Beyond Precision: Importance-Aware Recall for Factuality Evaluation in Long-Form LLM Generation.

James Allan 0001 University of Massachusetts Amherst, USA http://ciir.cs.umass.edu/~allan/ https://orcid.org/0000-0003-0132-5694 https://www.wikidata.org/entity/Q106519743 https://en.wikipedia.org/wiki/James_Allan_(computer_scientist) https://scholar.google.com/citations?user=-bLGeg0AAAAJ James Allan James Allan 0002 Urban Energy Systems Laboratory, Dübendorf, Switzerland https://orcid.org/0000-0001-8763-5831

Nazanin Jafari James Allan 0001 Mohit Iyyer Beyond Precision: Importance-Aware Recall for Factuality Evaluation in Long-Form LLM Generation. 2026 April abs/2604.03141 CoRR https://doi.org/10.48550/arXiv.2604.03141 db/journals/corr/corr2604.html#abs-2604-03141 streams/journals/corr

Johanne R. Trippas J. Shane Culpepper Mohammad Aliannejadi James Allan 0001 Enrique Amigó Jaime Arguello Leif Azzopardi Peter Bailey Jamie Callan Rob Capra 0001 Nick Craswell W. Bruce Croft Jeff Dalton 0001 Gianluca Demartini Laura Dietz Zhicheng Dou Carsten Eickhoff Michael D. Ekstrand Nicola Ferro 0001 Norbert Fuhr Dorota Glowacka Faegheh Hasibi Danula Hettiachchi Rosie Jones Jaap Kamps Noriko Kando Sarvnaz Karimi Makoto P. Kato Bevan Koopman Yiqun Liu 0001 Chenglong Ma 0001 Joel Mackenzie Maria Maistro Jiaxin Mao Dana McKay Bhaskar Mitra 0001 Stefano Mizzaro Alistair Moffat Josiane Mothe Iadh Ounis Lida Rashidi Yongli Ren Mark Sanderson Rodrygo L. T. Santos Falk Scholer Chirag Shah 0001 Laurianne Sitbon Ian Soboroff Damiano Spina Paul Thomas 0001 Julián Urbano Arjen P. de Vries Ryen White Abby Yuan Hamed Zamani Oleg Zendel Min Zhang 0006 Shengyao Zhuang Justin Zobel Guido Zuccon Report from the 4th Strategic Workshop on Information Retrieval in Lorne (SWIRL 2025). 1-68 2025 June 59 SIGIR Forum 1 https://doi.org/10.1145/3769733.3769739 db/journals/sigir/sigir59.html#TrippasCAAAAABCCCCDDDDE25 streams/journals/sigir

Tanya Chowdhury Yair Zick James Allan 0001 RankSHAP: Shapley Value Based Feature Attributions for Learning to Rank. 2025 ICLR https://openreview.net/forum?id=4011PUI9vm conf/iclr/2025 db/conf/iclr/iclr2025.html#ChowdhuryZA25 Tanya Chowdhury Atharva Nijasure James Allan 0001 Probing Ranking LLMs: A Mechanistic Analysis for Information Retrieval. 336-346 2025 ICTIR https://doi.org/10.1145/3731120.3744603 conf/ictir/2025 db/conf/ictir/ictir2025.html#ChowdhuryNA25 Nazanin Jafari James Allan 0001 Reducing the Emotional Distress of Content Moderators through LLM-based Target Substitution in Implicit and Explicit Hate-Speech. 255-264 2025 UMAP (Adjunct Publication) https://doi.org/10.1145/3708319.3733712 conf/um/2025a db/conf/um/umap2025a.html#JafariA25

Atharva Nijasure Tanya Chowdhury James Allan 0001 How Relevance Emerges: Interpreting LoRA Fine-Tuning in Reranking LLMs. 2025 April abs/2504.08780 CoRR https://doi.org/10.48550/arXiv.2504.08780 db/journals/corr/corr2504.html#abs-2504-08780 streams/journals/corr

Tanya Chowdhury Atharva Nijasure Yair Zick James Allan 0001 Hedonic Neurons: A Mechanistic Mapping of Latent Coalitions in Transformer MLPs. 2025 September abs/2509.23684 CoRR https://doi.org/10.48550/arXiv.2509.23684 db/journals/corr/corr2509.html#abs-2509-23684 streams/journals/corr

Zhiqi Huang 0002 Puxuan Yu Shauli Ravfogel James Allan 0001 Language Concept Erasure for Language-invariant Dense Retrieval. 13261-13273 2024 EMNLP https://doi.org/10.18653/v1/2024.emnlp-main.736 https://aclanthology.org/2024.emnlp-main.736 conf/emnlp/2024 db/conf/emnlp/emnlp2024.html#HuangYRA24 Youngwoo Kim Razieh Rahimi James Allan 0001 Discovering Biases in Information Retrieval Models Using Relevance Thesaurus as Global Explanation. 19530-19547 2024 EMNLP https://doi.org/10.18653/v1/2024.emnlp-main.1089 https://aclanthology.org/2024.emnlp-main.1089 conf/emnlp/2024 db/conf/emnlp/emnlp2024.html#KimRA24 Nazanin Jafari James Allan 0001 Sheikh Muhammad Sarwar Target Span Detection for Implicit Harmful Content. 117-122 2024 ICTIR https://doi.org/10.1145/3664190.3672525 conf/ictir/2024 db/conf/ictir/ictir2024.html#JafariAS24

Nazanin Jafari James Allan 0001 Target Span Detection for Implicit Harmful Content. 2024 abs/2403.19836 CoRR https://doi.org/10.48550/arXiv.2403.19836 db/journals/corr/corr2403.html#abs-2403-19836

Tanya Chowdhury Yair Zick James Allan 0001 RankSHAP: a Gold Standard Feature Attribution Method for the Ranking Task. 2024 abs/2405.01848 CoRR https://doi.org/10.48550/arXiv.2405.01848 db/journals/corr/corr2405.html#abs-2405-01848

Nazanin Jafari James Allan 0001 Robust Claim Verification Through Fact Detection. 2024 abs/2407.18367 CoRR https://doi.org/10.48550/arXiv.2407.18367 db/journals/corr/corr2407.html#abs-2407-18367 streams/journals/corr

Youngwoo Kim Razieh Rahimi James Allan 0001 Discovering Biases in Information Retrieval Models Using Relevance Thesaurus as Global Explanation. 2024 abs/2410.03584 CoRR https://doi.org/10.48550/arXiv.2410.03584 db/journals/corr/corr2410.html#abs-2410-03584 streams/journals/corr

Tanya Chowdhury James Allan 0001 Probing Ranking LLMs: Mechanistic Interpretability in Information Retrieval. 2024 abs/2410.18527 CoRR https://doi.org/10.48550/arXiv.2410.18527 db/journals/corr/corr2410.html#abs-2410-18527 streams/journals/corr

James Allan 0001 Eunsol Choi Daniel P. Lopresti Hamed Zamani Future of Information Retrieval Research in the Age of Generative AI. 2024 abs/2412.02043 CoRR https://doi.org/10.48550/arXiv.2412.02043 db/journals/corr/corr2412.html#abs-2412-02043 streams/journals/corr

Puxuan Yu Razieh Rahimi Zhiqi Huang 0002 James Allan 0001 Search Result Diversification Using Query Aspects as Bottlenecks. 3040-3051 2023 CIKM https://doi.org/10.1145/3583780.3615050 conf/cikm/2023 db/conf/cikm/cikm2023.html#YuRHA23 Dong-Ho Lee Ravi Kiran Selvam Sheikh Muhammad Sarwar Bill Yuchen Lin Fred Morstatter Jay Pujara Elizabeth Boschee James Allan 0001 Xiang Ren 0001 AutoTriggER: Label-Efficient and Robust Named Entity Recognition with Auxiliary Trigger Extraction. 3003-3017 2023 EACL https://doi.org/10.18653/v1/2023.eacl-main.219 https://aclanthology.org/2023.eacl-main.219 conf/eacl/2023 db/conf/eacl/eacl2023.html#LeeSSLMPBAR23 Youngwoo Kim Razieh Rahimi James Allan 0001 Conditional Natural Language Inference. 6833-6851 2023 EMNLP (Findings) https://doi.org/10.18653/v1/2023.findings-emnlp.456 https://aclanthology.org/2023.findings-emnlp.456 conf/emnlp/2023f db/conf/emnlp/emnlp2023f.html#KimRA23 Tanya Chowdhury Razieh Rahimi James Allan 0001 Rank-LIME: Local Model-Agnostic Feature Attribution for Learning to Rank. 33-37 2023 ICTIR https://doi.org/10.1145/3578337.3605138 conf/ictir/2023 db/conf/ictir/ictir2023.html#ChowdhuryRA23 Zhiqi Huang 0002 Shahrzad Naseri Hamed R. Bonab Sheikh Muhammad Sarwar James Allan 0001 Hierarchical Transformer-based Query by Multiple Documents. 105-115 2023 ICTIR https://doi.org/10.1145/3578337.3605130 https://www.wikidata.org/entity/Q130867018 conf/ictir/2023 db/conf/ictir/ictir2023.html#HuangNBSA23 Zhiqi Huang 0002 Hansi Zeng Hamed Zamani James Allan 0001 Soft Prompt Decoding for Multilingual Dense Retrieval. 1208-1218 2023 SIGIR https://doi.org/10.1145/3539618.3591769 conf/sigir/2023 db/conf/sigir/sigir2023.html#HuangZZA23 Negin Ghasemi Mohammad Aliannejadi Hamed R. Bonab Evangelos Kanoulas Arjen P. de Vries James Allan 0001 Djoerd Hiemstra Cross-Market Product-Related Question Answering. 1293-1302 2023 SIGIR https://doi.org/10.1145/3539618.3591658 conf/sigir/2023 db/conf/sigir/sigir2023.html#GhasemiABKVAH23 Zhiqi Huang 0002 Puxuan Yu James Allan 0001 UMass at TREC 2023 NeuCLIR Track. 2023 TREC https://trec.nist.gov/pubs/trec32/papers/CIIR.N.pdf conf/trec/2023 db/conf/trec/trec2023.html#HuangYA23 streams/conf/trec Zhiqi Huang 0002 Puxuan Yu James Allan 0001 Improving Cross-lingual Information Retrieval on Low-Resource Languages via Optimal Transport Distillation. 1048-1056 2023 WSDM https://doi.org/10.1145/3539597.3570468 conf/wsdm/2023 db/conf/wsdm/wsdm2023.html#HuangYA23

Zhiqi Huang 0002 Puxuan Yu James Allan 0001 Improving Cross-lingual Information Retrieval on Low-Resource Languages via Optimal Transport Distillation. 2023 abs/2301.12566 CoRR https://doi.org/10.48550/arXiv.2301.12566 db/journals/corr/corr2301.html#abs-2301-12566

Zhiqi Huang 0002 Puxuan Yu James Allan 0001 Cross-lingual Knowledge Transfer via Distillation for Multilingual Information Retrieval. 2023 abs/2302.13400 CoRR https://doi.org/10.48550/arXiv.2302.13400 db/journals/corr/corr2302.html#abs-2302-13400

Ali Montazeralghaem James Allan 0001 Evaluating the Robustness of Conversational Recommender Systems by Adversarial Examples. 2023 abs/2303.05575 CoRR https://doi.org/10.48550/arXiv.2303.05575 db/journals/corr/corr2303.html#abs-2303-05575

Zhiqi Huang 0002 Hansi Zeng Hamed Zamani James Allan 0001 Soft Prompt Decoding for Multilingual Dense Retrieval. 2023 abs/2305.09025 CoRR https://doi.org/10.48550/arXiv.2305.09025 db/journals/corr/corr2305.html#abs-2305-09025

Abhishek Madaan Tanya Chowdhury Neha Rana James Allan 0001 Tanmoy Chakraborty 0002 Uncertainty in Additive Feature Attribution methods. 2023 abs/2311.17446 CoRR https://doi.org/10.48550/arXiv.2311.17446 db/journals/corr/corr2311.html#abs-2311-17446

Shahrzad Naseri Jeffrey Dalton 0001 Andrew Yates James Allan 0001 CEQE to SQET: A study of contextualized embeddings for query expansion. 184-208 2022 25 Inf. Retr. J. 2 https://doi.org/10.1007/s10791-022-09405-y db/journals/ir/ir25.html#NaseriDYA22

Edward Kai Fung Dang Robert Wing Pong Luk James Allan 0001 A retrieval model family based on the probability ranking principle for ad hoc retrieval. 1140-1154 2022 73 J. Assoc. Inf. Sci. Technol. 8 https://doi.org/10.1002/asi.24619 db/journals/jasis/jasis73.html#DangLA22

Edward Kai Fung Dang Robert Wing Pong Luk James Allan 0001 A Comparison between Term-Independence Retrieval Models for Ad Hoc Retrieval. 62:1-62:37 2022 40 ACM Trans. Inf. Syst. 3 https://doi.org/10.1145/3483612 db/journals/tois/tois40.html#DangLA22

Tanya Chowdhury Razieh Rahimi James Allan 0001 Equi-explanation Maps: Concise and Informative Global Summary Explanations. 464-472 2022 FAccT https://doi.org/10.1145/3531146.3533112 conf/fat/2022 db/conf/fat/facct2022.html#ChowdhuryRA22 Ali Montazeralghaem James Allan 0001 Extracting Relevant Information from User's Utterances in Conversational Search and Recommendation. 1275-1283 2022 KDD https://doi.org/10.1145/3534678.3539471 conf/kdd/2022 db/conf/kdd/kdd2022.html#Montazeralghaem22 Puxuan Yu Razieh Rahimi James Allan 0001 Towards Explainable Search Results: A Listwise Explanation Generator. 669-680 2022 SIGIR https://doi.org/10.1145/3477495.3532067 https://www.wikidata.org/entity/Q130868704 conf/sigir/2022 db/conf/sigir/sigir2022.html#YuRA22 Youngwoo Kim Razieh Rahimi James Allan 0001 Alignment Rationale for Query-Document Relevance. 2489-2494 2022 SIGIR https://doi.org/10.1145/3477495.3531883 conf/sigir/2022 db/conf/sigir/sigir2022.html#KimRA22 Ali Montazeralghaem James Allan 0001 Learning Relevant Questions for Conversational Product Search using Deep Reinforcement Learning. 746-754 2022 WSDM https://doi.org/10.1145/3488560.3498526 conf/wsdm/2022 db/conf/wsdm/wsdm2022.html#Montazeralghaem22

Tanya Chowdhury Razieh Rahimi James Allan 0001 Rank-LIME: Local Model-Agnostic Feature Attribution for Learning to Rank. 2022 abs/2212.12722 CoRR https://doi.org/10.48550/arXiv.2212.12722 db/journals/corr/corr2212.html#abs-2212-12722

Edward Kai Fung Dang Robert Wing Pong Luk James Allan 0001 A Principled Approach Using Fuzzy Set Theory for Passage-Based Document Retrieval. 1967-1977 2021 29 IEEE Trans. Fuzzy Syst. 7 https://doi.org/10.1109/TFUZZ.2020.2990110 db/journals/tfs/tfs29.html#DangLA21

Hamed R. Bonab Mohammad Aliannejadi Ali Vardasbi Evangelos Kanoulas James Allan 0001 Cross-Market Product Recommendation. 110-119 2021 CIKM https://doi.org/10.1145/3459637.3482493 conf/cikm/2021 db/conf/cikm/cikm2021.html#BonabAVKA21 Zhiqi Huang 0002 Hamed R. Bonab Sheikh Muhammad Sarwar Razieh Rahimi James Allan 0001 Mixed Attention Transformer for Leveraging Word-Level Knowledge to Neural Cross-Lingual Information Retrieval. 760-770 2021 CIKM https://doi.org/10.1145/3459637.3482452 conf/cikm/2021 db/conf/cikm/cikm2021.html#HuangBSRA21 Youngwoo Kim Razieh Rahimi Hamed R. Bonab James Allan 0001 Query-driven Segment Selection for Ranking Long Documents. 3147-3151 2021 CIKM https://doi.org/10.1145/3459637.3482101 conf/cikm/2021 db/conf/cikm/cikm2021.html#KimRBA21 Shahrzad Naseri Jeff Dalton 0001 Andrew Yates James Allan 0001 CEQE: Contextualized Embeddings for Query Expansion. 467-482 2021 ECIR (1) https://doi.org/10.1007/978-3-030-72113-8_31 conf/ecir/2021-1 db/conf/ecir/ecir2021-1.html#NaseriDYA21 Lakshmi Vikraman Ali Montazeralghaem Helia Hashemi W. Bruce Croft James Allan 0001 Passage Similarity and Diversification in Non-factoid Question Answering. 271-280 2021 ICTIR https://doi.org/10.1145/3471158.3472249 conf/ictir/2021 db/conf/ictir/ictir2021.html#VikramanMHCA21 Masaharu Yoshioka Norihiko Tatsunami Masahiko Itoh Noriko Kando James Allan 0001 Interactive Visualization of the Polarity-based Stance of News Websites using News Genres (short paper). 62-69 2021 INRA@RecSys https://ceur-ws.org/Vol-3143/paper6.pdf conf/recsys/2021inra db/conf/recsys/inra2021.html#YoshiokaTIKA21 Ali Montazeralghaem James Allan 0001 Philip S. Thomas Large-scale Interactive Conversational Recommendation System using Actor-Critic Framework. 220-229 2021 RecSys https://doi.org/10.1145/3460231.3474271 conf/recsys/2021 db/conf/recsys/recsys2021.html#Montazeralghaem21 Mohammad Aliannejadi Hamed R. Bonab Ali Vardasbi Evangelos Kanoulas James Allan 0001 Vanessa Murdock 0001 XMRec: Workshop on Cross-Market Recommendation. 817-818 2021 RecSys https://doi.org/10.1145/3460231.3470934 conf/recsys/2021 db/conf/recsys/recsys2021.html#AliannejadiBVKA21 Sheikh Muhammad Sarwar Felipe Moraes Jiepu Jiang James Allan 0001 Utility of Missing Concepts in Query-biased Summarization. 2056-2060 2021 SIGIR https://doi.org/10.1145/3404835.3463121 conf/sigir/2021 db/conf/sigir/sigir2021.html#SarwarMJA21 Zhiqi Huang 0002 Razieh Rahimi Puxuan Yu Jingbo Shang James Allan 0001 AutoName: A Corpus-Based Set Naming Framework. 2101-2105 2021 SIGIR https://doi.org/10.1145/3404835.3463100 conf/sigir/2021 db/conf/sigir/sigir2021.html#HuangRYSA21

Shahrzad Naseri Jeffrey Dalton 0001 Andrew Yates James Allan 0001 CEQE: Contextualized Embeddings for Query Expansion. 2021 abs/2103.05256 CoRR https://arxiv.org/abs/2103.05256 db/journals/corr/corr2103.html#abs-2103-05256

Zhiqi Huang 0002 Hamed R. Bonab Sheikh Muhammad Sarwar Razieh Rahimi James Allan 0001 Mixed Attention Transformer for Leveraging Word-Level Knowledge to Neural Cross-Lingual Information Retrieval. 2021 abs/2109.02789 CoRR https://arxiv.org/abs/2109.02789 db/journals/corr/corr2109.html#abs-2109-02789

Youngwoo Kim Razieh Rahimi Hamed R. Bonab James Allan 0001 Query-driven Segment Selection for Ranking Long Documents. 2021 abs/2109.04611 CoRR https://arxiv.org/abs/2109.04611 db/journals/corr/corr2109.html#abs-2109-04611

Dong-Ho Lee Ravi Kiran Selvam Sheikh Muhammad Sarwar Bill Yuchen Lin Mahak Agarwal Fred Morstatter Jay Pujara Elizabeth Boschee James Allan 0001 Xiang Ren 0001 AutoTriggER: Named Entity Recognition with Auxiliary Trigger Extraction. 2021 abs/2109.04726 CoRR https://arxiv.org/abs/2109.04726 db/journals/corr/corr2109.html#abs-2109-04726

Hamed R. Bonab Mohammad Aliannejadi Ali Vardasbi Evangelos Kanoulas James Allan 0001 Cross-Market Product Recommendation. 2021 abs/2109.05929 CoRR https://arxiv.org/abs/2109.05929 db/journals/corr/corr2109.html#abs-2109-05929

Razieh Rahimi Youngwoo Kim Hamed Zamani James Allan 0001 Explaining Documents' Relevance to Search Queries. 2021 abs/2111.01314 CoRR https://arxiv.org/abs/2111.01314 db/journals/corr/corr2111.html#abs-2111-01314

Edward Kai Fung Dang Robert Wing Pong Luk James Allan 0001 Context-Dependent Feature Values in Text Categorization. 1199-1219 2020 30 Int. J. Softw. Eng. Knowl. Eng. 9 https://doi.org/10.1142/S021819402050031X db/journals/ijseke/ijseke30.html#DangLA20

Youngwoo Kim Myungha Jang James Allan 0001 Explaining Text Matching on Neural Natural Language Inference. 39:1-39:23 2020 38 ACM Trans. Inf. Syst. 4 https://doi.org/10.1145/3418052 db/journals/tois/tois38.html#KimJA20

Ali Montazeralghaem Razieh Rahimi James Allan 0001 Relevance Ranking Based on Query-Aware Context Analysis. 446-460 2020 ECIR (1) https://doi.org/10.1007/978-3-030-45439-5_30 conf/ecir/2020-1 db/conf/ecir/ecir2020-1.html#Montazeralghaem20 Puxuan Yu Razieh Rahimi Zhiqi Huang 0002 James Allan 0001 Learning to Rank Entities for Set Expansion from Unstructured Data. 21-28 2020 ICTIR https://doi.org/10.1145/3409256.3409811 https://www.wikidata.org/entity/Q130922532 conf/ictir/2020 db/conf/ictir/ictir2020.html#YuRHA20 Sheikh Muhammad Sarwar Raghavendra Addanki Ali Montazeralghaem Soumyabrata Pal James Allan 0001 Search Result Diversification with Guarantee of Topic Proportionality. 53-60 2020 ICTIR https://doi.org/10.1145/3409256.3409839 conf/ictir/2020 db/conf/ictir/ictir2020.html#SarwarAMPA20 Hamed R. Bonab Sheikh Muhammad Sarwar James Allan 0001 Training Effective Neural CLIR by Bridging the Translation Gap. 9-18 2020 SIGIR https://doi.org/10.1145/3397271.3401035 conf/sigir/2020 db/conf/sigir/sigir2020.html#BonabSA20 Ali Montazeralghaem Hamed Zamani James Allan 0001 A Reinforcement Learning Framework for Relevance Feedback. 59-68 2020 SIGIR https://doi.org/10.1145/3397271.3401099 conf/sigir/2020 db/conf/sigir/sigir2020.html#Montazeralghaem20 Sheikh Muhammad Sarwar James Allan 0001 Query by Example for Cross-Lingual Event Retrieval. 1601-1604 2020 SIGIR https://doi.org/10.1145/3397271.3401283 conf/sigir/2020 db/conf/sigir/sigir2020.html#SarwarA20 Puxuan Yu James Allan 0001 A Study of Neural Matching Models for Cross-lingual IR. 1637-1640 2020 SIGIR https://doi.org/10.1145/3397271.3401322 conf/sigir/2020 db/conf/sigir/sigir2020.html#YuA20

Puxuan Yu James Allan 0001 A Study of Neural Matching Models for Cross-lingual IR. 2020 abs/2005.12994 CoRR https://arxiv.org/abs/2005.12994 db/journals/corr/corr2005.html#abs-2005-12994

Sheikh Muhammad Sarwar Hamed R. Bonab James Allan 0001 A Multi-Task Architecture on Relevance-based Neural Query Translation. 6339-6344 2019 ACL (1) https://doi.org/10.18653/v1/p19-1639 https://aclanthology.org/P19-1639/ conf/acl/2019-1 db/conf/acl/acl2019-1.html#SarwarBA19 Jeffrey Dalton 0001 Shahrzad Naseri Laura Dietz James Allan 0001 Local and Global Query Expansion for Hierarchical Complex Topics. 290-303 2019 ECIR (1) https://doi.org/10.1007/978-3-030-15712-8_19 conf/ecir/2019-1 db/conf/ecir/ecir2019-1.html#DaltonNDA19 Youngwoo Kim James Allan 0001 Unsupervised Explainable Controversy Detection from Online News. 836-843 2019 ECIR (1) https://doi.org/10.1007/978-3-030-15712-8_60 conf/ecir/2019-1 db/conf/ecir/ecir2019-1.html#KimA19 Hamed R. Bonab Mohammad Aliannejadi John Foley James Allan 0001 Incorporating Hierarchical Domain Information to Disambiguate Very Short Queries. 51-54 2019 ICTIR https://doi.org/10.1145/3341981.3344251 conf/ictir/2019 db/conf/ictir/ictir2019.html#BonabAFA19 Razieh Rahimi Ali Montazeralghaem James Allan 0001 Listwise Neural Ranking Models. 101-104 2019 ICTIR https://doi.org/10.1145/3341981.3344245 conf/ictir/2019 db/conf/ictir/ictir2019.html#RahimiMA19 Hamed R. Bonab James Allan 0001 Ramesh K. Sitaraman Simulating CLIR Translation Resource Scarcity using High-resource Languages. 129-136 2019 ICTIR https://doi.org/10.1145/3341981.3344236 conf/ictir/2019 db/conf/ictir/ictir2019.html#BonabAS19 Ali Montazeralghaem Razieh Rahimi James Allan 0001 Term Discrimination Value for Cross-Language Information Retrieval. 137-140 2019 ICTIR https://doi.org/10.1145/3341981.3344252 conf/ictir/2019 db/conf/ictir/ictir2019.html#Montazeralghaem19 Sheikh Muhammad Sarwar John Foley Liu Yang 0005 James Allan 0001 Sentence Retrieval for Entity List Extraction with a Seed, Context, and Topic. 209-212 2019 ICTIR https://doi.org/10.1145/3341981.3344250 conf/ictir/2019 db/conf/ictir/ictir2019.html#SarwarFYA19 Sheikh Muhammad Sarwar James Allan 0001 SearchIE: A Retrieval Approach for Information Extraction. 249-252 2019 ICTIR https://doi.org/10.1145/3341981.3344248 conf/ictir/2019 db/conf/ictir/ictir2019.html#SarwarA19 Puxuan Yu Zhiqi Huang 0002 Razieh Rahimi James Allan 0001 Corpus-based Set Expansion with Lexical Features and Distributed Representations. 1153-1156 2019 SIGIR https://doi.org/10.1145/3331184.3331359 conf/sigir/2019 db/conf/sigir/sigir2019.html#YuHRA19 Yi Fang 0008 Yi Zhang 0001 James Allan 0001 Krisztian Balog Ben Carterette Jiafeng Guo Proceedings of the 2019 ACM SIGIR International Conference on Theory of Information Retrieval, ICTIR 2019, Santa Clara, CA, USA, October 2-5, 2019. ACM ICTIR 2019 978-1-4503-6881-0 https://doi.org/10.1145/3341981 https://www.wikidata.org/entity/Q131390276 db/conf/ictir/ictir2019.html

Sheikh Muhammad Sarwar Hamed R. Bonab James Allan 0001 A Multi-Task Architecture on Relevance-based Neural Query Translation. 2019 abs/1906.06849 CoRR http://arxiv.org/abs/1906.06849 db/journals/corr/corr1906.html#abs-1906-06849

Shahrzad Naseri Sheikh Muhammad Sarwar James Allan 0001 Semantic Driven Fielded Entity Retrieval. 2019 abs/1907.01457 CoRR http://arxiv.org/abs/1907.01457 db/journals/corr/corr1907.html#abs-1907-01457

Sheikh Muhammad Sarwar John Foley James Allan 0001 Term Relevance Feedback for Contextual Named Entity Retrieval. 301-304 2018 CHIIR https://doi.org/10.1145/3176349.3176886 conf/chiir/2018 db/conf/chiir/chiir2018.html#SarwarFA18 Shahrzad Naseri John Foley James Allan 0001 Brendan T. O'Connor 0001 Exploring Summary-Expanded Entity Embeddings for Entity Retrieval. 2018 CIKM Workshops https://ceur-ws.org/Vol-2482/paper7.pdf conf/cikm/2018w db/conf/cikm/cikm2018w.html#NaseriFAO18 Masaharu Yoshioka Myungha Jang James Allan 0001 Noriko Kando Visualizing Polarity-based Stances of News Websites. 6-8 2018 NewsIR@ECIR https://ceur-ws.org/Vol-2079/paper2.pdf conf/ecir/2018newsir db/conf/ecir/newsir2018.html#YoshiokaJAK18 Daniel Cohen John Foley Hamed Zamani James Allan 0001 W. Bruce Croft Universal Approximation Functions for Fast Learning to Rank: Replacing Expensive Regression Forests with Simple Feed-Forward Networks. 1017-1020 2018 SIGIR https://doi.org/10.1145/3209978.3210137 conf/sigir/2018 db/conf/sigir/sigir2018.html#CohenFZAC18 Hamed R. Bonab Hamed Zamani Erik G. Learned-Miller James Allan 0001 Citation Worthiness of Sentences in Scientific Reports. 1061-1064 2018 SIGIR https://doi.org/10.1145/3209978.3210162 conf/sigir/2018 db/conf/sigir/sigir2018.html#BonabZLA18 Myungha Jang James Allan 0001 Explaining Controversy on Social Media via Stance Summarization. 1221-1224 2018 SIGIR https://doi.org/10.1145/3209978.3210143 conf/sigir/2018 db/conf/sigir/sigir2018.html#JangA18 Shahrzad Naseri John Foley James Allan 0001 UMass at TREC 2018: CAR, Common Core and News Tracks. 2018 TREC https://trec.nist.gov/pubs/trec27/papers/UMass-CAR-CC-N.pdf conf/trec/2018 db/conf/trec/trec2018.html#NaseriFA18 Alfredo Cuzzocrea James Allan 0001 Norman W. Paton Divesh Srivastava Rakesh Agrawal 0001 Andrei Z. Broder Mohammed J. Zaki K. Selçuk Candan Alexandros Labrinidis Assaf Schuster Haixun Wang Proceedings of the 27th ACM International Conference on Information and Knowledge Management, CIKM 2018, Torino, Italy, October 22-26, 2018 ACM CIKM 2018 978-1-4503-6014-2 http://dl.acm.org/citation.cfm?id=3269206 db/conf/cikm/cikm2018.html

Sheikh Muhammad Sarwar John Foley James Allan 0001 Term Relevance Feedback for Contextual Named Entity Retrieval. 2018 abs/1801.02687 CoRR http://arxiv.org/abs/1801.02687 db/journals/corr/corr1801.html#abs-1801-02687

John Foley Sheikh Muhammad Sarwar James Allan 0001 Named Entity Recognition with Extremely Limited Data. 2018 abs/1806.04411 CoRR http://arxiv.org/abs/1806.04411 db/journals/corr/corr1806.html#abs-1806-04411

Myungha Jang James Allan 0001 Explaining Controversy on Social Media via Stance Summarization. 2018 abs/1806.07942 CoRR http://arxiv.org/abs/1806.07942 db/journals/corr/corr1806.html#abs-1806-07942

James Allan 0001 Nicholas J. Belkin Paul N. Bennett Jamie Callan Charles L. A. Clarke Fernando Diaz 0001 Susan T. Dumais Nicola Ferro 0001 Donna Harman Djoerd Hiemstra Ian Ruthven Tetsuya Sakai Mark D. Smucker Justin Zobel Overview of Special Issue. 1-25 2017 51 SIGIR Forum 2 https://doi.org/10.1145/3130348.3130350 db/journals/sigir/sigir51.html#AllanBBCCDDFHHR17

James Allan 0001 Ron Papka Victor Lavrenko On-Line New Event Detection and Tracking. 185-193 2017 51 SIGIR Forum 2 https://doi.org/10.1145/3130348.3130366 db/journals/sigir/sigir51.html#AllanPL17

Myungha Jang Jinho D. Choi James Allan 0001 Improving Document Clustering by Removing Unnatural Language. 122-130 2017 NUT@EMNLP https://doi.org/10.18653/v1/w17-4416 https://aclanthology.org/W17-4416/ conf/aclnut/2017 db/conf/aclnut/aclnut2017.html#JangCA17 Jiepu Jiang Daqing He Diane Kelly 0001 James Allan 0001 Understanding Ephemeral State of Relevance. 137-146 2017 CHIIR https://doi.org/10.1145/3020165.3020176 conf/chiir/2017 db/conf/chiir/chiir2017.html#JiangH0A17 Jiepu Jiang James Allan 0001 Similarity-based Distant Supervision for Definition Retrieval. 527-536 2017 CIKM https://doi.org/10.1145/3132847.3133032 conf/cikm/2017 db/conf/cikm/cikm2017.html#JiangA17 Jiepu Jiang James Allan 0001 Adaptive Persistence for Search Effectiveness Measures. 747-756 2017 CIKM https://doi.org/10.1145/3132847.3133033 conf/cikm/2017 db/conf/cikm/cikm2017.html#JiangA17a Myungha Jang Shiri Dori-Hacohen James Allan 0001 Modeling Controversy within Populations. 141-149 2017 ICTIR https://doi.org/10.1145/3121050.3121067 https://www.wikidata.org/entity/Q130875298 conf/ictir/2017 db/conf/ictir/ictir2017.html#JangDA17 Jiepu Jiang Daqing He James Allan 0001 Comparing In Situ and Multidimensional Relevance Judgments. 405-414 2017 SIGIR https://doi.org/10.1145/3077136.3080840 conf/sigir/2017 db/conf/sigir/sigir2017.html#JiangHA17 Qingyao Ai Hamed Zamani Stephen M. Harding Shahrzad Naseri James Allan 0001 W. Bruce Croft UMass at TREC 2017 Common Core Track. 2017 TREC https://trec.nist.gov/pubs/trec26/papers/UMass-CC.pdf conf/trec/2017 db/conf/trec/trec2017.html#AiZHNAC17 James Allan 0001 Donna Harman Evangelos Kanoulas Dan Li 0015 Christophe Van Gysel Ellen M. Voorhees TREC 2017 Common Core Track Overview. 2017 TREC https://trec.nist.gov/pubs/trec26/papers/Overview-CC.pdf conf/trec/2017 db/conf/trec/trec2017.html#AllanHKLGV17

Myungha Jang Jinho D. Choi James Allan 0001 Improving Document Clustering by Eliminating Unnatural Language. 2017 abs/1703.05706 CoRR http://arxiv.org/abs/1703.05706 db/journals/corr/corr1703.html#JangCA17

Shiri Dori-Hacohen Myungha Jang James Allan 0001 Is Climate Change Controversial? Modeling Controversy as Contention Within Populations. 2017 abs/1703.10111 CoRR http://arxiv.org/abs/1703.10111 db/journals/corr/corr1703.html#Dori-HacohenJA17

Edward Kai Fung Dang Robert W. P. Luk James Allan 0001 A context-dependent relevance model. 582-593 2016 67 J. Assoc. Inf. Sci. Technol. 3 https://doi.org/10.1002/asi.23419 db/journals/jasis/jasis67.html#DangLA16

Jiepu Jiang James Allan 0001 Correlation Between System and User Metrics in a Session. 285-288 2016 CHIIR https://doi.org/10.1145/2854946.2855005 conf/chiir/2016 db/conf/chiir/chiir2016.html#JiangA16 Weize Kong James Allan 0001 Precision-Oriented Query Facet Extraction. 1433-1442 2016 CIKM https://doi.org/10.1145/2983323.2983824 conf/cikm/2016 db/conf/cikm/cikm2016.html#KongA16 John Foley Brendan O'Connor 0001 James Allan 0001 Improving Entity Ranking for Keyword Queries. 2061-2064 2016 CIKM https://doi.org/10.1145/2983323.2983909 conf/cikm/2016 db/conf/cikm/cikm2016.html#FoleyOA16 Myungha Jang John Foley Shiri Dori-Hacohen James Allan 0001 Probabilistic Approaches to Controversy Detection. 2069-2072 2016 CIKM https://doi.org/10.1145/2983323.2983911 https://www.wikidata.org/entity/Q130879620 conf/cikm/2016 db/conf/cikm/cikm2016.html#JangFDA16 Jiepu Jiang James Allan 0001 Adaptive Effort for Search Evaluation Metrics. 187-199 2016 ECIR https://doi.org/10.1007/978-3-319-30671-1_14 conf/ecir/2016 db/conf/ecir/ecir2016.html#JiangA16 John Foley James Allan 0001 Retrieving Hierarchical Syllabus Items for Exam Question Analysis. 575-586 2016 ECIR https://doi.org/10.1007/978-3-319-30671-1_42 conf/ecir/2016 db/conf/ecir/ecir2016.html#FoleyA16 Nada Naji James Allan 0001 On Cross-Script Information Retrieval. 796-802 2016 ECIR https://doi.org/10.1007/978-3-319-30671-1_70 conf/ecir/2016 db/conf/ecir/ecir2016.html#NajiA16 Shiri Dori-Hacohen David D. Jensen James Allan 0001 Controversy Detection in Wikipedia Using Collective Classification. 797-800 2016 SIGIR https://doi.org/10.1145/2911451.2914745 https://www.wikidata.org/entity/Q87833348 conf/sigir/2016 db/conf/sigir/sigir2016.html#Dori-HacohenJA16 Myungha Jang James Allan 0001 Improving Automated Controversy Detection on the Web. 865-868 2016 SIGIR https://doi.org/10.1145/2911451.2914764 https://www.wikidata.org/entity/Q130875377 conf/sigir/2016 db/conf/sigir/sigir2016.html#JangA16 Jiepu Jiang James Allan 0001 Reducing Click and Skip Errors in Search Result Ranking. 183-192 2016 WSDM https://doi.org/10.1145/2835776.2835838 conf/wsdm/2016 db/conf/wsdm/wsdm2016.html#JiangA16

Edward Kai Fung Dang Robert Wing Pong Luk James Allan 0001 Fast-Forward Index Methods for Pseudo-Relevance Feedback Retrieval. 19:1-19:33 2015 33 ACM Trans. Inf. Syst. 4 https://doi.org/10.1145/2744199 db/journals/tois/tois33.html#DangLA15

Shiri Dori-Hacohen James Allan 0001 Automated Controversy Detection on the Web. 423-434 2015 ECIR https://doi.org/10.1007/978-3-319-16354-3_46 conf/ecir/2015 db/conf/ecir/ecir2015.html#Dori-HacohenA15 Shiri Dori-Hacohen Elad Yom-Tov James Allan 0001 Navigating Controversy as a Complex Search Task. 2015 SCST@ECIR https://ceur-ws.org/Vol-1338/paper_3.pdf conf/ecir/2015scst db/conf/ecir/scst2015.html#Dori-HacohenYA15 John Foley James Allan 0001 Retrieving Time from Scanned Books. 221-232 2015 ECIR https://doi.org/10.1007/978-3-319-16354-3_24 conf/ecir/2015 db/conf/ecir/ecir2015.html#FoleyA15 David Wemhoener James Allan 0001 Balancing Aspects in Retrieved Search Results. 305-308 2015 ICTIR https://doi.org/10.1145/2808194.2809492 conf/ictir/2015 db/conf/ictir/ictir2015.html#WemhoenerA15 Weize Kong Rui Li 0049 Jie Luo Aston Zhang Yi Chang 0001 James Allan 0001 Predicting Search Intent Based on Pre-Search Context. 503-512 2015 SIGIR https://doi.org/10.1145/2766462.2767757 conf/sigir/2015 db/conf/sigir/sigir2015.html#KongLLZCA15 James Allan 0001 W. Bruce Croft Arjen P. de Vries Chengxiang Zhai Proceedings of the 2015 International Conference on The Theory of Information Retrieval, ICTIR 2015, Northampton, Massachusetts, USA, September 27-30, 2015 ICTIR ACM 2015 978-1-4503-3833-2 https://doi.org/10.1145/2808194 db/conf/ictir/ictir2015.html

Edward K. F. Dang Robert W. P. Luk James Allan 0001 Beyond bag-of-words: Bigram-enhanced context-dependent term weights. 1134-1148 2014 65 J. Assoc. Inf. Sci. Technol. 6 https://doi.org/10.1002/asi.23024 db/journals/jasis/jasis65.html#DangLA14

Weize Kong James Allan 0001 Extending Faceted Search to the General Web. 839-848 2014 CIKM https://doi.org/10.1145/2661829.2661964 conf/cikm/2014 db/conf/cikm/cikm2014.html#KongA14 Jeffrey Dalton 0001 Laura Dietz James Allan 0001 Entity query feature expansion using knowledge base links. 365-374 2014 SIGIR https://doi.org/10.1145/2600428.2609628 https://www.wikidata.org/entity/Q115619004 conf/sigir/2014 db/conf/sigir/sigir2014.html#DaltonDA14 Jiepu Jiang Daqing He James Allan 0001 Searching, browsing, and clicking in a search session: changes in user behavior by task and over time. 607-616 2014 SIGIR https://doi.org/10.1145/2600428.2609633 conf/sigir/2014 db/conf/sigir/sigir2014.html#JiangHA14 Jiepu Jiang James Allan 0001 Necessary and frequent terms in queries. 1167-1170 2014 SIGIR https://doi.org/10.1145/2600428.2609536 conf/sigir/2014 db/conf/sigir/sigir2014.html#JiangA14 Hui Cheng Jingen Liu Ishani Chakraborty Guang Chen Qiguang Liu Mohamed Elhoseiny Gary Gan Ajay Divakaran Harpreet S. Sawhney James Allan 0001 John Foley Mubarak Shah Afshin Dehghan Michael Witbrock Jon Curtis SRI-Sarnoff AURORA System at TRECVID 2014 Multimedia Event Detection and Recounting. 2014 TRECVID https://www-nlpir.nist.gov/projects/tvpubs/tv14.papers/sri_aurora.pdf conf/trecvid/2014 db/conf/trecvid/trecvid2014.html#ChengLCCLEGDSAF14 Henry Allen Feild James Allan 0001 Using CrowdLogger for in situ information retrieval system evaluation. 15-18 2013 LivingLab@CIKM https://doi.org/10.1145/2513150.2513164 conf/cikm/2013livinglab db/conf/cikm/livinglab2013.html#FeildA13 Shiri Dori-Hacohen James Allan 0001 Detecting controversy on the web. 1845-1848 2013 CIKM https://doi.org/10.1145/2505515.2507877 https://www.wikidata.org/entity/Q66711594 conf/cikm/2013 db/conf/cikm/cikm2013.html#Dori-HacohenA13 Jeffrey Dalton 0001 James Allan 0001 Pranav Mirajkar Zero-shot video retrieval using content and concepts. 1857-1860 2013 CIKM https://doi.org/10.1145/2505515.2507880 conf/cikm/2013 db/conf/cikm/cikm2013.html#DaltonAM13 Weize Kong Elif Aktolga James Allan 0001 Improving passage ranking with user behavior information. 1999-2008 2013 CIKM https://doi.org/10.1145/2505515.2505719 conf/cikm/2013 db/conf/cikm/cikm2013.html#KongAA13 Henry Allen Feild James Allan 0001 Task-aware query recommendation. 83-92 2013 SIGIR https://doi.org/10.1145/2484028.2484069 conf/sigir/2013 db/conf/sigir/sigir2013.html#FeildA13 Weize Kong James Allan 0001 Extracting query facets from search results. 93-102 2013 SIGIR https://doi.org/10.1145/2484028.2484097 conf/sigir/2013 db/conf/sigir/sigir2013.html#KongA13 Elif Aktolga James Allan 0001 Sentiment diversification with different biases. 593-602 2013 SIGIR https://doi.org/10.1145/2484028.2484060 conf/sigir/2013 db/conf/sigir/sigir2013.html#AktolgaA13 James Allan 0001 Jeff Dalton 0001 John Foley R. Manmatha Venkatesh N. Murthy David Wemhoener Short Text Queries for Video Retrieval Multimedia event Detection at TRECVID 2013. 2013 TRECVID https://www-nlpir.nist.gov/projects/tvpubs/tv13.papers/umass.pdf conf/trecvid/2013 db/conf/trecvid/trecvid2013.html#Allan0FMMW13 Jingen Liu Hui Cheng Omar Javed Qian Yu Ishani Chakraborty Weiyu Zhang Ajay Divakaran Harpreet S. Sawhney James Allan 0001 R. Manmatha John Foley Mubarak Shah Afshin Dehghan Michael Witbrock Jon Curtis Gerald Friedland SRI-Sarnoff AURORA System at TRECVID 2013 Multimedia Event Detection and Recounting. 2013 TRECVID https://www-nlpir.nist.gov/projects/tvpubs/tv13.papers/sriaurora_med_mer.pdf conf/trecvid/2013 db/conf/trecvid/trecvid2013.html#LiuCJYCZDSAMFSD13

James Allan 0001 W. Bruce Croft Alistair Moffat Mark Sanderson Frontiers, challenges, and opportunities for information retrieval: Report from SWIRL 2012 the second strategic workshop on information retrieval in Lorne. 2-32 2012 46 SIGIR Forum 1 https://doi.org/10.1145/2215676.2215678 db/journals/sigir/sigir46.html#AllanCMS12

Marc-Allen Cartright Jeffrey Dalton 0001 James Allan 0001 Search and exploration of scanned books. 9-10 2012 BooksOnline@CIKM https://doi.org/10.1145/2390116.2390122 conf/cikm/2012books db/conf/cikm/books2012.html#Cartright0A12 Mark D. Smucker James Allan 0001 Blagovest Dachev Human question answering performance using an interactive document retrieval system. 35-44 2012 IIiX https://doi.org/10.1145/2362724.2362735 conf/iiix/2012 db/conf/iiix/iiix2012.html#SmuckerAD12 Marc-Allen Cartright Ethem F. Can William Dabney Jeff Dalton 0001 Logan Giorda Kriste Krstovski Xiaoye Wu Ismet Zeki Yalniz James Allan 0001 R. Manmatha David A. Smith A framework for manipulating and searching multiple retrieval types. 1001 2012 SIGIR https://doi.org/10.1145/2348283.2348426 conf/sigir/2012 db/conf/sigir/sigir2012.html#CartrightCDDGKWYAMS12 Henry Allen Feild James Allan 0001 Task-aware search assistant. 1015 2012 SIGIR https://doi.org/10.1145/2348283.2348440 conf/sigir/2012 db/conf/sigir/sigir2012.html#FeildA12 Hui Cheng Jingen Liu Saad Ali Omar Javed Qian Yu Amir Tamrakar Ajay Divakaran Harpreet S. Sawhney R. Manmatha James Allan 0001 Alexander G. Hauptmann Mubarak Shah Subhabrata Bhattacharya Afshin Dehghan Gerald Friedland Benjamin Elizalde Trevor Darrell Michael Witbrock Jon Curtis SRI-Sarnoff AURORA System at TRECVID 2012 Multimedia Event Detection and Recounting. 2012 TRECVID https://www-nlpir.nist.gov/projects/tvpubs/tv12.papers/aurora.pdf conf/trecvid/2012 db/conf/trecvid/trecvid2012.html#ChengLAJYTDSMAH12 Marc-Allen Cartright Henry Allen Feild James Allan 0001 Evidence finding using a collection of books. 11-18 2011 BooksOnline https://doi.org/10.1145/2064058.2064063 https://www.wikidata.org/entity/Q66711070 conf/cikm/2011books db/conf/cikm/books2011.html#CartrightFA11 David A. Smith R. Manmatha James Allan 0001 Mining relational structure from millions of books: position paper. 49-54 2011 BooksOnline https://doi.org/10.1145/2064058.2064069 conf/cikm/2011books db/conf/cikm/books2011.html#SmithMA11 Xing Yi James Allan 0001 Discovering missing click-through query language information for web search. 153-162 2011 CIKM https://doi.org/10.1145/2063576.2063604 conf/cikm/2011 db/conf/cikm/cikm2011.html#YiA11 Elif Aktolga James Allan 0001 Reranking search results for sparse queries. 173-182 2011 CIKM https://doi.org/10.1145/2063576.2063606 conf/cikm/2011 db/conf/cikm/cikm2011.html#AktolgaA11 Marc-Allen Cartright James Allan 0001 Efficiency optimizations for interpolating subqueries. 297-306 2011 CIKM https://doi.org/10.1145/2063576.2063625 conf/cikm/2011 db/conf/cikm/cikm2011.html#CartrightA11 Jeffrey Dalton 0001 James Allan 0001 David A. Smith Passage retrieval for incorporating global evidence in sequence labeling. 355-364 2011 CIKM https://doi.org/10.1145/2063576.2063633 conf/cikm/2011 db/conf/cikm/cikm2011.html#DaltonAS11 Elif Aktolga James Allan 0001 David A. Smith Passage Reranking for Question Answering Using Syntactic Structures and Answer Types. 617-628 2011 ECIR https://doi.org/10.1007/978-3-642-20161-5_62 conf/ecir/2011 db/conf/ecir/ecir2011.html#AktolgaAS11 Henry Allen Feild Marc-Allen Cartright James Allan 0001 The University of Massachusetts Amherst's Participation in the INEX 2011 Prove It Track. 80-85 2011 INEX https://doi.org/10.1007/978-3-642-35734-3_6 conf/inex/2011 db/conf/inex/inex2011.html#FeildCA11 Henry Allen Feild James Allan 0001 Joshua Glatt CrowdLogging: distributed, private, and anonymous search logging. 375-384 2011 SIGIR https://doi.org/10.1145/2009916.2009969 conf/sigir/2011 db/conf/sigir/sigir2011.html#FeildAG11 Hui Cheng Amir Tamrakar Saad Ali Qian Yu Omar Javed Jingen Liu Ajay Divakaran Harpreet S. Sawhney Alexander G. Hauptmann Mubarak Shah Subhabrata Bhattacharya Michael Witbrock Jon Curtis Gerald Friedland Robert Mertens 0003 Trevor Darrell R. Manmatha James Allan 0001 Team SRI-Sarnoff's AURORA System @ TRECVID 2011. 2011 TRECVID https://www-nlpir.nist.gov/projects/tvpubs/tv11.papers/sri-aurora.pdf conf/trecvid/2011 db/conf/trecvid/trecvid2011.html#ChengTAYJLDSHSB11

Edward K. F. Dang Robert W. P. Luk James Allan 0001 Kei Shiu Ho Stephen C. F. Chan Korris Fu-Lai Chung Dik Lun Lee A new context-dependent term weight computed by boost and discount using relevance information. 2514-2530 2010 61 J. Assoc. Inf. Sci. Technol. 12 https://doi.org/10.1002/asi.21425 db/journals/jasis/jasis61.html#DangLAHCCL10

Marc-Allen Cartright James Allan 0001 Victor Lavrenko Andrew McGregor 0001 Fast query expansion using approximations of relevance models. 1573-1576 2010 CIKM https://doi.org/10.1145/1871437.1871675 conf/cikm/2010 db/conf/cikm/cikm2010.html#CartrightALM10 Henry Allen Feild James Allan 0001 Rosie Jones Predicting searcher frustration. 34-41 2010 SIGIR https://doi.org/10.1145/1835449.1835458 conf/sigir/2010 db/conf/sigir/sigir2010.html#FeildAJ10 Xing Yi James Allan 0001 A content based approach for discovering missing anchor text for web search. 427-434 2010 SIGIR https://doi.org/10.1145/1835449.1835521 conf/sigir/2010 db/conf/sigir/sigir2010.html#YiA10 Niranjan Balasubramanian James Allan 0001 Learning to select rankers. 855-856 2010 SIGIR https://doi.org/10.1145/1835449.1835650 conf/sigir/2010 db/conf/sigir/sigir2010.html#BalasubramanianA10 Ao Feng James Allan 0001 Incident threading for news passages. 1307-1316 2009 CIKM https://doi.org/10.1145/1645953.1646118 conf/cikm/2009 db/conf/cikm/cikm2009.html#FengA09 Xing Yi James Allan 0001 A Comparative Study of Utilizing Topic Models for Information Retrieval. 29-41 2009 ECIR https://doi.org/10.1007/978-3-642-00958-7_6 conf/ecir/2009 db/conf/ecir/ecir2009.html#YiA09 Matthew Lease James Allan 0001 W. Bruce Croft Regression Rank: Learning to Meet the Opportunity of Descriptive Queries. 90-101 2009 ECIR https://doi.org/10.1007/978-3-642-00958-7_11 conf/ecir/2009 db/conf/ecir/ecir2009.html#LeaseAC09 Ben Carterette Virgiliu Pavlu Evangelos Kanoulas Javed A. Aslam James Allan 0001 If I Had a Million Queries. 288-300 2009 ECIR https://doi.org/10.1007/978-3-642-00958-7_27 https://www.wikidata.org/entity/Q57746411 conf/ecir/2009 db/conf/ecir/ecir2009.html#CarterettePKAA09 Mark D. Smucker James Allan 0001 A New Measure of the Cluster Hypothesis. 281-288 2009 ICTIR https://doi.org/10.1007/978-3-642-04417-5_27 conf/ictir/2009 db/conf/ictir/ictir2009.html#SmuckerA09 Mark D. Smucker James Allan 0001 Ben Carterette Agreement among statistical significance tests for information retrieval evaluation at varying sample sizes. 630-631 2009 SIGIR https://doi.org/10.1145/1571941.1572050 conf/sigir/2009 db/conf/sigir/sigir2009.html#SmuckerAC09 Niranjan Balasubramanian James Allan 0001 Syntactic Query Models for Restatement Retrieval. 143-155 2009 SPIRE https://doi.org/10.1007/978-3-642-03784-9_14 conf/spire/2009 db/conf/spire/spire2009.html#BalasubramanianA09 James Allan 0001 Javed A. Aslam Mark Sanderson ChengXiang Zhai Justin Zobel Proceedings of the 32nd Annual International ACM SIGIR Conference on Research and Development in Information Retrieval, SIGIR 2009, Boston, MA, USA, July 19-23, 2009 978-1-60558-483-6 SIGIR ACM 2009 https://doi.org/10.1145/1571941 https://www.wikidata.org/entity/Q40885708 db/conf/sigir/sigir2009.html

Giridhar Kumaran James Allan 0001 Adapting information retrieval systems to user queries. 1838-1862 2008 44 Inf. Process. Manag. 6 https://doi.org/10.1016/j.ipm.2007.12.006 db/journals/ipm/ipm44.html#KumaranA08

Kristen Parton Kathleen R. McKeown James Allan 0001 Enrique Henestroza Simultaneous multilingual search for translingual information retrieval. 719-728 2008 CIKM https://doi.org/10.1145/1458082.1458179 https://www.wikidata.org/entity/Q66711585 conf/cikm/2008 db/conf/cikm/cikm2008.html#PartonMAH08 Lisa Friedland James Allan 0001 Joke retrieval: recognizing the same joke told differently. 883-892 2008 CIKM https://doi.org/10.1145/1458082.1458199 conf/cikm/2008 db/conf/cikm/cikm2008.html#FriedlandA08 Elif Aktolga Marc-Allen Cartright James Allan 0001 Cross-document cross-lingual coreference retrieval. 1359-1360 2008 CIKM https://doi.org/10.1145/1458082.1458278 conf/cikm/2008 db/conf/cikm/cikm2008.html#AktolgaCA08 Xing Yi James Allan 0001 Evaluating topic models for information retrieval. 1431-1432 2008 CIKM https://doi.org/10.1145/1458082.1458317 conf/cikm/2008 db/conf/cikm/cikm2008.html#YiA08 Rebecca Reznik-Zellen Bob Stevens Michael Thorn Jeff Morse Mark D. Smucker James Allan 0001 David M. Mimno Andrew McCallum Mark Tuominen InterNano: e-Science for the Nanomanufacturing Community. 382-383 2008 eScience https://doi.org/10.1109/eScience.2008.142 https://doi.ieeecomputersociety.org/10.1109/eScience.2008.142 https://www.wikidata.org/entity/Q60192332 conf/eScience/2008 db/conf/eScience/eScience2008.html#Reznik-ZellenSTMSAMMT08 Giridhar Kumaran James Allan 0001 Effective and efficient user interaction for long queries. 11-18 2008 SIGIR https://doi.org/10.1145/1390334.1390339 conf/sigir/2008 db/conf/sigir/sigir2008.html#KumaranA08 Kyung-Soon Lee W. Bruce Croft James Allan 0001 A cluster-based resampling method for pseudo-relevance feedback. 235-242 2008 SIGIR https://doi.org/10.1145/1390334.1390376 conf/sigir/2008 db/conf/sigir/sigir2008.html#LeeCA08 Ben Carterette Virgiliu Pavlu Evangelos Kanoulas Javed A. Aslam James Allan 0001 Evaluation over thousands of queries. 651-658 2008 SIGIR https://doi.org/10.1145/1390334.1390445 https://www.wikidata.org/entity/Q57746419 conf/sigir/2008 db/conf/sigir/sigir2008.html#CarterettePKAA08 James Allan 0001 Javed A. Aslam Virgil Pavlu Evangelos Kanoulas Ben Carterette Million Query Track 2008 Overview. 2008 TREC https://trec.nist.gov/pubs/trec17/papers/MQ.OVERVIEW.pdf conf/trec/2008 db/conf/trec/trec2008.html#AllanAPKC08 Ho Chung Wu Edward K. F. Dang Robert Wing Pong Luk G. Ngai Yinghao Li James Allan 0001 Kui-Lam Kwok Kam-Fai Wong Evaluating a Novel Kind of Retrieval Models Based on Relevance Decision Making in a Relevance Feedback Environment. 2008 TREC http://trec.nist.gov/pubs/trec17/papers/hong-kong.pu.rf.rev.pdf conf/trec/2008 db/conf/trec/trec2008.html#WuDLNLAKW08 Kathleen R. McKeown Johanna D. Moore Simone Teufel James Allan 0001 Sadaoki Furui ACL 2008, Proceedings of the 46th Annual Meeting of the Association for Computational Linguistics, June 15-20, 2008, Columbus, Ohio, USA ACL The Association for Computer Linguistics https://aclanthology.org/volumes/P08-1/ https://aclanthology.org/P08-1000/ db/conf/acl/acl2008.html 2008 978-1-932432-04-6

E. Micah Kornfield R. Manmatha James Allan 0001 Further explorations in text alignment with handwritten documents. 39-52 2007 10 Int. J. Document Anal. Recognit. 1 https://doi.org/10.1007/s10032-006-0019-8 db/journals/ijdar/ijdar10.html#KornfieldMA07

Jamie Callan James Allan 0001 Charles L. A. Clarke Susan T. Dumais David A. Evans 0001 Mark Sanderson ChengXiang Zhai Meeting of the MINDS: an information retrieval research agenda. 25-34 2007 41 SIGIR Forum 2 https://doi.org/10.1145/1328964.1328967 db/journals/sigir/sigir41.html#CallanACDESZ07

Mark D. Smucker James Allan 0001 Ben Carterette A comparison of statistical significance tests for information retrieval evaluation. 623-632 2007 conf/cikm/2007 CIKM https://doi.org/10.1145/1321440.1321528 https://www.wikidata.org/entity/Q136523711 db/conf/cikm/cikm2007.html#SmuckerAC07 Ao Feng James Allan 0001 Finding and linking incidents in news. 821-830 2007 conf/cikm/2007 CIKM https://doi.org/10.1145/1321440.1321554 db/conf/cikm/cikm2007.html#FengA07 Ben Carterette James Allan 0001 Semiautomatic evaluation of retrieval systems using document similarities. 873-876 2007 conf/cikm/2007 CIKM https://doi.org/10.1145/1321440.1321564 db/conf/cikm/cikm2007.html#CarteretteA07 Giridhar Kumaran James Allan 0001 Selective user interaction. 923-926 2007 conf/cikm/2007 CIKM https://doi.org/10.1145/1321440.1321576 db/conf/cikm/cikm2007.html#KumaranA07 Ron Bekkerman Hema Raghavan James Allan 0001 Koji Eguchi Interactive Clustering of Text Collections According to a User-Specified Criterion. 684-689 2007 conf/ijcai/2007 IJCAI http://ijcai.org/Proceedings/07/Papers/109.pdf db/conf/ijcai/ijcai2007.html#BekkermanRAE07 Ron Bekkerman Shlomo Zilberstein James Allan 0001 Web Page Clustering Using Heuristic Search in the Web Graph. 2280-2285 2007 conf/ijcai/2007 IJCAI http://ijcai.org/Proceedings/07/Papers/367.pdf db/conf/ijcai/ijcai2007.html#BekkermanZA07 Victor Lavrenko Xing Yi James Allan 0001 Information Retrieval On Empty Fields. 89-96 2007 HLT-NAACL https://aclanthology.org/N07-1012/ conf/naacl/2007 db/conf/naacl/naacl2007.html#LavrenkoYA07 Giridhar Kumaran James Allan 0001 A Case For Shorter Queries, and Helping Users Create Them. 220-227 2007 HLT-NAACL https://aclanthology.org/N07-1028/ conf/naacl/2007 db/conf/naacl/naacl2007.html#KumaranA07 Barry Schiffman Kathleen R. McKeown Ralph Grishman James Allan 0001 Question Answering Using Integrated Information Retrieval and Information Extraction. 532-539 2007 HLT-NAACL https://aclanthology.org/N07-1067/ conf/naacl/2007 db/conf/naacl/naacl2007.html#SchiffmanMGA07 Giridhar Kumaran James Allan 0001 Information Retrieval Techniques for Templated Queries. 2007 RIAO conf/riao/2007 db/conf/riao/riao2007.html#KumaranA07 https://dl.acm.org/doi/10.5555/1931390.1931455 671-686 Xing Yi James Allan 0001 Victor Lavrenko Discovering Missing Values in Semi-Structured Databases. 2007 RIAO conf/riao/2007 db/conf/riao/riao2007.html#YiAL07 https://dl.acm.org/doi/10.5555/1931390.1931456 687-701 Ben Carterette James Allan 0001 Research Methodology in Studies of Information Retrieval Evaluation. 2007 RIAO conf/riao/2007 db/conf/riao/riao2007.html#CarteretteA07 https://dl.acm.org/doi/10.5555/1931390.1931461 738-757 Hema Raghavan James Allan 0001 An interactive algorithm for asking and incorporating feature feedback into support vector machines. 79-86 2007 conf/sigir/2007 SIGIR https://doi.org/10.1145/1277741.1277758 db/conf/sigir/sigir2007.html#RaghavanA07 Xing Yi James Allan 0001 W. Bruce Croft Matching resumes and jobs based on relevance models. 809-810 2007 conf/sigir/2007 SIGIR https://doi.org/10.1145/1277741.1277920 db/conf/sigir/sigir2007.html#YiAC07 Niranjan Balasubramanian James Allan 0001 W. Bruce Croft A comparison of sentence retrieval techniques. 813-814 2007 conf/sigir/2007 SIGIR https://doi.org/10.1145/1277741.1277922 db/conf/sigir/sigir2007.html#BalasubramanianAC07 Mark D. Smucker James Allan 0001 Using similarity links as shortcuts to relevant web pages. 863-864 2007 conf/sigir/2007 SIGIR https://doi.org/10.1145/1277741.1277947 db/conf/sigir/sigir2007.html#SmuckerA07 James Allan 0001 Ben Carterette Blagovest Dachev Javed A. Aslam Virgiliu Pavlu Evangelos Kanoulas Million Query Track 2007 Overview. 2007 TREC http://trec.nist.gov/pubs/trec16/papers/1MQ.OVERVIEW16.pdf conf/trec/2007 db/conf/trec/trec2007.html#AllanCDAPK07 Mark D. Smucker James Allan 0001 Blagovest Dachev UMass Complex Interactive Question Answering (ciQA) 2007: Human Performance as Question Answerers. 2007 TREC http://trec.nist.gov/pubs/trec16/papers/umass.qa.final.pdf conf/trec/2007 db/conf/trec/trec2007.html#SmuckerAD07 Xing Yi James Allan 0001 Indri at TREC 2007: Million Query (1MQ) Track. 2007 TREC http://trec.nist.gov/pubs/trec16/papers/umass.mq.final.pdf conf/trec/2007 db/conf/trec/trec2007.html#YiA07 Ben Carterette James Allan 0001 Ramesh K. Sitaraman Minimal test collections for retrieval evaluation. 268-275 2006 conf/sigir/2006 SIGIR https://doi.org/10.1145/1148170.1148219 db/conf/sigir/sigir2006.html#CarteretteAS06 Mark D. Smucker James Allan 0001 Find-similar: similarity browsing as a search tool. 461-468 2006 conf/sigir/2006 SIGIR https://doi.org/10.1145/1148170.1148250 db/conf/sigir/sigir2006.html#SmuckerA06 Giridhar Kumaran James Allan 0001 Simple questions to improve pseudo-relevance feedback results. 661-662 2006 conf/sigir/2006 SIGIR https://doi.org/10.1145/1148170.1148305 db/conf/sigir/sigir2006.html#KumaranA06 Mark D. Smucker James Allan 0001 Lightening the load of document smoothing for better language modeling retrieval. 699-700 2006 conf/sigir/2006 SIGIR https://doi.org/10.1145/1148170.1148324 db/conf/sigir/sigir2006.html#SmuckerA06a Giridhar Kumaran James Allan 0001 UMass at TREC ciQA 2006. 2006 TREC http://trec.nist.gov/pubs/trec15/papers/umass.qa.final.pdf conf/trec/2006 db/conf/trec/trec2006.html#KumaranA06 Ben Carterette James Allan 0001 Incremental test collections. 680-687 2005 conf/cikm/2005 CIKM https://doi.org/10.1145/1099554.1099723 db/conf/cikm/cikm2005.html#CarteretteA05 James Allan 0001 Stephen M. Harding David Fisher Alvaro Bolivar Sergio Guzman-Lara Peter Amstutz Taking Topic Detection From Evaluation to Practice. 2005 conf/hicss/2005 HICSS https://doi.org/10.1109/HICSS.2005.576 https://doi.ieeecomputersociety.org/10.1109/HICSS.2005.576 db/conf/hicss/hicss2005.html#AllanHFBGA05 Giridhar Kumaran James Allan 0001 Using Names and Topics for New Event Detection. 2005 conf/naacl/2005 HLT/EMNLP https://aclanthology.org/H05-1016/ db/conf/naacl/naacl2005.html#KumaranA05 121-128 Hema Raghavan James Allan 0001 Matching Inconsistently Spelled Names in Automatic Speech Recognizer Output for Information Retrieval. 2005 conf/naacl/2005 HLT/EMNLP https://aclanthology.org/H05-1057/ db/conf/naacl/naacl2005.html#RaghavanA05 451-458 James Allan 0001 Ben Carterette Joshua Lewis When will information retrieval be "good enough"? 433-440 2005 conf/sigir/2005 SIGIR https://doi.org/10.1145/1076034.1076109 db/conf/sigir/sigir2005.html#AllanCL05 James Allan 0001 HARD Track Overview in TREC 2005 High Accuracy Retrieval from Documents. 2005 TREC http://trec.nist.gov/pubs/trec14/papers/HARD.OVERVIEW.pdf conf/trec/2005 db/conf/trec/trec2005.html#Allan05 Fernando Diaz 0001 James Allan 0001 When Less is More: Relevance Feedback Falls Short and Term Expansion Succeeds at HARD 2005. 2005 TREC http://trec.nist.gov/pubs/trec14/papers/umass-hard.pdf conf/trec/2005 db/conf/trec/trec2005.html#DiazA05

Andrew Arnt Shlomo Zilberstein James Allan 0001 Abdel-Illah Mouaddib Dynamic Composition of Information Retrieval Techniques. 67-97 2004 23 J. Intell. Inf. Syst. 1 https://doi.org/10.1023/B:JIIS.0000029671.27333.7d db/journals/jiis/jiis23.html#ArntZAM04

Anton Leuski James Allan 0001 Interactive Information Retrieval Using Clustering and Spatial Proximity. 259-288 2004 14 User Model. User Adapt. Interact. 2-3 https://doi.org/10.1023/B:USER.0000028978.09823.47 db/journals/umuai/umuai14.html#LeuskiA04

Ramesh Nallapati Ao Feng Fuchun Peng James Allan 0001 Event threading within news topics. 446-453 2004 conf/cikm/2004 CIKM https://doi.org/10.1145/1031171.1031258 db/conf/cikm/cikm2004.html#NallapatiFPA04 E. Micah Kornfield R. Manmatha James Allan 0001 Text Alignment with Handwritten Documents. 195-211 2004 conf/dial/2004 DIAL https://doi.org/10.1109/DIAL.2004.1263249 https://doi.ieeecomputersociety.org/10.1109/DIAL.2004.1263249 db/conf/dial/dial2004.html#KornfieldMA04 Diane Kelly 0001 Fernando Diaz 0001 Nicholas J. Belkin James Allan 0001 A User-Centered Approach to Evaluating Topic Models. 27-41 https://doi.org/10.1007/978-3-540-24752-4_3 2004 conf/ecir/2004 ECIR db/conf/ecir/ecir2004.html#KellyDBA04 Chung Heong Gooi James Allan 0001 Cross-Document Coreference on a Large Scale Corpus. 9-16 2004 conf/naacl/2004 HLT-NAACL https://aclanthology.org/N04-1002/ db/conf/naacl/naacl2004.html#GooiA04 Giridhar Kumaran James Allan 0001 Text classification and named entities for new event detection. 297-304 2004 conf/sigir/2004 SIGIR https://doi.org/10.1145/1008992.1009044 db/conf/sigir/sigir2004.html#KumaranA04 James Allan 0001 HARD Track Overview in TREC 2004 - High Accuracy Retrieval from Documents. 2004 TREC http://trec.nist.gov/pubs/trec13/papers/HARD.OVERVIEW.pdf conf/trec/2004 db/conf/trec/trec2004.html#Allan04 Nasreen Abdul Jaleel James Allan 0001 W. Bruce Croft Fernando Diaz 0001 Leah S. Larkey Xiaoyan Li Mark D. Smucker Courtney Wade UMass at TREC 2004: Novelty and HARD. 2004 TREC http://trec.nist.gov/pubs/trec13/papers/umass.novelty.hard.pdf conf/trec/2004 db/conf/trec/trec2004.html#JaleelACDLLSW04 Elisa H. Barney Smith Jianying Hu James Allan 0001 Document Recognition and Retrieval XI, San Jose, California, USA, January 18-22, 2004, Proceedings DRR SPIE Proceedings 5296 SPIE 2004 0-8194-5199-1 http://proceedings.spiedigitallibrary.org/volume.aspx?volume=5296 db/conf/drr/drr2004.html Mark Sanderson Kalervo Järvelin James Allan 0001 Peter Bruza SIGIR 2004: Proceedings of the 27th Annual International ACM SIGIR Conference on Research and Development in Information Retrieval, Sheffield, UK, July 25-29, 2004 SIGIR ACM 1-58113-881-4 2004 https://doi.org/10.1145/1008992 db/conf/sigir/sigir2004.html

James Allan 0001 Robust Techniques for Organizing and Retrieving Spoken Documents. 103-114 2003 2003 EURASIP J. Adv. Signal Process. 2 https://doi.org/10.1155/S1110865703211070 db/journals/ejasp/ejasp2003.html#Allan03

James Allan 0001 Jay Aslam Nicholas J. Belkin Chris Buckley James P. Callan W. Bruce Croft Susan T. Dumais Norbert Fuhr Donna Harman David J. Harper Djoerd Hiemstra Thomas Hofmann 0001 Eduard H. Hovy Wessel Kraaij John D. Lafferty Victor Lavrenko David D. Lewis Liz Liddy R. Manmatha Andrew McCallum Jay M. Ponte John M. Prager Dragomir R. Radev Philip Resnik Stephen E. Robertson Ronald Rosenfeld Salim Roukos Mark Sanderson Richard M. Schwartz Amit Singhal 0001 Alan F. Smeaton Howard R. Turtle Ellen M. Voorhees Ralph M. Weischedel Jinxi Xu ChengXiang Zhai Challenges in information retrieval and language modeling: report of a workshop held at the center for intelligent information retrieval, University of Massachusetts Amherst, September 2002. 31-47 2003 37 SIGIR Forum 1 https://doi.org/10.1145/945546.945549 https://www.wikidata.org/entity/Q121889597 db/journals/sigir/sigir37.html#AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03

James Allan 0001 Victor Lavrenko Margaret E. Connell A month to topic detection and tracking in Hindi. 85-100 2003 2 ACM Trans. Asian Lang. Inf. Process. 2 https://doi.org/10.1145/974740.974742 db/journals/talip/talip2.html#AllanLC03

James Allan 0001 Ao Feng Alvaro Bolivar Flexible intrinsic evaluation of hierarchical clustering for TDT. 263-270 2003 conf/cikm/2003 CIKM https://doi.org/10.1145/956863.956914 db/conf/cikm/cikm2003.html#AllanFB03 Ramesh Nallapati W. Bruce Croft James Allan 0001 Relevant query feedback in statistical language modeling. 560-563 2003 conf/cikm/2003 CIKM https://doi.org/10.1145/956863.956973 db/conf/cikm/cikm2003.html#NallapatiCA03 James Allan 0001 Courtney Wade Alvaro Bolivar Retrieval and novelty detection at the sentence level. 314-321 2003 conf/sigir/2003 SIGIR https://doi.org/10.1145/860435.860493 db/conf/sigir/sigir2003.html#AllanWB03 James Allan 0001 Giridhar Kumaran Stemming in the language modeling framework. 455-456 2003 conf/sigir/2003 SIGIR https://doi.org/10.1145/860435.860548 db/conf/sigir/sigir2003.html#AllanK03 James Allan 0001 HARD Track Overview in TREC 2003: High Accuracy Retrieval from Documents. 24-37 2003 conf/trec/2003 TREC http://trec.nist.gov/pubs/trec12/papers/HARD.OVERVIEW.pdf db/conf/trec/trec2003.html#Allan03 Nasreen Abdul Jaleel Andrés Corrada-Emmanuel Qi Li Xiaoyong Liu Courtney Wade James Allan 0001 UMass at TREC 2003: HARD and QA. 715-725 2003 conf/trec/2003 TREC http://trec.nist.gov/pubs/trec12/papers/umass-amherst.hard.qa.pdf db/conf/trec/trec2003.html#JaleelCLLWA03

James Allan 0001 Detection As Multi-Topic Tracking. 139-157 2002 5 Inf. Retr. 2-3 db/journals/ir/ir5.html#Allan02 https://doi.org/10.1023/A:1015793827697

Robert W. P. Luk Hong Va Leong Tharam S. Dillon Alvin T. S. Chan W. Bruce Croft James Allan 0001 A survey in indexing and searching XML documents. 415-437 2002 53 J. Assoc. Inf. Sci. Technol. 6 db/journals/jasis/jasis53.html#LukLDCCA02 https://doi.org/10.1002/asi.10056

Ramesh Nallapati James Allan 0001 Capturing term dependencies using a language model based on sentence trees. 383-390 2002 conf/cikm/2002 CIKM https://doi.org/10.1145/584792.584855 https://www.wikidata.org/entity/Q130801766 db/conf/cikm/cikm2002.html#NallapatiA02 Carl Lagoze William Y. Arms Stoney Gan Diane Hillmann Christopher Ingram Dean B. Krafft Richard J. Marisa Jon Phipps John Saylor Carol Terrizzi Walter Hoehn David Millman James Allan 0001 Sergio Guzman-Lara Tom Kalt Core services in the architecture of the national science digital library (NSDL). 201-209 2002 conf/jcdl/2002 JCDL https://doi.org/10.1145/544220.544264 db/conf/jcdl/jcdl2002.html#LagozeAGHIKMPSTHMAGK02 Anton Leuski James Allan 0001 Improving realism of topic tracking evaluation. 89-96 2002 conf/sigir/2002 SIGIR https://doi.org/10.1145/564376.564394 db/conf/sigir/sigir2002.html#LeuskiA02 James Allan 0001 Hema Raghavan Using part-of-speech patterns to reduce query ambiguity. 307-314 2002 conf/sigir/2002 SIGIR https://doi.org/10.1145/564376.564430 db/conf/sigir/sigir2002.html#AllanR02 R. Manmatha Ao Feng James Allan 0001 A critical examination of TDT's cost function. 403-404 2002 conf/sigir/2002 SIGIR https://doi.org/10.1145/564376.564465 db/conf/sigir/sigir2002.html#ManmathaFA02 Leah S. Larkey James Allan 0001 Margaret E. Connell Alvaro Bolivar Courtney Wade UMass at TREC 2002: Cross Language and Novelty Tracks. 2002 conf/trec/2002 TREC http://trec.nist.gov/pubs/trec11/papers/umass.wade.pdf db/conf/trec/trec2002.html#LarkeyACBW02

Carl Lagoze William Y. Arms Stoney Gan Diane Hillmann Christopher Ingram Dean B. Krafft Richard J. Marisa Jon Phipps John Saylor Carol Terrizzi Walter Hoehn David Millman James Allan 0001 Sergio Guzman-Lara Tom Kalt Core Services in the Architecture of the National Digital Library for Science Education (NSDL) https://arxiv.org/abs/cs/0201025 2002 CoRR cs.DL/0201025 db/journals/corr/corr0201.html#cs-DL-0201025

James Allan 0001 Anton Leuski Russell C. Swan Donald Byrd Evaluating combinations of ranked lists and visualizations of inter-document similarity. 435-458 2001 37 Inf. Process. Manag. 3 db/journals/ipm/ipm37.html#AllanLSB01 https://doi.org/10.1016/S0306-4573(00)00056-X

David Frey Rahul Gupta Vikas Khandelwal Victor Lavrenko Anton Leuski James Allan 0001 Monitoring the News: a TDT demonstration system. 2001 HLT https://aclanthology.org/H01-1053/ conf/naacl/2001hlt db/conf/naacl/hlt2001.html#FreyGKLLA01 Vikas Khandelwal Rahul Gupta James Allan 0001 An Evaluation Corpus For Temporal Summarization. 2001 HLT https://aclanthology.org/H01-1022/ conf/naacl/2001hlt db/conf/naacl/hlt2001.html#KhandelwalGA01 James Allan 0001 Perspectives on Information Retrieval and Speech. 1-10 2001 conf/sigir/2001w1 SIGIR Workshop: Information Retrieval Techniques for Speech Applications https://doi.org/10.1007/3-540-45637-6_1 db/conf/sigir/sigir2001w1.html#Allan01 James Allan 0001 Rahul Gupta Vikas Khandelwal Temporal Summaries of News Topics. 10-18 2001 conf/sigir/2001 SIGIR db/conf/sigir/sigir2001.html#AllanGK01 https://doi.org/10.1145/383952.383954

Anton Leuski James Allan 0001 Strategy-based interactive cluster visualization for information retrieval. 170-184 2000 3 Int. J. Digit. Libr. 2 https://doi.org/10.1007/s007999900016 db/journals/jodl/jodl3.html#LeuskiA00

James Allan 0001 Victor Lavrenko Hubert Jin First Story Detection In TDT Is Hard. 374-381 2000 conf/cikm/2000 CIKM https://doi.org/10.1145/354756.354843 db/conf/cikm/cikm2000.html#AllanLJ00 Victor Lavrenko Matthew D. Schmill Dawn J. Lawrie Paul Ogilvie David D. Jensen James Allan 0001 Language Models for Financial News Recommendation. 389-396 2000 conf/cikm/2000 CIKM https://doi.org/10.1145/354756.354845 db/conf/cikm/cikm2000.html#LavrenkoSLOJA00 Anton Leuski James Allan 0001 Lighthouse: Showing the Way to Relevant Information. 125-129 2000 conf/infovis/2000 INFOVIS https://doi.org/10.1109/INFVIS.2000.885099 db/conf/infovis/infovis2000.html#LeuskiA00 Anton Leuski James Allan 0001 Improving Interactive Retrieval by Combining Ranked List and Clustering. 665-681 2000 RIAO conf/riao/2000 db/conf/riao/riao2000.html#LeuskiA00 https://dl.acm.org/doi/10.5555/2835865.2835935 Russell C. Swan James Allan 0001 Automatic generation of overview timelines. 49-56 2000 conf/sigir/2000 SIGIR https://doi.org/10.1145/345508.345546 db/conf/sigir/sigir2000.html#SwanA00 Russell C. Swan James Allan 0001 TimeMine: visualizing automatically constructed timelines. 393 2000 conf/sigir/2000 SIGIR https://doi.org/10.1145/345508.345674 db/conf/sigir/sigir2000.html#SwanA00a James Allan 0001 Margaret E. Connell W. Bruce Croft Fangfang Feng David Fisher Xiaoyan Li INQUERY and TREC-9. 2000 conf/trec/2000 TREC http://trec.nist.gov/pubs/trec9/papers/umass-trec9.pdf db/conf/trec/trec2000.html#AllanCCFFL00 Russell C. Swan James Allan 0001 Extracting Significant Time Varying Features from Text. 38-45 CIKM1999/P038.pdf 1999 conf/cikm/99 CIKM https://doi.org/10.1145/319950.319956 db/conf/cikm/cikm99.html#SwanA99 James Allan 0001 James P. Callan Fangfang Feng Daniella Malin INQUERY and TREC-8. 1999 conf/trec/1999 TREC http://trec.nist.gov/pubs/trec8/papers/trec8-umass.pdf db/conf/trec/trec1999.html#AllanCFM99

James Allan 0001 Book Review: Readings in Information Retrieval edited by K. Sparck Jones and P. Willett. 489-490 1998 34 Inf. Process. Manag. 4 db/journals/ipm/ipm34.html#Allan98

Daniela Rus James Allan 0001 Structural Queries in Electronic Corpora. 153-169 1998 6 Multim. Tools Appl. 2 db/journals/mta/mta6.html#RusA98 https://doi.org/10.1023/A:1009656615964

Ron Papka James Allan 0001 Document Classification Using Multiword Features. 124-131 CIKM1998/P124.pdf 1998 conf/cikm/98 CIKM https://doi.org/10.1145/288627.288648 db/conf/cikm/cikm98.html#PapkaA98 Anton Leuski James Allan 0001 Evaluating a Visual Navigation System for a Digital Library. 535-554 https://doi.org/10.1007/3-540-49653-X_32 1998 conf/ercimdl/1998 ECDL db/conf/ercimdl/ercimdl98.html#LeouskiA98 James Allan 0001 Ron Papka Victor Lavrenko On-Line New Event Detection and Tracking. 37-45 1998 conf/sigir/98 SIGIR SIGIR1998/P037.pdf https://doi.org/10.1145/290941.290954 https://www.wikidata.org/entity/Q112251219 db/conf/sigir/sigir98.html#AllanPL98 Russell C. Swan James Allan 0001 Aspect Windows, 3-D Visualizations, and Indirect Comparisons of Information Retrieval Systems. 173-181 1998 conf/sigir/98 SIGIR SIGIR1998/P173.pdf https://doi.org/10.1145/290941.290987 db/conf/sigir/sigir98.html#SwanA98 Anton Leuski James Allan 0001 Visual Interactions with a Multidimensional Ranked List. 353-354 1998 conf/sigir/98 SIGIR SIGIR1998/P353.pdf https://doi.org/10.1145/290941.291043 db/conf/sigir/sigir98.html#LeouskiA98 James Allan 0001 James P. Callan Mark Sanderson Jinxi Xu Steven Wegmann INQUERY and TREC-7. 148-163 1998 conf/trec/1998 TREC db/conf/trec/trec98.html#AllanCSXW98

Maristella Agosti James Allan 0001 Introduction to the Special Issue on Methods and Tools for the Automatic Construction of Hypertext. 129-131 1997 33 Inf. Process. Manag. 2 db/journals/ipm/ipm33.html#AgostiA97 https://doi.org/10.1016/S0306-4573(96)00057-X https://www.wikidata.org/entity/Q59260078

James Allan 0001 Building Hypertext Using Information Retrieval. 145-159 1997 33 Inf. Process. Manag. 2 db/journals/ipm/ipm33.html#Allan97 https://doi.org/10.1016/S0306-4573(96)00059-3

James Allan 0001 James P. Callan W. Bruce Croft Lisa Ballesteros Donald Byrd Russell C. Swan Jinxi Xu INQUERY Does Battle With TREC-6. 169-206 1997 conf/trec/1997 TREC http://trec.nist.gov/pubs/trec6/papers/umass-trec6.ps db/conf/trec/trec97.html#AllanCCBBSX97 Nicholas J. Belkin Jose Perez Carballo Colleen Cool Shin-jeng Lin Soyeon Park Soo Young Rieh Pamela A. Savage-Knepshield Cynthia A. Sikora Hong (Iris) Xie James Allan 0001 Rutgers' TREC-6 Interactive Track Experience. 597-610 1997 conf/trec/1997 TREC http://trec.nist.gov/pubs/trec6/papers/ruint-paper2.ps db/conf/trec/trec97.html#BelkinCCLPRSSXA97

Gerard Salton James Allan 0001 Amit Singhal 0001 Automatic Text Decomposition and Structuring. 127-138 1996 32 Inf. Process. Manag. 2 db/journals/ipm/ipm32.html#SaltonAS96 https://doi.org/10.1016/S0306-4573(96)85001-1

James Allan 0001 Incremental Relevance Feedback for Information Filtering. 270-278 1996 conf/sigir/96 SIGIR db/conf/sigir/sigir96.html#Allan96 SIGIR1996/P270.pdf https://doi.org/10.1145/243199.243274 James Allan 0001 James P. Callan W. Bruce Croft Lisa Ballesteros John Broglio Jinxi Xu Hongming Shu INQUERY at TREC-5. 1996 conf/trec/1996 TREC http://trec.nist.gov/pubs/trec5/papers/umass-trec96.ps.gz db/conf/trec/trec1996.html#AllanCCBBHS96

Gerard Salton James Allan 0001 Selective text utilization and text traversal. 483-497 1995 43 Int. J. Hum. Comput. Stud. 3 https://doi.org/10.1006/ijhc.1995.1055 db/journals/ijmms/ijmms43.html#SaltonA95

Chris Buckley James Allan 0001 Gerard Salton Automatic Routing and Retrieval Using Smart: TREC-2. 315-326 1995 31 Inf. Process. Manag. 3 db/journals/ipm/ipm31.html#BuckleyAS95 https://doi.org/10.1016/0306-4573(94)00049-9

James Allan 0001 Relevance Feedback With Too Much Data. 337-343 1995 SIGIR db/conf/sigir/sigir95.html#Allan95 conf/sigir/95 SIGIR1995/P337.pdf https://doi.org/10.1145/215206.215380 James Allan 0001 Lisa Ballesteros James P. Callan W. Bruce Croft Zhihong Lu 0001 Recent Experiments with INQUERY. 1995 conf/trec/1995 TREC http://trec.nist.gov/pubs/trec4/papers/umass.ps.gz db/conf/trec/trec1995.html#AllanBCCL95

Gerard Salton James Allan 0001 Chris Buckley Automatic Structuring and Retrival of Large Text Files. 97-108 1994 37 Commun. ACM 2 db/journals/cacm/cacm37.html#SaltonAB94 https://doi.org/10.1145/175235.175243

Gerard Salton James Allan 0001 Automatic Text Decomposition and Structuring. 6-20 1994 RIAO conf/riao/1994 db/conf/riao/riao1994.html#SaltonA94 https://dl.acm.org/doi/10.5555/2856823.2856826 Chris Buckley Gerard Salton James Allan 0001 The Effect of Adding Relevance Information in a Relevance Feedback Environment. 292-300 1994 SIGIR db/conf/sigir/sigir94.html#BuckleySA94 conf/sigir/94 SIGIR1994/P292.pdf https://doi.org/10.1007/978-1-4471-2099-5_30 http://dl.acm.org/citation.cfm?id=188586 Chris Buckley Gerard Salton James Allan 0001 Amit Singhal 0001 Automatic Query Expansion Using SMART: TREC 3. 69-80 1994 conf/trec/1994 TREC http://trec.nist.gov/pubs/trec3/papers/cornell.new.ps.gz db/conf/trec/trec94.html#BuckleySAS94 https://doi.org/10.1145/168750.168809 Gerard Salton James Allan 0001 Selective Text Utilization and Text Traversal. 131-144 HT1993/P131.pdf 1993 conf/ht/93 Hypertext db/conf/ht/ht93.html#SaltonA93 Chris Buckley Gerard Salton James Allan 0001 The SMART Information Retrieval Project. 1993 HLT https://aclanthology.org/H93-1086/ conf/naacl/1993 db/conf/naacl/hlt1993.html#BuckleySA93 Gerard Salton James Allan 0001 Chris Buckley Approaches to Passage Retrieval in Full Text Information Systems. 49-58 1993 SIGIR db/conf/sigir/sigir93.html#SaltonAB93 conf/sigir/93 SIGIR1993/P049.pdf https://doi.org/10.1145/160688.160693 Chris Buckley James Allan 0001 Gerard Salton Automatic Routing and Ad-hoc Retrieval Using SMART: TREC 2. 45-56 1993 conf/trec/1993 TREC http://trec.nist.gov/pubs/trec2/papers/ps/cornell.ps db/conf/trec/trec93.html#BuckleyAS93

Gerard Salton Chris Buckley James Allan 0001 Automatic Structuring of Text Files. 1-17 1992 5 Electron. Publ. 1 db/journals/epodd/epodd5.html#SaltonBA92

Chris Buckley Gerard Salton James Allan 0001 Automatic Retrieval With Locality Information Using SMART. 59-72 1992 conf/trec/1992 TREC http://trec.nist.gov/pubs/trec1/papers/04.txt db/conf/trec/trec92.html#BuckleySA92 Raghavendra Addanki Mahak Agarwal Maristella Agosti Rakesh Agrawal 0001 Qingyao Ai Elif Aktolga Saad Ali Mohammad Aliannejadi Enrique Amigó Peter Amstutz Jaime Arguello William Y. Arms Andrew Arnt Javed A. AslamJay Aslam Leif Azzopardi Peter Bailey Niranjan Balasubramanian Lisa Ballesteros Krisztian Balog Ron Bekkerman Nicholas J. Belkin Paul N. Bennett Subhabrata Bhattacharya Alvaro Bolivar Hamed R. Bonab Elizabeth Boschee Andrei Z. Broder John Broglio Peter Bruza Chris Buckley Donald Byrd Jamie CallanJames P. Callan Ethem F. Can K. Selçuk Candan Robert G. CapraRob Capra 0001 Jose Perez Carballo Ben Carterette Marc-Allen Cartright Ishani Chakraborty Tanmoy Chakraborty 0002 Stephen Chi-fai ChanStephen C. F. Chan Yi Chang 0001 Guang Chen Hui Cheng Eunsol Choi Jinho D. Choi Tanya Chowdhury Korris Fu-Lai Chung Charles L. A. Clarke Daniel Cohen Margaret E. Connell Colleen Cool Andrés Corrada-Emmanuel Nick Craswell W. Bruce Croft J. Shane Culpepper Jon Curtis Alfredo Cuzzocrea William Dabney Blagovest Dachev Jeff Dalton 0001Jeffrey Dalton 0001 Edward K. F. DangEdward Kai Fung Dang Trevor Darrell Afshin Dehghan Gianluca Demartini Fernando Diaz 0001 Laura Dietz Tharam S. Dillon Ajay Divakaran Shiri Dori-Hacohen Zhicheng Dou Susan T. Dumais Koji Eguchi Carsten Eickhoff Michael D. Ekstrand Mohamed Elhoseiny Benjamin Elizalde David A. Evans 0001 Yi Fang 0008 Henry Allen Feild Ao Feng Fangfang Feng Nicola Ferro 0001 David Fisher John Foley David Frey Gerald Friedland Lisa Friedland Norbert Fuhr Sadaoki Furui Gary Gan Stoney Gan Negin Ghasemi Logan Giorda Joshua Glatt Dorota Glowacka Chung Heong Gooi Ralph Grishman Jiafeng Guo Rahul Gupta Sergio Guzman-Lara Christophe Van Gysel Stephen M. Harding Donna K. HarmanDonna Harman David J. Harper Helia Hashemi Faegheh Hasibi Alex Hauptmann 0001Alexander G. Hauptmann Daqing He Enrique Henestroza Danula Hettiachchi Djoerd Hiemstra Diane Hillmann Edward Kei Shiu HoKei Shiu Ho Walter Hoehn Thomas Hofmann 0001 Eduard H. Hovy Jianying Hu Zhiqi Huang 0002 Christopher Ingram Masahiko Itoh Mohit Iyyer Nazanin Jafari Nasreen Abdul Jaleel Myungha Jang Kalervo Järvelin Omar Javed David D. Jensen Jiepu Jiang Hubert Jin Rosie Jones Tom Kalt Jaap Kamps Noriko Kando Evangelos Kanoulas Sarvnaz Karimi Makoto P. Kato Diane Kelly 0001 Vikas Khandelwal Youngwoo Kim Weize Kong Bevan Koopman E. Micah Kornfield Wessel Kraaij Dean B. Krafft Kriste Krstovski Giridhar Kumaran Kui-Lam Kwok Alexandros Labrinidis John D. Lafferty Carl Lagoze Leah S. Larkey Victor Lavrenko Dawn J. Lawrie Erik G. Learned-Miller Matthew Lease Dik Lun Lee Dong-Ho Lee Kyung-Soon Lee Hong Va Leong Anton Leuski David D. Lewis Joshua Lewis Dan Li 0015 Qi Li Rui Li 0049 Xiaoyan Li Yinghao Li Elizabeth D. LiddyLiz Liddy Bill Y. LinBill Yuchen Lin Shin-jeng Lin Jingen Liu Qiguang Liu Xiaoyong Liu Yiqun Liu 0001 Daniel P. Lopresti Zhihong Lu 0001 Robert Wing Pong LukRobert W. P. Luk Jie Luo Chenglong Ma 0001 Joel Mackenzie Abhishek Madaan Maria Maistro Daniella Malin R. Manmatha Jiaxin Mao Richard J. Marisa Andrew McCallum Andrew McGregor 0001 Dana McKay Kathy McKeownKathleen R. McKeown Robert Mertens 0003 David Millman David M. Mimno Pranav Mirajkar Bhaskar Mitra 0001 Stefano Mizzaro Alistair Moffat Ali Montazeralghaem Johanna D. Moore Felipe Moraes Jeff Morse Fred Morstatter Josiane Mothe Abdel-Illah Mouaddib Vanessa Murdock 0001 Venkatesh N. Murthy Nada Naji Ramesh Nallapati Shahrzad Naseri G. Ngai Atharva Nijasure Brendan T. O'Connor 0001Brendan O'Connor 0001 Paul Ogilvie Iadh Ounis Soumyabrata Pal Ron Papka Soyeon Park Kristen Parton Norman W. Paton Virgil PavluVirgiliu Pavlu Fuchun Peng Jon Phipps Jay M. Ponte John M. Prager Jay Pujara Dragomir R. Radev Hema Raghavan Razieh Rahimi Neha Rana Lida Rashidi Shauli Ravfogel Xiang Ren 0001 Yongli Ren Philip Resnik Rebecca Reznik-Zellen Soo Young Rieh Stephen E. Robertson Ronald Rosenfeld Salim Roukos Daniela Rus Ian Ruthven Tetsuya Sakai Gerard Salton Mark Sanderson Rodrygo L. T. Santos Sheikh Muhammad Sarwar Pamela A. Savage-Knepshield Harpreet SawhneyHarpreet S. Sawhney John Saylor Barry Schiffman Matthew D. Schmill Falk Scholer Assaf Schuster Richard M. Schwartz Ravi Kiran Selvam Chirag Shah 0001 Mubarak Shah Jingbo Shang Alvin Chan Toong ShoonAlvin T. S. Chan Hongming Shu Cynthia A. Sikora Amit Singhal 0001 Ramesh K. Sitaraman Laurianne Sitbon Alan F. Smeaton David A. Smith Elisa H. Barney Smith Mark D. Smucker Ian Soboroff Damiano Spina Divesh Srivastava Bob Stevens Russell C. Swan Amir Tamrakar Norihiko Tatsunami Carol Terrizzi Simone Teufel Paul Thomas 0001 Philip S. Thomas Michael Thorn Johanne R. Trippas Mark Tuominen Howard R. Turtle Julián Urbano Ali Vardasbi Lakshmi Vikraman Ellen M. Voorhees Arjen P. de Vries Courtney Wade Haixun Wang Steven Wegmann Ralph M. Weischedel David Wemhoener Ryen W. WhiteRyen White Michael Witbrock Kam-Fai Wong Ho Chung Wu Xiaoye Wu Iris XieHong (Iris) Xie Jinxi Xu Ismet Zeki Yalniz Liu Yang 0005 Andrew Yates Xing Yi Elad Yom-Tov Masaharu Yoshioka Puxuan Yu Qian Yu Abby Yuan Mohammed J. Zaki Hamed Zamani Oleg Zendel Hansi Zeng ChengXiang ZhaiChengxiang Zhai Aston Zhang Min Zhang 0006 Weiyu Zhang Yi Zhang 0001 Shengyao Zhuang Yair Zick Shlomo Zilberstein Justin Zobel Guido Zuccon