2011
Government of Kerala
Kerala State Planning Board
Thiruvananthapuram
February 2012
7
Over the last few months, the world economy has been showing alarming signs of fragility and
instability. Economic growth has been sluggish with protracted unemployment, fscal uncertainty and
subdued business and consumer sentiments. Growth in high income countries is projected to be weak
as they struggle to repair damaged fnancial sectors and badly stretched fnancial sheets.
1.2 Global economic growth started to decelerate on a broad front in mid-2011 and this trend is
expected to stretch well into 2012 and 2013. The United Nations base line forecast for the growth of
world gross product (WGP) is 2.6% for 2012 and 3.2% for 2013, which is below the pre-crisis pace of
global growth.
1.3 It is expected that the US economy will grow at about 2% with modest growth in exports. Persistent
high unemployment and low wage growth have been holding back aggregate demand and together
with the prospects of prolonged depressed housing prices, this has heightened risks of a new wave of
home foreclosures in the United States. However, employment data for December 2011 and January
2012 have been encouraging with signs of revival in business confdence. On the other hand, as far
as the Euro Zone is concerned, high defcit and debt continue to prevail. The Euro Zone experienced
a period of declining output, high unemployment and subdued private consumption. However, the
business climate indicator increased for the frst time in ten months and infation rate fell from 3% to
2.8 % in December. In order to boost investment, the European Central Bank fooded banks with low
cost loans and there was improvement in demand. The recent debt swap agreement forged by the
Government of Greece with banks and further assistance from other European countries are positive
signals. World export trade slipped to a modest 6.5 per cent in 2011. Experts, including those in the
World Trade Organization, feel that the trend is likely to persist for some more time.
1.4 Asia, on the other hand, proved to be resilient, registering strong demand, low unemployment
and factories working at near full capacity. The Chinese economy, after nearly three decades of rapid,
almost uninterrupted growth, seems to be settling down to a still strong but less blistering pace. But
some sectors are struggling, including exports and real estate, particularly in the luxury segment.
The Chinese Government has scaled down its economic growth target to 7.5 percent in 2012, down
from 8 percent set as a minimum growth target in recent years. If growth rests at only 7.5 percent, it
will be the slowest pace in 22 years. The slower growth partly refects a movement toward personal
consumption, with less emphasis on exports and investment in big domestic construction and infra-
structure projects.
1.5 The global slowdown has had its adverse impact on the Indian economy. Deceleration in economic
activity has been in evidence for quite some time now and seen across many sectors. The Centre has
pegged second quarter GDP growth during 2011-12 at 6.9 percent, the lowest in nine quarters and
Introduction
C
H
A
P
T
E
R
Economic Review 2011
8
sharply lower than the previous quarters 7.7 percent. Over the same period last year, growth rate
was 8.4 percent. The decline was spread across agriculture and most of the sub-sectors of industry,
while the service sector preformed well. There was a fall in revenue collection, which, in turn, resulted
in increased fscal defcit. Corporate sector also reported a decline in proft. The fall in rupee value
against the dollar by 20 percent in mid- 2011 pushed up the import bill.
1.6 Food infation turned negative and touched the lowest in the last six years. Infation also moder-
ated to 9.11 percent from 9.78 percent and there was improvement in the manufacturing sector. The
Gross National Income (GNI) was estimated to rise by 7.9 percent factor cost at 2004-05 prices in
2010-11, in comparison to the growth rate of 8.4 percent in 2009-10.
1.7 The quick estimate of gross state domestic product (GSDP) at factor cost at constant prices
(2004-05) revealed a growth rate of 9.13 percent in 2010-11 compared to 8.95 percent in 2009-10.
The growth rate at current prices was 19.20 percent compared to 14.60 percent in 2009-10. The per-
capita national income at constant prices during 2010-11 was estimated at ` 35993 and that of the
State as ` 56107. The sectoral distribution of gross state domestic product revealed that contribution
from primary, secondary and tertiary sectors to the GSDP in 2010-11 at constant prices (2004-05) was
11.06, 20.13 and 68.80 percent respectively. At current prices, it was 14.94, 21.08 and 63.98 percent,
respectively. Recent trends reveal that the contribution from primary sector has been decreasing while
that of tertiary sector has been increasing. The contribution of the secondary sector has been almost
stagnant.
1.8 The slowdown in the Indian economy did adversely impact State fnances in 2008-09 and
2009-10. It was particularly alarming in 2009-10, when revenue defcit re-emerged after a gap of three
years and gross fscal defcit shot up above 3% of GDP. Revised estimates available for 2009-10,
however, showed much steeper deterioration over the budget estimates. A turnaround was envis-
aged in the budget 2010-11, with the State possibly reverting to the path of fscal consolidation. The
fnal outcome, however, left a lot to be desired. Various factors had contributed to the States fnancial
uncertainties in the crisis years of 2008-09 and 2009-10, the additional fnancial burden brought to
bear on the exchequer by the Sixth Central/State(s) Pay Commissions (CPC/ SPCs) and the discre-
tionary fscal measures introduced to moderate the impact of the overall macroeconomic slowdown
being the more important among them.
1.9 Though the states fscal imbalances continued to prevail in 2010-11, there were hopeful signs of
recovery. Revenue defcit, which stood at `2638 crore in 2006-07 and rose to `5023 crore in 2009-10,
came down to ` 3674 crore in 2010-11. This improvement was attributed to the 18.70% growth in reve-
nue receipts vis--vis 11.3% in revenue expenditure. The reduced growth in Non-Plan expenditure was
largely due to the deferment of the major portion of expenditure by way of pay and pension revisions due in
2009-10 to 2011-12. As a proportion of GSDP, revenue defcit declined to 1.4% in 2010-11.
1.10 The consumer price index of agricultural and industrial workers in Kerala went up by 19 points
during 2011 (upto August) compared to the corresponding period of 2010. So did the wholesale price
index of agricultural commodities in Kerala. The high rate of infation witnessed by the State resulted
in higher retail prices of almost all essential commodities. Among food crops, the highest price hike
was recorded for oil and oil seeds followed by fruits and vegetables. It was also signifcant that the
price of plantation crops decreased during 2011.
1.11 Unemployment continues to be one of the basic problems of the State. The number of job seek-
ers, as per the live register of employment exchanges in Kerala as on 31.08.2011 was 43.42 lakh,of
which 25.68 lakh (59.1%) were female. However, there is doubt whether these fgures refect the
actual unemployment position as many who have found employment continue to be retained on the
live register for want of information.
Kerala State Planning Board
9
1.12 The Kerala State Entrepreneurs Development Mission was a new initiative launched by the Gov-
ernment in 2011, aiming at providing self- employment to one lakh youths through 10,000 new ven-
tures, over a period of 5 years. The Kerala Financial Corporation is the nodal agency and before
launching self-employment ventures, all the benefciaries are given training jointly with institutions like
the Entrepreneurship Development Institute, KITCO, RSETI, the Centre for Management Develop-
ment etc.
1.13 The labour sector continued to face several problems such as high rates of unemployment and
under employment, low rates of employment creation, unprotected conditions in the unorganized sec-
tor, adverse labour relations, inadequate levels of skill creation and training and ineffciently targeted
social security programmes. The Labour Welfare Fund Boards played a vital role in providing various
welfare measures for labourers. In Kerala, 30 lakh families joined schemes like RSBY and CHIS, of
which 11.79 lakh families come under RSBY and the balance under CHIS. Besides, through the CHIS
PLUS scheme, additional free treatment upto ` 70,000 was being provided to RSBY CHIS benef-
ciaries for treatment of cancer, heart and kidney diseases. This scheme is being implemented through
non-insurance route and payments to the hospitals are being paid directly by Comprehensive Health
Insurance Agency Kerala (CHIAK ).
1.14 Non-resident Keralites, including emigrants living abroad and those who returned to the State
for good, were estimated at 34.30 lakh in 2011. The number of emigrants who returned for good was
estimated to be 15 lakh. Similarly, the number of migrants living in other states (inter-State migrants) in
the country was estimated to be 9.31lakh in 2011. In addition to this, the number of out-migrants who
returned to the State estimated to be 5.11 lakh in 2011. Thus, inter-state migrants numbered 14.42
lakh. The NORKA Department and its feld agency NORKA ROOTS provided social security to the
non-resident Keralites.
1.15 Kerala State which had a low base in food production in the country continued to face serious
challenges in retaining farming area and improving production and productivity of important crops.
The provisional estimate of agricultural income of the State recorded a negative growth of 1.79 per-
cent in 2009-10. Quick estimate for 2010-11 also indicated a decline of 0.78 percent in growth over
2009-10. The share of agriculture and allied sectors in GSDP similarly indicated a fall. The share
was 17.48% in 2004-05 and declined to 10.59% in 2010-11. Keralas agricultural economy has been
undergoing a structural transformation since the mid-seventies by switching over a large proportion of
its traditional crop area devoted to subsistence crop like rice and tapioca to more remunerative cash
crops. The area under rice and tapioca has been declining consistently over the last several years.
Even though several measures such as additional incentives, interest free loans, project based sup-
port for fallow land cultivation, increase in procurement price of rice etc, had been attempted as part
of food security initiatives, the area under rice declined to 2.13 lakh ha during 2010-11 from 2.34 lakh
ha in 2009-10 and production of rice to 5.22 lakh MT from 5.98 lakh MT during this period. It is a fact
that during the last fve years the cost of cultivation had doubled due to increases in labour cost and in
prices of seed and other inputs, which, in turn, adversely affected paddy cultivation. Keralas share in
area under cultivation as well as production of coconut had also been declining over time. Regarding
pepper, domestic price of pepper showed an upward trend and reached a peak in 2010-11 of ` 174.21
per Kg. Area and production under cashew had been steadily declining over the past two decades.
1.16 Nonetheless, the agricultural sector continued to get priority despite all these issues. High-value
farm products such as fruits, vegetables and live stock were promoted. The State Horticulture Mission
and Vegetable and Fruit Promotion Council are the two agencies supported by the State Govern-
ments for the promotion of vegetable and fruit marketing and production. Collective farming is an
important area identifed for securing livelihood opportunities to the poor families.
Economic Review 2011
10
1.17 There had been positive change in milk and egg production in the State. Milk production in-
creased to 26.43 lakh tonnes (provisional) in 2010-11 from 25.37 lakh tonnes in 2009-10. Similarly,
egg production increased to 1685 million nos from 1633 million nos during this period. However, the
per capita availability of egg continued to be very low at 47 eggs/year and poultry meat is 0.9 kg/ year
against the world average of 147 eggs and 11 KG poultry meat/year in the country. The Union Govern-
ment had set a production target of over 52 billion for eggs by 2011-12, a growth rate of 4.3 percent.
1.18 It had been a satisfactory year for industry and allied sectors in Kerala. While the manufacturing
sector in the country as a whole registered a growth rate of 8.2 percent in 2010-11, in Kerala it was a bit
higher at 8.74 percent. The contribution of the manufacturing sector to GSDP at constant and current
prices in 2010-11 was 8.2 percent and 9 percent, respectively. The performance of public sector un-
dertaking was not commendable. Out of the 63 PSUs under the Industries Department, 17 remained
closed. However, there was a signifcant increase in turnover and profts of the proft-making units in
2011 compared to the previous year.
1.19 Micro, small and medium enterprises (MSMEs) sector played a vital role in employment genera-
tion at low capital cost, upholding entrepreneurial spirit and innovation, in the State. During 2010-11,
there were 10882 SS/MSME units and the total investment made was ` 1453 crore. A total number
of 84878 job opportunities were created through these units in 2010-11. Under the Prime Ministers
Employment Generation Programme, a total number of 959 projects involving margin money of `11.84
crore had been sanctioned by various banks, in 2010-11. Similarly, in 2011-12, upto August, 259
projects at a margin money of ` 392 crore had been sanctioned.
1.20 Disbursement of advances by commercial banks in Kerala in 2011 was ` 122823 crore against `
95785 crore in 2010. Priority sector advances disbursed by commercial banks in 2010-11 was ` 71145
crore as against ` 58204 crore in 2010. Deposits accepted by commercial banks in Kerala during 2011
was ` 170547 crore. NRE deposit was ` 37690 crore in 2011 against ` 36886 crore in 2010.
1.21 Even though the global economic crisis adversely affected tourism industry in the State during
2009-10, there has been signifcant improvement during 2010-11. Foreign tourists arrivals increased
by 18.31 percent during 2010-11 compared to the previous fnancial year.
1.22 The installed capacity of power generation at the end of march 2011 through all sources was
2857 MW, the major share being from hydel projects followed by thermal projects. Capacity addition
during 2010-11 was only 4 percent over the previous year. On the other hand, there had been about
4 percent increase in domestic category consumers and 4.7 percent increase in LT &HT commercial
category consumers during 2010-11 compared to 2009-10.
1.23 Surface irrigation constituted the major chunk of irrigation infrastructure in the State. There are
18 dams in the State intended for irrigation. Out of these 14 have storages and the remaining are bar-
rages. During 2010-11, expenditure on major and medium irrigation was ` 145 crore.
1.24 Kerala has achieved the distinction of having the lowest drop out rate among school students in
the country. Out of the total number of school teachers, about 69% are working in private management
schools including aided and unaided schools. The Government had approved a teachers package for
setting up a teachers bank for managing the transition and introducing scientifc methods for recruit-
ment of teachers in aided schools.
1.25 Kerala enjoys a unique position in the health map of India. The health indicators in Kerala are
at par with the western world. We have the lowest infant mortality and maternal mortality rate and the
highest life expectancy in the country. However, the spread of modern disease has become a major
crisis in Kerala. Higher prevalence of mental health problems, suicide rates, death due to road traffc
Kerala State Planning Board
11
accidents and other traumas are other dimensions of the health problem in Kerala. Kerala is facing an
alarmingly high mortality rate at the most productive ages of people. The Human Development Report
2005 had adduced the high life expectancy as one of the reasons for high levels of morbidity in Kerala
and laid stress on better nutrition, environmental sanitation and preventive health care, enhanced role
for the public sector and greater regulation of the private sector. The major problems in the health
sector of Kerala are (1) prevalence of diseases associated with lifestyle and ageing (2) prevalence of
environment related diseases owing to problems of community hygiene and pollution and (3) lack of
infrastructural facilities and trained personnel.
1.26 The success of Kerala health indicators is due, primarily, to higher investment in social capital.
The public sector is unable to meet the demands of health care and people have responded to these
inadequacies by increased use of the emerging private sector. This has led to the growth of the private
medical care in the State and the dependence on private health care is quite high even among lower
income groups and rural in areas. Health sector has to be improved considerably in terms of availabil-
ity and quality of its physical infrastructure, human resources and services so as to fulfl the growing
demand for health services. The present health delivery system has to be improved by increasing ef-
fciency, effectiveness and accountability. The health policy of the State will focus on the requirements
of elders, people residing in remote areas, tribal people, vulnerable groups etc. Similarly, mental health
including psychological care and counselling will be given priority.
1.27 During the fnancial year 2011-12, Government undertook an intensive exercise, involving many
stakeholder consultations for devising its approach to the Twelfth Plan. Forty fve Working Groups
were also constituted for preparation of the Twelfth Plan Document. These Working Groups included
experts, stakeholders, academics and offcials. They have almost completed their work and the Twelfth
Plan Document will be ready soon after the Centre fnalises its work on the 12
th
Plan. In the meanwhile,
work has commenced on preparation of a long-term Perspective Plan for the State. A decision has
also been taken to consitute a specialist Projet Financing Cell in the State Planning Board to explore
avenues for external funding of major projects wherever feasible.
Economic Review 2011
Kerala Economy and its Finance
C
H
A
P
T
E
R
14
Kerala State Planning Board
15
TKH VORZGRZQ LQ WKH ,QGLDQ HFRQRP\ GLG DGYHUVHO\ LPSDFW 6WDWH QDQFHV LQ DQG
,WZDVSDUWLFXODUO\DODUPLQJLQZKHQUHYHQXHGHFLWUHHPHUJHGDIWHUDJDSRIWKUHH
\HDUV DQG JURVV VFDO GHFLW VKRW XS DERYH RI *'3 5HYLVHG HVWLPDWHV DYDLODEOH IRU
however, showed much steeper deterioration over the budget estimates. A turnaround was envisaged
LQWKHEXGJHWZLWKWKH6WDWHSRVVLEO\UHYHUWLQJWRWKHSDWKRIVFDOFRQVROLGDWLRQ7KHQDO
outcome, however, left a lot to be desired.
9DULRXVIDFWRUVKDGFRQWULEXWHGWRWKH6WDWHVQDQFLDOXQFHUWDLQWLHVLQWKHFULVLV\HDUVRI
DQGWKHDGGLWLRQDOQDQFLDOEXUGHQEURXJKWWREHDURQWKHH[FKHTXHUE\WKH6L[WK&HQWUDO
6WDWHV3D\&RPPLVVLRQV&3&63&VDQGWKHGLVFUHWLRQDU\VFDOPHDVXUHVLQWURGXFHGWRPRGHUDWH
the impact of the overall macroeconomic slowdown being the more important among them.
7KRXJKWKHVWDWHVVFDOLPEDODQFHVFRQWLQXHGWRSUHYDLOLQWKHUHZHUHKRSHIXOVLJQVRI
UHFRYHU\5HYHQXHGHFLWZKLFKVWRRGDW`2638 crore in 2006-07 and rose to `5023 crore in 2009-10,
came down to ` 3674 crore in 2010-11. This improvement was attributed to the 18.70% growth in reve-
nue receipts vis--vis 11.3% in revenue expenditure. The reduced growth in Non-Plan expenditure was
largely due to the deferment of the major portion of expenditure by way of pay and pension revisions due in
WR$VDSURSRUWLRQRI*6'3UHYHQXHGHFLWGHFOLQHGWRLQ
7KH6WDWHVKLJKLQFLGHQFHRIUHYHQXHGHFLWLVPDLQO\DWWULEXWHGWRWKHKLJKHUOHYHORIGHYROXWLRQ
to local self governments for their developmental expenditure, which is actually used for asset cre-
ation. Similarly, grants given to the Universities and other autonomous bodies like the Kerala Road
Fund Board etc. for capital asset creation also get accounted as revenue expenditure, contributing to
RYHUDOOUHYHQXHGHFLWRIWKH6WDWH,IVXFKH[SHQGLWXUHZKLFKXOWLPDWHO\UHVXOWVLQDVVHWFUHDWLRQLQ
WKH6WDWHLVH[FOXGHGIURPWKHSXUYLHZRIUHYHQXHGHFLWWKHHIIHFWLYHUHYHQXHGHFLWZRXOGEHLQWKH
range of `1326 crore, which is 0.48% of GSDP.
7KH EXGJHW IRU KDG SURMHFWHG D UHYHQXH GHFLW RI `5534 crore, which would work to
1.81% of GSDP, the increase being largely due to the pay and pension revisions for the employees
and the consequent payment of arrears of pension and salaries. The higher level of devolution to lo-
cal self governments as per the recommendations of the 4th State Finance Commission was also a
PDMRUFRQWULEXWRU\IDFWRUIRUWKHHQKDQFHGUHYHQXHGHFLW$[Link])LVFDO5HVSRQVLELO-
LW\$PHQGPHQW$FWWKH6WDWH*RYHUQPHQWLVFRPPLWWHGWRDFKLHYLQJDUHYHQXHGHFLWWDUJHW
of 1.4% against the 1.8% envisaged in the budget for 2011-12. Given the present trend in revenue
receipts and expenditure, the target is hard to achieve.
Kerala Economy and its Finance
Economic Review 2011
16
5HYHQXHGHFLWRI` FURUHZDVWKHPDMRUFRQWULEXWRUWRWKHVFDOGHFLWRI` 7731 crore in
,QWKHODWWHUZDVQDQFHGPDLQO\WKURXJKPDUNHWERUURZLQJV` 4771 crore) and
from PF and Small Savings (` FURUH+RZHYHUDVKLIWLQWKHQDQFLQJSDWWHUQLVHQYLVDJHGLQ
DVWKHGHFLWLVVRXJKWWREHPHWWKURXJKVHFXULWLHVLVVXHGWRWKH1DWLRQDO6PDOO6DYLQJV
Fund (`2177 crore). In 2007-08 net receipts from NSSF had declined to ` 107 crore and in 2008-09
and 2009-10 the net receipts were negative. In 2010-11 the net receipts under this category was just
` 42 crore.
7KHUDWLRRIUHYHQXHGHFLWDQGVFDOGHFLWLQGLFDWHVWKHH[WHQWWRZKLFKERUURZHGIXQGVDUH
XWLOL]HG IRU QDQFLQJ UHYHQXH H[SHQGLWXUH 7KH UDWLR KDV EHHQ VKRZLQJ D GHFOLQLQJ WUHQG VLQFH
5HYHQXHGHFLWZKLFKZDVRIVFDOGHFLWLQGURSSHGVKDUSO\WR
LQ'HWDLOVRIPDMRUGHFLWLQGLFDWRUVDUHJLYHQLQ7DEOH
TabIe-2.1
Major Decit Indicators
( ` in crore)
Year
Revenue Decit FiscaI Decit Primary Decit
GSDP
Amount % to
GSDP
Amount % to
GSDP
Amount % to
GSDP
2005-06 3129.15 2.29% 4181.72 3.06% -382.00 -0.28% 136841.76
2006-07 2637.95 1.72% 3821.87 2.49% 367.83 0.24% 153784.88
2007-08 3784.84 2.16% 6100.21 3.48% -1770.56 -1.01% 175141.08
2008-09 3711.67 1.85% 6346.21 3.16% -1686.52 -0.84% 201019.75
2009-10 5022.97 2.18% 7871.60 3.42% -2579.12 -1.12% 230315.55
2010-11 3673.87 1.38% 7730.46 2.91% -2040.80 -0.77% 265322.00
2011-
12(BE)
5533.91 1.81% 10506.99 3.43% -4252.43 -1.39% 306172.90
Source: Finance department, Govt. of Kerala
7KH LPSRUWDQW QDQFLDO LQGLFDWRUV IRU *RYHUQPHQW RI .HUDOD IRU WKH SHULRG IURP WR
2011-12 (BE) are given in Table 2.2.
TabIe-2.2
FinanciaI Indicators for Government of KeraIa
ParticuIars 2006-07 2007-08 2008-09 2009-10 2010-11 2011-12
Balance from Current Rev-
enue ( BCR)
(` in Crore)
-1332.00 - 2749 - 2306 - 2155 -909.68 2687.89
Interest Ratio 0.23 0.21 0.19 0.20 0.18 0.16
&DSLWDO2XWOD\&DSLWDO5H-
ceipt
0.22 0.24 0.27 0.26 0.43 0.37
Return of Investment ratio 0.013 0.011 0.012 0.008 0.02 NA
2XWVWDQGLQJ*XDUDQWHHV
Revenue Receipt
0.52 0.39 0.31 0.29 0.24 NA
Assets/ Liabilities 0.40 0.40 0.40 0.40 NA NA
Source : Finance department. Government of Kerala
Kerala State Planning Board
17
2.9 The average growth rate of revenue receipts from 2005-06 to 2008-09 was around 16.10% but
slipped to 6.52% in 2009-10, thanks to the global economic slowdown. A sharp pick up to an impres-
sive 18.70% was reported in 2010-11, the actual receipt being ` 30990.95 crore against an estimated
target of ` 31180.82 crore. The estimated target for 2011-12 is ` 39427.50 crore. This underscores
the consistent efforts and measures being taken to augment revenue collection. The States own tax
revenue contributed 70.09% of the total revenue receipts of the State in 2010-11.
2.10 Meanwhile, Central transfers comprising share in central taxes and grants-in-aid have been de-
clining. They constituted 29.94%t of revenue receipts in 2005-06, but declined to 23.68%t in 2010-11.
The trend is expected to continue in 2011-12 as well. As per budget estimates, Central transfers of
`10255.04 crore are to contribute 26.01 per cent of the total revenue receipts of ` 39427.50 crore in
2011-12. Details of revenue receipt form 2005-06 to 2011-12 (BE) are given in Table 2.3
TabIe-2.3
Revenue Receipt
(` in Crore)
Year
State's own Tax
Revenue
State's own Non
Tax Revenue
State's Own
Revenue
(2+4)
Share of CentraI
Taxes and Grants
TotaI Revenue
(6+8)
Amount Growth
rate
Amount Growth
rate
Amount Growth
rate
Amount Growth
rate
Amount AnnuaI
Growth
rate
1 2 3 4 5 6 7 8 9 10 11
2005-06 9779.64 9.10 936.77 14.37 10716.41 9.54 4578.11 23.14 15294.52 13.30%
2006-07 11941.82 22.11 937.57 0.09 12879.39 20.18 5307.23 15.93 18186.62 18.91%
2007-08 13668.95 14.46 1209.55 29.01 14878.50 15.52 6228.29 17.35 21106.79 16.06%
2008-09 15990.18 16.98 1559.29 28.92 17549.47 17.95 6962.71 11.79 24512.18 16.13%
2009-10 17625.02 10.22 1852.22 18.78 19477.24 10.98 6632.16 -4.74 26109.40 6.52%
2010-11 21721.69 23.24 1930.79 4.24 23652.48 21.44 7338.47 10.65 30990.95 18.7
2011-12
(BE)
26641.53 22.65 2530.94 31.08 29172.47 23.34 10255.04 39.74 39427.51 27.22
AAGR
from
2005-
06 to
2011-12
16.97 18.07 16.99 16.27 16.69
Source : Finance Department, Govt. of Kerala
States Own Tax Revenue
2.11 Income from sales tax, stamps and registration fees, State excise duty, motor vehicle tax and land
revenue forms the major source of State revenue. The growth rate in what is known as States own
tax revenue improved in 2010-11. Against the lower rate of 10.22% in 2009-10, it improved to 23.24%
in 2010-11. Against the estimated target of ` 20884.23 crore, the actual receipt during 2010-11 added
up to ` FURUH%UHDNXSRIWKH6WDWHV2ZQ7D[5HYHQXHIRUWR%(DUH
given in Table 2.4.
Economic Review 2011
18
TabIe-2.4
State's Own Tax Revenue
(` in Crore)
Year Land
Rev-
enue
Stamps
and
Regis-
tration
fees
State
Excise
Duties
SaIes tax Motor
ve-
hicIes
tax
Others TotaI AnnuaI
Growth
rate
2005-06 43.88 1101.42 841.00 7037.97 628.51 126.86 9779.64 9.10
2006-07 47.01 1519.93 953.07 8563.31 707.74 150.76 11941.82 22.11
2007-08 47.21 2027.97 1169.25 9371.76 853.17 199.59 13668.95 14.46
2008-09 47.56 2002.99 1397.64 11377.13 937.45 227.41 15990.18 16.98
2009-10 53.93 1896.41 1514.81 12770.89 1131.10 257.88 17625.02 10.22
2010-11 55.97 2552.49 1699.54 15833.11 1331.37 249.21 21721.69 23.24
2011-12 (BE) 162.84 3252.17 2059.05 19427.90 1410.73 328.84 26641.53 22.65
AAGR from
2005-06 to
2011-12
7.30 40.43 25.37 26.79 24.10 34.83 16.97
Source : Finance Department, Govt. of Kerala
States Own Non-Tax Revenue
2.12 The consistent improvement in receipts under the States non-tax revenue suffered a setback
during 2010-11. Growth in non-tax revenue, which was around 29% during 2007-08 and 2008-09,
dropped to 18.79% in 2009-10. This, however, declined, rather sharply, to 4.24% per cent in 2010-11.
7KHUDWLRRI6WDWHVQRQWD[UHYHQXHWR*6'3KDVEHHQODUJHO\XFWXDWLQJVLQFH,WKRYHUHG
between 0.68% and 0.80% during 2005-06 - 2009-10. It came down to 0.73% in 2010-11. Receipts
from forest, lotteries and various social developmental services remained the major contributors to the
States non-tax revenue. Against an estimated target of ` 2314.31 crore, actual receipt was much less
at ` 1930.79 crore in 2010-11. The component- wise details of non-tax revenue receipts from 2005-06
to 2011-12 are shown in Table 2.5.
TabIe-2.5
State's Own Non-Tax Revenue
( ` in Crore)
Year
Forest Debt Services
(interest)
SociaI DeveIop-
ment Services*
Others TotaI
Amount AnnuaI
Growth
rate
Amount AnnuaI
Growth
rate
Amount AnnuaI
Growth
rate
Amount AnnuaI
Growth
rate
Amount AnnuaI
Growth
rate
2005-06 189.63 -5.04 46.35 14.42 236.67 12.78 464.12 25.77 936.77 14.37
2006-07 174.56 -7.94 44.63 -3.71 242.26 2.36 476.12 2.59 937.57 0.09
2007-08 154.45 -11.52 69.65 56.06 369.76 52.61 615.69 29.30 1209.55 29.01
2008-09 223.71 44.84 83.69 20.16 310.96 -15.90 940.93 52.83 1559.29 28.91
2009-10 272.80 21.94 152.50 82.22 294.64 -5.25 1132.28 20.40 1852.22 18.79
2010-11 274.1 0.48 171.47 12.44 368.81 25.17 1116.41 -1.40 1930.79 4.24
2011-
12(BE)
330.12 20.44 192.43 12.22 804.35 118.09 1204.04 7.85 2530.94 31.08
Source : Finance Department, Govt. of Kerala
* It includes education, medical and public health, Agriculture, Rural Development, Animal Husbandry, Co-
operation, Industries, Community Development and miscellaneous Social Development Organisation
Kerala State Planning Board
19
&RPSRQHQWZLVH UHDOL]DWLRQ RI QRQWD[ UHYHQXH RI .HUDOD DQG RWKHU 6WDWHV IURP WR
2010-11 are given in Table 2.6
TabIe-2.6
Component-wise reaIisation of Own- Non Tax Revenue-KeraIa & AII States
(` in Crore)
Items 2008-09 Accounts 2009-10 (RE) 2010-11 (BE)
KeraIa AII states KeraIa AII States KeraIa AII States
6WDWHV2ZQ1RQWD[
Revenue
1559.28
(100.00)
81751.17
(100.00)
1780.32
(100.00)
97178.09
(100.00)
2314.31
(100.00)
102609.20
(100.00)
Interest receipts 83.69
(5.37)
81751.17
(100.00)
1780.32
(100.00)
97178.09
(100.00)
2314.31
(100.00)
102609.20
(100.00)
'LYLGHQG3URW 33.53
(2.15)
16356.48
(20.01)
107.04
(6.01)
16812.18
(17.30)
119.43
(5.16)
16356.47
(15.94)
General Services 817.74
(52.44)
832.7 (1.02) 36.56
(2.05)
487.89
(0.50)
41.31
(1.78)
757.51
(0.74)
2IZKLFK6WDWH/RW-
tories
481.39
(30.87)
5089.4 (6.23) 631.45
(35.47)
5769.13
(5.94)
694.6
(30.01)
6558.73
(6.39)
Social & Community
Service
184.99
(11.86)
7726.12
(9.45)
186.1
(10.45)
8493.44
(8.74)
231.25
(9.99)
11386.52
(11.10)
Economic Service 439.34
(28.18)
34555.4
(42.27)
594.38
(33.39)
40182.64
(41.35)
952.19
(41.14)
46507.15
(45.32)
2IZKLFK)RUHVWU\
Wild Life
223.71
(14.35)
2926.65
(3.58)
272.31
(15.3)
3245.15
(3.34)
360.11
(15.56)
3638.95
(3.55)
Source : State Finances : A study of Budgets of 2010-11 by RBI
(Figures in brackets are percentage to State's own Non-Tax Revenue.)
2.14 A comparative position of non-tax revenue with neighboring states during 2009-10 (B.E) is given
LQ7DEOH,WUHYHDOVWKDWQRQWD[UHYHQXHUHDOL]HGE\$QGKUD3UDGHVK.DUQDWDNDDQG7DPLO1DGX
are 16.91%, 4.51% and 5.74%, respectively, of their total revenue expenditure whereas for Kerala it is
4.68%. Similarly the ratios of non-tax revenue to the revenue receipts of Andhra Pradesh, Karnataka
and Tamil Nadu are 16.39%,, 4.40% and 5.84%, respectively, where as for Kerala it is 5.18%.
TabIe-2.7
Comparative Position of States Own Non-Tax Revenue in Neighbouring
States: 2010-11 (BE)
(` in Crore)
Items Andhra
Pradesh
Karnataka TamiI Nadu KeraIa
2ZQ1RQWD[5HYHQXH 15702.80 2819.90 4101.28 2314.31
Revenue Expenditure 87100.10 53138.29 66488.17 34810.38
Revenue Receipts 90648.42 53638.78 63091.74 31180.82
NTR/RE (percentage) 18.03 5.31 6.17 6.65
NTR/RR (percentage) 17.32 5.26 6.50 7.42
Source : State Finances : A study of Budgets of 2010-11, by RBI
Economic Review 2011
20
Central Transfers
2.15 Central transfers comprises share in Central taxes and grants-in-aid from the Centre. The share
of States in net proceeds of shareable Central taxes during the 13th Finance Commssion period from
WRLV2XWRIWKLV.HUDODVVKDUHLV7KHVKDUHRIJUDQWVLQDLGWR6WDWH
during the same period is 2.46%t. A consistent decline in Central transfers has been apparent in recent
years. It was as high as 29.94% in 2005-06 but dropped to 25.40% in 2009-10 Central transfers as a
percentage of GSDP have also been declining since 2008-09. Against an estimated target of ` 7982.28
crore, actual Central transfer received in 2010-11 was ` 7338.47 crore. Details of Central Transfers to
Kerala during the period from 2005-06 to 2011-12 are shown in Table 2.8.
TabIe-2.8
CentraI Transfers: 1999-00 to 2010-11 ([Link])
Year
Share in CentraI taxes &
Duties
Grant-in-aid and other
receipts from Centre for
PIan & Non-PIan
TotaI Transfers
Amount AnnuaI
Growth
rate
Amount AnnuaI
Growth rate
Amount AnnuaI
Growth
rate
2005-06 2517.18 4.67 2060.93 57.00 4578.11 23.17
2006-07 3212.00 27.60 2095.23 1.66 5307.23 15.93
2007-08 4051.70 26.14 2176.59 3.88 6228.29 17.35
2008-09 4275.52 5.52 2687.19 23.46 6962.71 11.79
2009-10 4398.78 2.88 2233.38 -16.89 6632.16 -4.75
2010-11 5141.85 16.89 2196.62 -1.65 7338.47 10.65
2011-12 (BE) 6176.97 20.13 4078.07 85.65 10255.04 39.74
Source : Finance Department, Govt. of Kerala
2.16 Central transfers in Kerala and neighboring states during 2009-10 are given in Table 2.9
TabIe2.9
Comparative position of CentraI Transfers to Neighboring States
State
2009-10 (B.E)
Share of Cen-
traI Taxes
Grant from Centre TotaI Amount Percentage
Andhra Pradesh 14505 13441 27946 7.28
Karnataka 9060 4665 13725 3.58
Tamil Nadu 10402 7193 17595 4.59
Kerala 4826 5530 10356 2.70
All Sates 200466 183282 383748 100.00
Source: State Finances: A study of Budgets of 2010-11 by RBI
Kerala State Planning Board
21
Expenditure Pattern:
Revenue Expenditure
2.17 The major items of expenditure under revenue account are, pension, interest payments, salaries
and devolutions to local bodies. The combined expenditure of social and economic services under rev-
enue account constitutes the developmental expenditure. The collective expenditure of maintenance,
expansion and development funds given to LSGD also needs to be reckoned as developmental ex-
penditure. Expenditure on interest charges, pension charges, administrative services, police, etc. are
the main components of non-developmental revenue expenditure. The ratio of revenue expenditure
with relative to GSDP declined slightly to 13.07% in 2010-11 from 13.50% in 2009-10. The decline has
been consistent since 2008-09. The share of developmental expenditure in total revenue expenditure
marginally improved to 54.58% in 2010-11 from 53.43% in 2009-10. The developmental expenditure
estimated in BE 2011-12 accounts for 59.37% of the total revenue expenditure. Trend in revenue ex-
penditure is given in Table 2.10 and the component-wise details are given in Appendix 2.1.
TabIe-2.10
Trend in Revenue Expenditure
(` in Crore)
Year
TotaI Revenue Expendi-
ture
DeveIopment
Expenditure
Non DeveIopment
Expenditure
Amount AnnuaI
Growth
rate
Amount % to totaI
Revenue
expenditure
Amount % to totaI
Revenue
expendi-
ture
2005-06 18423.58 7.30 9757.79 52.96 8665.79 47.04
2006-07 20824.57 13.03 9283.26 44.58 11541.31 55.42
2007-08 24891.64 19.53 12332.42 49.54 12559.22 50.46
2008-09 28223.85 13.39 15154.25 53.69 13069.60 46.31
2009-10 31132.38 10.31 16633.43 53.43 14498.95 46.57
2010-11 34664.82 11.35 18918.57 54.58 15746.25 45.42
2011-12(BE) 44961.41 29.70 26694.87 59.37 18266.55 40.63
Source : Finance Department, Govt. of Kerala
Capital Expenditure
2.18 The consistent efforts to provide adequate funds for creation of capital assets have been
apparent since 2007-08. The capital outlay of ` 902.58 crore in 2006-07 rose to ` 1474.58 crore
in 2007-08. The trend of enhanced level of capital outlay continued in subsequent years also. The
capital outlay increased to ` 3363.69 crore in 2010-11 from ` 2059.38 crore in 2009-10. The ratio of
capital outlay to GSDP that stood below 1% in some of the preceeding years advanced to 1.27% in
2010-11. The capital expenditure estimated for 2011-12 is ` 5063.82 crore, its ratio to GSDP being
1.55%. Public works continued to remain the major segment of capital outlay. Details of capital expen-
diture and total expenditure from 2005-06 to 2011-12 (BE) are given in Table 2.11 and the sector-wise
capital expenditure and its growth rate are given in Appendix 2.2.
Economic Review 2011
22
TabIe-2.11
CapitaI Expenditure and TotaI Expenditure: 2005-06 to 2010-11
(` in crore)
Year
CapitaI
OutIay
Loan
Dis-
burse-
ments
CapitaI
Expenditure
TotaI
Expenditure
CapitaI
expendi-
ture as %
to totaI
expendi-
ture
Amount Amount Amount
AnnuaI
Growth
Rate
Amount
AnnuaI
Growth
Rate
2005-06 816.95 287.11 1104.06 19.83 19471.30 7.89
2006-07 902.58 349.39 1251.97 13.4 22076.53 13.38 5.67
2007-08 1474.58 893.16 2367.74 89.12 27259.38 23.48 8.69
2008-09 1695.60 983.69 2679.29 13.16 30903.14 13.37 8.67
2009-10 2059.38 876.68 2936.06 9.58 34068.44 10.24 8.62
2010-11 3363.69 761.74 4125.43 40.51 38790.24 13.86 10.64
2011-
12(BE)
3834.69 1229.13 5063.82 22.75 50025.24 28.96 10.12
Source: Finance Department, Govt. of Kerala
2.19 During 2010-11, the commitments on three major items coming under non-plan/non-develop-
PHQWDOH[SHQGLWXUHYL]LQWHUHVWSHQVLRQDQGVDODU\DFFRXQWHGIRUDERXWRIWKHWRWDOUHYHQXH
receipt of the state whereas it was 75.83% in 2009-10. The rate of growth in interest payment dur-
ing 2010-11 over the previous year was 7.50%. Expenditure as salary during the period went up by
12.94%. As against 2009-10, Expenditure on pension during 2010-11 went up by ` 1061.99 crore.
The total Expenditure on interest, pension and salary which was 80.19% of the revenue receipts and
66.57% of revenue expenditure in 2005-06 reached at a level of 72.68% of revenue receipts and
64.98% of revenue expenditure in 2010-11. (Appendix 2.3).
'HEW3UROH
7KH6WDWHVGHEWLQFOXGLQJERUURZLQJVRQDFFRXQWRILQWHUQDOGHEWORDQVDQGDGYDQFHVIURP*2,
and liabilities in respect of Small Savings, PF etc, touched ` FURUHDWWKHHQGRIWKHQDQFLDO\HDU
2010-11. The annual growth rate of debt dropped to 10.86%in 2010-11 from 12.17% in 2009-10. The
net addition to liabilities under small savings during 2008-09 - 2010-11 had been consistently large.
2XWVWDQGLQJOLDELOLWLHVXQGHUVPDOOVDYLQJVDOVRURVHWR` 10410.34 crore at the end of 2010-11 from
`6535.63 crore at the beginning of 2008-09. The net addition during this period amounted to ` 3874.71
crore. The repayment of past debt together with its interest charges always constituted a major por-
tion of the total debt-receipts. Total debt availed during 2010-11 was ` 23874.46 crore. An amount of
` 16170.65 crore was expended for the repayment of the debt in 2010-11. Interest charges on debt
outstanding for 2010-11 notched ` 5689.66 crore and repayment of past debt together with interest
charges, totalled ` 21860.31 crore, constituting 91.56% of the total debt-receipts of ` 23874.46 crore
in 2010-11. Details regarding the States debt from 2005-06 to 2011-12 (BE) are given in Table 2.12.
Kerala State Planning Board
23
TabIe-2.12
Debt of the State
(` in Crore)
Year
InternaI
Debt
Growth
rate
SmaII
Savings
Provident
Fund,
Others
Growth
rate
Loans
and Ad-
vances
from the
CentraI
Govt.
Growth
rate
TotaI
Growth
rate
2005-06 25670.72 18.43 14840.93 0.34 5417.40 0.12 45929.05 9.67
2006-07 29969.15 16.74 14534.26 -2.07 5371.77 -0.84 49875.18 8.59
2007-08 34019.00 13.51 15858 9.10 5533.00 3.00 55410.00 11.10
2008-09 38814.00 14.10 18447.00 16.33 6009.00 8.60 63270.00 14.19
2009-10 43368.00 11.73 21296 15.44 6305.00 4.93 70969.00 12.17
2010-11 48528.10 11.9 23786.06 11.69 6359.08 0.86 78673.24 10.86
2011-12
BE
56288.15 15.99 25000.55 5.11 7457.99 17.28 88746.69 12.8
AAGR
from
2005-06
to2011-
12
14.63 7.99 4.85 11.34
Source : Finance Department, Govt. of Kerala
2.21 A comparison of debt / GSDP ratio as well as percapita debt liability of Kerala with neighboring
states is shown in Table 2.13. The per capita debt of Kerala, which was ` 12605 in 2005, increased to
` 18042 in 2009.
TabIe-2.13
Debt Position: Comparison with Other States
State Debt/GSDP Ratio(%) Per Capita Debt (`)
2005 2006 2007 2008 2009 2005 2006 2007 2008 2009
Andhra
Pradesh
38 39 35 25 30 10191 11470 11951 10027 11256
Karnataka 27 26 24 22 24 7463 8366 8624 8933 10182
Kerala 34 32 32 31 31 12605 13725 14803 16318 18042
Tamil Nadu 25 24 22 21 26 7751 8804 9168 9780 11290
All States 32 32 29 27 25 8367 9334 9947 10127 11086
Source: Budget in Brief, Govt. of Kerala 2009-10
Source: State Finances: A study of Budgets of 2010-11 by RBI
2.22 Gross retention (receipt minus disbursement) and net retention (gross retention minus interest)
were ` 7699.75 crore and ` 2407.84 crore, respectively, in 2009-10 against ` 7703.81 crore and
`2013.38 crore, respectively in 2010-11. Budget estimate for 2010-11 shows the gross retention as
`10429.71 crore and net retention as `FURUH'HWDLOVRIGHEWSUROHRIWKH6WDWHDUHJLYHQLQ
Appendix 2.4.
Economic Review 2011
24
Contingent Liabilities
2.23 The outstanding guarantees of the State Government from 2005-06 to 2010-11 are shown in
Table 2.14. Contingent liabilities also become the debt obligations of the State in the event of default
by borrowing public sector units for which Government is a guarantor.
TabIe-2.14
Outstanding Guarantees
(` in Crore)
Year Maximum Amount Guaranteed Amount Outstanding
2005-06 13751.80 11934.69
2006-07 12646.70 9405.33
2007-08 14871.08 8317.34
2008-09 11385.54 7603.32
2009-10 10225.78 7495.00
2010-11 12625.07 7425.79
Source : Finance Department, Govt. of Kerala
INCOME AND POPULATION
Global Scenario
:RUOG HFRQRPLF RXWORRN :(2 SURMHFWLRQV LQGLFDWH D PRGHUDWH JURZWK RI DERXW WKURXJK
2012. Real GDP in the advanced economies was projected to expand at an anemic pace of about
1% in 2011 and 2% in 2012, helped by a gradual unwinding of the temporary forces that had held
back activity during much of the second quarter of 2011 However, this assumed that European policy-
makers would contain the crisis in the euro area and its periphery, that the U.S. policymakers would
VWULNH D MXGLFLRXV EDODQFH EHWZHHQ VXSSRUW IRU WKH HFRQRP\ DQG PHGLXPWHUP VFDO FRQVROLGDWLRQ
DQGWKDWYRODWLOLW\LQJOREDOQDQFLDOPDUNHWVZRXOGQRWHVFDODWH0RUHRYHUWKHUHPRYDORIPRQHWDU\
accommodation in advanced economies is now expected to pause. Under such a scenario, emerging
capacity constraints and policy tightening, much of which has already happened, would lower growth
rates in emerging and developing economies to a still very solid pace of about 6% in 2012. Details are
given in Appendix 2.5.
2.25 But the ground realities seem different. For one, the euro area runs beyond the control of policy-
makers, notwithstanding the strong policy response agreed at the July 21, 2011, EU summit. Policy-
makers are now expected to ratify swiftly the commitments made at the July summit. In the meantime,
the European Central Bank (ECB) must continue to intervene strongly to maintain orderly conditions
in sovereign debt markets. For another, things are not shaping well in the US what with the political
LPSDVVHRYHUVFDOFRQVROLGDWLRQDZHDNKRXVLQJPDUNHWUDSLGLQFUHDVHVLQKRXVHKROGVDYLQJUDWHV
DQGGHWHULRUDWLQJQDQFLDOFRQGLWLRQV'HHSSROLWLFDOGLYLVLRQVVHHPWROHDYHWKHFRXUVHRI86SROLF\
KLJKO\XQFHUWDLQ7KHUHLVDVHULRXVULVNWKDWKDVW\VFDOFXWEDFNVZLOOIXUWKHUZHDNHQWKHRXWORRNZLWK-
out providing long-term reforms required to reduce debt to more sustainable levels.
National Scenario
7KHRIFLDO*'3GDWDIRUWKHVHFRQGTXDUWHURIWKLVVFDO\HDU-XO\6HSWHPEHUUHHFWWKH
economic slowdown more vividly than they did in the previous quarter. The deceleration in economic
activity has been in evidence for quite some time now and seen across many sectors. Forecasters,
Kerala State Planning Board
25
ERWK RIFLDO DQG SULYDWH KDYH EHHQ FRQVLVWHQWO\ UHYLVLQJ GRZQZDUGV WKHLU SURMHFWLRQV IRU WKH \HDU
+HQFHWKH&HQWUDO6WDWLVWLFV2IFHGDWDSHJJLQJVHFRQGTXDUWHUJURZWKDWWKHORZHVWLQQLQH
TXDUWHUVDQGVKDUSO\ORZHUWKDQWKHSUHYLRXVTXDUWHUVGLGQRWFRPHDVDVXUSULVH2YHUWKH
same period last year, the growth rate was 8.4%. The decline was spread across agriculture and most
of the sub-sectors of industry, while the services performed well. Agriculture grew by 3.2%t, as against
5.4% last year. It is, however, hoped that the remaining two quarters would see the farm sector making
a recovery, buoyed by the good monsoon. As for manufacturing, the sharp fall in growth from 7.8% last
\HDUWRQRZZDVQRWXQH[SHFWHG7KHPRQWKO\LQGXVWULDOSURGXFWLRQJXUHVKDGFOHDUO\LQGLFDWHG
the downtrend. Mining output fell by 2.9%, whereas it recorded a growth of 8% in the second quarter
of last year.
2.27 The slowdown in general and the decline in manufacturing and mining in particular are at-
tributed to a number of well-known factors. The debt crisis in Europe and the lackluster performance
RI WKH 86 HFRQRP\ KDYH FHUWDLQO\ KDG WKHLU LPSDFW RQ ,QGLD 6SHFLFDOO\ ,QGLDV ERRPLQJ H[SRUW
SHUIRUPDQFHGXULQJWKHUVWKDOIRIWKH\HDUFRXOGQRWEHVXVWDLQHGLQWKHIDFHRIGHPDQGFRQWUDFWLRQ
in the advanced economies. Monetary tightening by the RBI had increased the cost of borrowing. The
Governments procrastination in taking certain key decisions related to mining, granting infrastructure
concessions and setting tariffs had been another contributory factor. By far, the most worrying aspect
KDGEHHQWKHIDOOLQLQYHVWPHQW:KLOHWKHJURVV[HGFDSLWDOIRUPDWLRQ*)&)UHJLVWHUHGDQHJDWLYH
growth of 0.6%, investment rate dropped to 28%. These suggest dimmer growth prospects in the
PRQWKVDKHDG,WLVWLPHWRUHDOL]HWKDWJURZWKUDWHVZRXOGEHPRUHLQWKHUDQJHRIWRWKDQ
the 9% that was hoped for earlier.
National Income
2.28 The Gross National Income (GNI) at factor cost at 2004-05 prices was now estimated at
` 48,33,178 crore in 2010-11, against the previous years estimate of ` 44,79,973 crore (Table 2.15).
In terms of growth rates, the gross national income was estimated to rise by 7.9% in 2010-11, in
comparison to the growth rate of 8.4% in 2009-10. The GNI at factor cost at current prices is now
estimated at ` 70,78,512 crore in 2010-11, as compared to Rs 60,53,585 crore in 2009-10, showing a
rise of 16.9%t. The NNI at factor cost at current prices is now estimated at ` 63,25,038 crore during
2010-11, as compared to ` 53,95,687 crore during 2009-10, showing a rise of 17.2 per cent.
Gross Domestic Product
2.29 The GDP at factor cost at constant (2004-05) prices in 2010-11 is now estimated at Rs. 48,
85,954 crore showing a growth of 8.4% over the estimated ` 45,07,637 crore in 2009-10,. The increase
ZDVGXHWRKLJKJURZWKLQWUDQVSRUWVWRUDJHDQGFRPPXQLFDWLRQQDQFLQJLQVXUDQFHUHDO
estate & business services (10.4%), trade, hotels & restaurants (9.0%), and construction (8.0%). At
FRQVWDQWSULFHVWKHSULPDU\VHFWRULHDJULFXOWXUHIRUHVWU\VKLQJVKRZHGDKLJKJURZWKRILQ
2010-11 against 1% in 2009-10. The growth of secondary sector was 7.2% and that of service sector
9.3% in 2010-11. The GDP at factor cost at current prices in 2010-11 was estimated at ` 71,57,412
crore showing a growth rate of 17% over the estimate of ` 60,91,485 crore in 2009-10.
Per Capita Net National Income
2.30 The per capita income (per capita net national income at factor cost) in real terms, i.e. at 2004-05
prices, was estimated at Rs. 35,993 for 2010-11 against Rs. 33,843 in 2009-10, an increase of 6.4%.
The per capita income at current prices was estimated at Rs. 53,331 in 2010-11 against Rs. 46,117 for
the previous year, a growth of 15.6%.
Economic Review 2011
26
TabIe2.15
NationaI Income, Domestic Product & Per Capita Income at Factor Cost
(AII India) (` in Crore)
SI.
No
Item at factor
cost
At 2004-05 Prices At Current Prices
2008-09 2009-10
(PE)
2010-11
(QE)
2008-09 2009-10
(PE)
2010-11
(QE)
1 Gross National
Income (GNI)
4133292 4479973
(8.4)
4833178
(7.9)
5,270,644 6,053,585
(14.9)
7,078512
(16.9)
2 Net National
Income (NNI)
3664388 3959653
(8.1)
4268715
(7.8)
4,705,447 5,395,687
(14.7)
6,325,038
(17.2)
3 Gross domestic
product (GDP)
4158676 4507637
(8.4)
4885954
(8.4)
5,303,567 6,091,485
(14.9)
7,157,412
(17.5)
4 Net domestic
product (NDP)
3689772 3987317
(8.1 )
4321491
(8.4)
4,738,370 5,433,587
(14.7)
6,403,938
(17.9)
5 Per capita Net
National Income
(`)
31,754 33,843
(6.6)
35,993
(6.4)
40775 46,117
(13.1)
53,331
(15.6)
Note: The fgures in Parenthesis shows the percentage change over previous year.
QE-Quick Estimate, PE- Provisional Estimate
Source: Central Statistical Organisation.
2.31 Details of GDP and National Income at current and constant (2004-05) prices from 2004-05 to
2010-11 with percentage change over previous year are given in Appendix 2.6 to 2.9. The details of
Sectorwise Distribution of GDP at Factor cost by Economic Activity at constant and current prices are
given in Table 2.16 and Table 2.17.
TabIe2.16
Sector wise Distribution of GDP at Factor cost by Economic Activity- AII India
(At 2004-05 prices) (` in Crore)
SL.
No
Industry of Origin 2008-09 2009-10
(Provi-
sionaI
estimate)
2010-11
(Quick
estimate)
Percentage change
over previous year
2009-10 2010-11
1 $JULFXOWXUHIRUHVWU\VKLQJ 655,689 662,509 709,103 1.0 7.0
2 Mining & quarrying 98,055 104,225 109,421 6.3 5.0
3 Manufacturing 656,302 719,728 774,162 9.7 7.6
4 Electricity, gas & water supply 83,050 88,266 90,944 6.3 3.0
5 Construction 332,329 355,717 384,199 7.0 8.0
6 Trade, hotels & restaurants 692,224 746,178 813,079 7.8 9.0
7 Transport, storage & commu-
nication
392,901 451,035 517,376 14.8 14.7
8 Financing, insurance, real
estate & business services
703,629 769,883 849,995 9.4 10.4
9 Community, social & personal
services
544,497 610,096 637,675 12.0 4.5
10 Total Gross Domestic Product
at factor cost
4,158,676 4,507,637 4,885,954 8.4 8.4
Source: Central Statistical Organization, 2011.
Kerala State Planning Board
27
TabIe2.17
Sectorwise Distribution of GDP at Factor cost by Economic Activity- AII India
(At Current Prices)
(` in Crore)
[Link] Industry of Origin 2008-09
2009-10
(ProvisionaI
estimate)
2010-11
(Quick
estimate)
Percentage
change over
previous year
2009-
10
2010-
11
1 $JULFXOWXUHIRUHVWU\VKLQJ 943,204 1,079,365 1,269,888 14.4 17.7
2 Mining & quarrying 139,828 157,400 191,207 12.6 21.5
3 Manufacturing 818,322 907,032 1,040,345 10.8 14.7
4 Electricity, gas & water sup-
ply
91,070 112,522 124,038 23.6 10.2
5 Construction 451,034 502,190 585,265 11.3 16.5
6 Trade, hotels & restaurants 895,397 1,008,548 1,206,549 12.6 19.6
7 Transport, storage & com-
munication
415,448 476,928 548,982 14.8 15.1
8 Financing, insurance, real
estate & business services
845,369 962,186 1,170,522 13.8 21.7
9 Community, social & per-
sonal services
703,895 885,314 1,020,616 25.8 15.3
10 Total Gross Domestic Prod-
uct at factor cost
5,303,567 6,091,485 7,157,412 14.9 17.5
Source : Central Statistical Organization, 2011
2.32 An analysis of percentage distribution of GDP shows that the contribution from Primary sector
and secondary sector to the GDP is decreasing and that from tertiary sector is increasing (Table 2.18)
TabIe2.18
Gross Domestic Product at Factor cost by Economic Activity- Percentage Distribution
(AII India)
SL.
No
Industry of Origin
At Constant Prices ( 2004-05) At Current Prices
2008-
09
2009-10
(Provi-
sionaI
estimate)
2010-11
(Quick
estimate)
2008-
09
2009-10
(Provi-
sionaI
estimate)
2010-11
(Quick
esti-
mate)
1 Agriculture, forestry &
VKLQJ
15.8 14.7 14.5 17.8 17.7 17.7
2 Mining & quarrying 2.4 2.3 2.2 2.6 2.6 2.7
Sub Total Primary 18.2 17 16.7 20.4 20.3 20.4
3 Manufacturing 15.8 16 15.8 15.4 14.9 14.5
4 Electricity, gas & water
supply
2 2 1.9 1.7 1.8 1.7
5 Construction 8 7.9 7.9 8.5 8.2 8.2
Economic Review 2011
28
SL.
No
Industry of Origin
At Constant Prices ( 2004-05) At Current Prices
2008-
09
2009-10
(Provi-
sionaI
estimate)
2010-11
(Quick
estimate)
2008-
09
2009-10
(Provi-
sionaI
estimate)
2010-11
(Quick
esti-
mate)
Sub Total Secondary 25.8 25.9 25.6 25.6 24.9 24.4
6 Trade, hotels & restau-
rants
16.6 16.6 16.6 16.9 16.6 16.9
7 Transport, storage &
communication
9.4 10 10.6 7.8 7.8 7.7
8 Financing, insurance,
real estate& business
services
16.9 17.1 17.4 15.9 15.8 16.4
9 Community, social &
personal services
13.1 13.5 13.1 13.3 14.5 14.3
Sub Total tertiary 56 57.2 57.7 53.9 54.7 55.3
Total GDP at factor cost 100 100 100 100 100 100
Source : Central Statistical Organization, 2010
State Income
2.33 According to the statistics published by the Department of Economics and Statistics, the quick
estimate of gross state domestic product (GSDP) at factor cost at constant prices (2004-05) was
` 193383.39 crore in 2010-11 as against the provisional estimate of `177209.32 crore during 2009-
10, registering a growth rate of 9.13 percent in 2010-11 compared to 8.95 percent in 2009-10 (Fig 2.1).
At current prices, it was estimated at Rs. 276996.70 crore (quick estimate) in 2010-11 against
the provisional estimate of Rs. 232381.05 crore in 2009-10 (Table 2.19).
Fig.2.1
0.00
2.00
4.00
6.00
8.00
10.00
12.00
10.09
7.90
8.77
7.22
8.95 9.13
P
e
r
c
e
n
t
a
g
e
Year
Growth Rate of GSDP at Constant (2004-05) Prices - KeraIa
Source : Department of Economics and Statistics
Kerala State Planning Board
29
2.34 The quick estimate of net state domestic product at factor cost at constant prices
(2004-05) was Rs.171897.32 crore in 2010-11 compared to the provisional estimate of `157078.22
crore in 2009-10, a growth rate of 9.43% in 2010-11. At current prices the State income was
estimated at ` 246212.72 crore (quick estimate) in 2010-11 compared to the provisional estimate
of ` 206200.31 crore in 2009-10 (Table 2.19).
TabIe2.19
State Domestic Product and per capita Income of KeraIa
SL.
No
Item
Income (` Crore) Growth Rate (Percent)
2008-09
2009-10
(P)
2010-11 (Q)
2009-10
(P)
2010-11
(Q)
1 2 3 4 5 6 7
1 Gross State Domestic
Product
a) At Constant (2004-
05) prices
162659.20 177209.32 193383.39 8.95 9.13
b) At Current prices 202782.79 232381.05 276996.70 14.60 19.20
2 Net State Domestic
Product (State Income)
a) At Constant (2004-
05) prices
144093.92 157078.22 171897.32 9.01 9.43
b) At Current prices 180134.36 206200.31 246212.72 14.47 19.40
3 Per Capita State Income
(Rs)
a) At Constant (2004
-05) Prices
47900 51791 56107 8.12 8.33
b) At Current Prices 59716 67916 80366 13.73 18.33
Source : Department of Economics and Statistics
P: Provisional, Q: Quick Estimate
Per Capita State Income
2.35 As per the quick estimates in 2010-11, the per capita gross state domestic product at
constant (2004-05) prices was Rs..56107 against the provisional estimate of Rs. 51791 in 2009-
10, a growth of 8.33% in 2010-11. At current prices, the per capita GSDP in 2010-11 was
` 80366 registering a growth of 18.33% over the estimate of Rs. 67916 in 2009-10. The graph
(Fig. 2.2) below shows that during the period 2004-05 to 2009-10, the per capita state income is higher
than the per capita national income.
Economic Review 2011
30
Fig. 2.2
6RXUFH&HQWUDO6WDWLVWLFDO2UJDQL]DWLRQDQG'HSDUWPHQWRI(FRQRPLFVDQG6WDWLVWLFV
Sectoral Distribution of Gross State Domestic Product
2.36 The contribution from primary, secondary and tertiary sectors to the GSDP in 2010-11 at
constant prices (2004-05) was 11.06%, 20.13% and 68.80%, respectively. At current prices, the
same was 14.94 %, 21.08% and 63.98%, respectively. While analysing the sectoral distribution
of state income it is seen that the contribution from primary sector has been decreasing and
while that of the tertiary sector has been increasing. The contribution of secondary sector remained
almost stagnant. Details of sectoral distribution of GSDP with percentage during the last three
years are given in Tables 2.20, 2.21 and Appendix 2.10-2.13 Sectoral distribution of GSDP during
DQGDUHVKRZQLQWKHJXUH
Fig. 2.3
SectoraI Distribution of GSDP-KeraIa
Source : Department of Economics and Statistics
Kerala State Planning Board
31
TabIe2.20
SectoraI Distribution of Gross State Domestic Product (GSDP) at Factor Cost 2008-09 to
2010-11 at Current Prices
Rs. In Crore
SI.
No
Industry of Origin
At Current Price
2008-09 2009-10 (P) 2010-11 (Q)
GSDP % GSDP % GSDP %
1 Agriculture & Allied Activi-
ties
24927.44 12.29 25673.86 11.05 30926.73 11.17
2 Forestry & Logging 3514.14 1.73 4027.68 1.73 4694.93 1.69
3 Fishing 2684.13 1.32 3120.96 1.34 3476.70 1.26
Agriculture and Allied 31125.71 15.35 32822.50 14.12 39098.36 14.12
4 Mining and Quariying 1299.37 0.64 1668.81 0.72 2280.45 0.82
727$/2)35,0$5<6(&725 32425.08 15.99 34491.31 14.84 41378.81 14.94
5 Manufacturing 17356.90 8.56 20543.17 8.84 24331.43 8.78
5.1 Registered 8363.19 4.12 10278.47 4.42 12486.95 4.51
5.2 Un-registered 8993.71 4.44 10264.70 4.42 11844.48 4.28
6 Construction 23211.53 11.45 27665.97 11.91 31190.52 11.26
7 Electricity, Gas and Water
supply
2453.80 1.21 26101.22 1.12 2873.32 1.04
7.1 Electricity 2146.54 1.06 2260.43 0.97 2469.72 0.89
7.2 Gas 44.05 0.02 4562.2.49 0.02 47.25 0.02
7.3 Water supply 263.21 0.13 304.07 0.13 356.35 0.13
727$/2)6(&21'$5<6(&-
725
43022.23 21.22 50819.26 21.87 58395.27 21.08
Industry 44321.60 21.86 52488.07 22.59 60675.72 21.90
8 Transport, Storage& Comm. 19593.96 9.66 23061.66 9.92 27030.08 9.76
8.1 Railways 872.96 0.43 1105.84 0.48 1283.27 0.46
8.2 Transport by other means 14656.12 7.23 17062.54 7.34 20008.62 7.22
8.3 Storage 94.56 0.05 112.92 0.05 134.85 0.05
8.4 Communication 3970.32 1.96 4780.36 2.06 5603.34 2.02
9 Trade, Hotel & Restaurants 42685.98 21.05 48836.86 21.02 59380.74 21.44
10 Banking & Insurance 10245.86 5.05 11355.81 4.89 13807.53 4.98
11 Real estate ownership,
Business ,legal
26143.83 12.89 31119.21 13.39 37533.18 13.55
12 Public Administration 8982.36 4.43 10620.04 4.57 12785.82 4.62
13 2WKHU6HUYLFHV 19683.49 9.71 22076.90 9.50 26685.27 9.63
727$/2)7(57,$5<6(&725 127335.48 62.79 147070.48 63.29 177222.62 63.98
727$/*6'3 202782.79 100.00 232381.05 100.00 276996.70 100.00
Economic Review 2011
32
TabIe2.21
SectoraI Distribution of Gross State Domestic Product (GSDP) at Factor Cost 2008-09 to
2010-11 at Constant Prices
Rs. In Crore
SI.
No
Industry of Origin
At Constant Price
2008-09 2009-10 (P) 2010-11 (Q)
GSDP % GSDP % GSDP %
1 Agriculture & Allied Activi-
ties
16533.94 10.16 16236.47 9.16 16110.58 8.33
2 Forestry & Logging 2338.60 1.44 2411.24 1.36 2491.26 1.29
3 Fishing 1784.03 1.10 1886.81 1.06 1884.27 0.97
Agriculture and Allied 20656.57 12.70 20534.52 11.59 20486.11 10.59
4 Mining and Quariying 599.93 0.37 723.89 0.41 909.07 0.47
727$/2)35,0$5<6(&725 21256.50 13.07 21258.41 12.00 21395.18 11.06
5 Manufacturing 13440.72 8.26 14615.95 8.25 16014.96 8.28
5.1 Registered 6001.76 3.69 6527.22 3.68 7142.07 3.69
5.2 Un-registered 7438.96 4.57 8088.73 4.56 8872.89 4.59
6 Construction 18714.52 11.51 20083.23 11.33 20892.05 10.80
7 Electricity, Gas and Water
supply
1973.94 1.21 1992.57 1.12 2029.67 1.05
7.1 Electricity 1716.04 1.05 1718.17 0.97 1733.78 0.90
7.2 Gas 44.05 0.03 45.62 0.03 47.25 0.02
7.3 Water supply 213.85 0.13 228.78 0.13 248.64 0.13
727$/2)6(&21'$5<6(&-
725
34129.18 20.98 36691.75 20.71 38936.68 20.13
Industry 34729.11 21.35 37415.64 21.11 39845.75 20.60
8 Transport, Storage& Comm. 20822.43 12.80 25147.97 14.19 30416.38 15.73
8.1 Railways 756.80 0.47 828.04 0.47 907.22 0.47
8.2 Transport by other means 11518.51 7.08 13266.49 7.49 14858.63 7.68
8.3 Storage 74.01 0.05 81.66 0.05 87.45 0.05
8.4 Communication 8473.11 5.21 10971.78 6.19 14563.08 7.53
9 Trade, Hotel & Restaurants 33380.85 20.52 35127.72 19.82 36644.36 18.95
10 Banking & Insurance 10900.91 6.70 12142.33 6.85 13957.10 7.22
11 Real estate ownership,
Business ,legal
19667.31 12.09 21526.17 12.15 23578.96 12.19
12 Public Administration 7106.28 4.37 7807.54 4.41 8426.87 4.36
13 2WKHU6HUYLFHV 15395.74 9.47 17507.43 9.88 20027.86 10.36
727$/2)7(57,$5<6(&725 107273.52 65.95 119259.16 67.30 133051.53 68.80
727$/*6'3 162659.20 100.00 177209.32 100.00 193383.39 100.00
Kerala State Planning Board
33
2.37 The analysis of annual sectoral growth in GSDP showed that tertiary sector recorded the
highest rate of growth of 11.57% in 2010-11 at constant (2004-05) prices followed by secondary sec-
tor (6.12 %) and primary sector (0.64%). At current prices, the tertiary sector recorded a growth rate
of 20.50 %, primary sector 19.97% and secondary sector 14.91% (Table 2.22).
TabIe2.22
Sector wise AnnuaI Growth Rate of GSDP- KeraIa
SI.
No
Industry Origin
Percentage change over Previous Year
At Constant (2004-05) Prices At Current Prices
2008-09
2009-
10 (P)
2010-11
(Q)
2008-09
2009-10
(P)
2010-11
(Q)
1 Agriculture 2.08 -1.80 -0.78 12.20 2.99 20.46
2 Forestry & logging 3.34 3.11 3.32 34.73 14.61 16.57
3 Fishing -0.64 5.76 -0.13 1.89 16.27 11.40
AgricuIture and AIIied 1.98 -0.59 -0.24 13.35 5.45 19.12
4 Mining and Quariying 9.67 20.66 25.58 -5.07 28.43 36.65
A. Sub-TotaI of Primary 2.18 0.01 0.64 12.48 6.37 19.97
5 Manufacturing 2.10 8.74 9.57 15.08 18.36 18.44
5.1 Manu-Registered 8.21 8.76 9.42 29.91 22.90 21.49
5.2 Manu-Unregistered -2.35 8.73 9.69 4.04 14.13 15.39
6 Construction 2.28 7.31 4.03 6.77 19.19 12.74
7 Electricity Gas & Water
Supply
-23.11 0.94 1.86 -14.12 6.37 10.08
7.1 Electricity -26.00 0.12 0.91 -17.03 5.31 9.26
7.2. Gas 4.43 3.57 3.57 4.43 3.57 3.57
7.3 Water Supply 3.87 6.98 8.68 15.41 15.52 17.19
B. Sub-TotaI of Secondary 0.30 7.51 6.12 8.42 18.12 14.91
Industry 0.44 7.74 6.49 7.97 18.43 15.60
8 Transport, storage and
communication
16.70 20.77 20.95 19.39 17.70 17.21
8.1 Railways 38.45 9.41 9.56 39.81 26.68 16.04
8.2 7UDQVSRUWE\2WKHU0HDQV 11.18 15.18 12.00 21.34 16.42 17.27
8.3 Storage 2.54 10.34 7.09 17.38 19.42 19.42
8.4 Communication 23.44 29.49 32.73 9.42 20.40 17.22
9 Trade, hotels & restaurants 4.65 5.23 4.32 19.90 14.41 21.59
10 Banking and Insurance 11.96 11.39 14.95 17.53 10.83 21.59
11 Real estate, ownership of
dwellings and business
services
9.20 9.45 9.54 21.51 19.03 20.61
12 Public Administration 2.91 9.87 7.93 16.01 18.23 20.39
13 2WKHU6HUYLFHV 3.53 13.72 14.40 18.26 12.16 20.87
C. Sub-TotaI of Tertiary 8.07 11.17 11.57 19.41 15.50 20.50
14 State Domestic Product 5.56 8.95 9.13 15.78 14.60 19.20
P: Provisional, Q: Quick Estimate
Source: - Department of Economics & Statistics
Economic Review 2011
34
District-wise Gross State Domestic Product
2.38 District wise distribution of Gross State Domestic Product at factor cost at current prices
shows that Ernakulam District continues to have the highest income of ` 40478.48 crore in
2010-11 as against ` 34131.72 crore in 2009-10 registering a growth rate of 18.59 % . At constant
(2004-05) prices it comes to Rs. 28711.07 crore during 2010-11 compared to `26247.74 crore dur-
ing 2009-10. Thiruvananthapuram District stands second with an income of ` 30078.77 crore in
2010-11 at current prices followed by Thrissur (` FURUH.R]KLNRGH`23923.54crore),
Malappuram (` 22416.34 crore) and Palakkad (` 20910.13 crore) and the lowest income of
`5093.36 crore was recorded in Wayanad District at current prices during 2010-11 preceded by
Kasargod (` 8540.39 crore), Idukki (` 9757.31 crore), and Pathanamthitta (` 10693.88 crore). The
details are given in Table 2.23 and Appendix 2.14 to 2.19.
TabIe2.23
District-wise Distribution of Gross State Domestic Product
(` Crore)
SI.
No
District
Gross State Domestic Product at Factor Cost Growth Rate (%)
At Current Prices At Constant Prices
At Cur-
r e n t
Prices
At Con-
s t a n t
Prices
2009-10 2010-11 2009-10 2010-11
2 0 1 0 -
11
2010-11
(P) (Q) (P) (Q)
1 Thiruvananthapuram 25246.81 30078.77 19467.61 21373.44 19.14 9.79
2 Kollam 18215.70 21758.56 13608.07 14786.75 19.45 8.66
3 Pathanamthitta 8948.98 10693.88 7025.06 7733.38 19.50 10.08
4 $ODSSX]KD 15226.42 18123.41 11637.49 12702.89 19.03 9.15
5 Kottayam 15952.79 19053.62 12301.06 13440.40 19.44 9.26
6 Idukki 8155.85 9757.31 6004.33 6464.48 19.64 7.66
7 Eranakulam 34131.72 40478.48 26247.74 28711.07 18.59 9.38
8 Thrissur 22236.31 26465.96 17253.02 18914.88 19.02 9.63
9 Palakkad 17496.37 20910.13 13163.39 14347.31 19.51 8.99
10 Malappuram 18768.08 22416.34 13997.07 15188.22 19.44 8.51
11 .R]KLNRGH 20095.27 23923.54 15295.87 16644.82 19.05 8.82
12 Wayanad 4250.19 5093.36 3178.70 3448.18 19.84 8.48
13 Kannur 16510.01 19702.95 12588.70 13708.38 19.34 8.89
14 Kasaragod 7146.55 8540.39 5441.21 5919.19 19.50 8.78
GSDP 232381.05 276996.70 177209.32 193383.39 19.20 9.13
P - Provisional, Q - Quick Estimate
Source: Department of Economics & Statistics
District-wise Per Capita Income
2.39 The analysis of district wise per capita income shows that Ernakulam district stands
UVWZLWKWKHSHUFDSLWDLQFRPHRI` 85070 at constant (2004-05) prices in 2010-11 as against
` 78351 in 2009-10 Kottayam District has the second largest per capita income of ` 64648 in
2010-11 at constant prices followed by Thiruvananthapuram (` 60945), Pathanamthitta (` 60370),
Thrissur (`DQG$ODSSX]KD` 57298). The lowest per capita income was recorded in
Malappuram District (` 36740) in 2010-11 at constant prices preceded by Wayanad
Kerala State Planning Board
35
(` 39051) , Kasargod (` DQG.R]KLNRGH` 53298).
2.40 The highest rate of growth of per capita income of 9.31% was recorded in Pathana-
mthitta District in 2010-11 followed by Thiruvananthapuram (8.98 %), Thrissur (8.84%), Ernakulam
DQG$OODSSX]KD7KHORZHVWJURZWKUDWHZDVUHFRUGHGLQ,GXNNL'LVWULFW
preceded by Wayanad District (7.74%) , Malappuram (7.75%), and Kasargod (7.97 %). The dis-
trict wise per capita income with growth rate is given in Table 2.24.
TabIe2.24
District-wise Per Capita Income at constant (2004-05) Prices
SI .
No.
District
2 0 0 9 - 1 0
(P) `
Rank
2 0 1 0 - 1 1
(Q) `
Rank
Gr o wt h
Rate (%)
2010-11
1 Thiruvananthapuram 55925 3 60945 3 8.98
2 Kollam 49683 8 53595 8 7.87
3 Pathanamthitta 55228 4 60370 4 9.31
4 $ODSSX]KD 52874 6 57298 6 8.37
5 Kottayam 59598 2 64648 2 8.47
6 Idukki 51144 7 54645 7 6.84
7 Eranakulam 78351 1 85070 1 8.57
8 Thrissur 54323 5 59127 5 8.84
9 Palakkad 46695 11 50519 11 8.19
10 Malappuram 34098 14 36740 14 7.75
11 .R]KLNRGH 49342 10 53298 10 8.02
12 Wayanad 36245 13 39051 13 7.74
13 Kannur 49562 9 53569 9 8.09
14 Kasaragod 41284 12 44572 12 7.97
STATE 51791 56107 8.33
P: Provisional Q:Quick
Source: Department of Economics & Statistics
District-wise Sectoral Distribution of Gross State Domestic Product
2.41 District wise and sectorwise analysis of GSDP shows that the highest contribution from
primary sector income of ` 2472.84 crore at constant (2004-05) prices was in Ernakulam district
during 2010-11 followed by Kollam (` 2450.16 crore) , Kottayam (` 1848.4 crore), Idukki (` 1624.75
crore). The district wise details of sectoral income and growth rate are given in Table 2.25.
District-wise sectoral distribution of Gross State Domestic Product from 2008-09 to 2010-11 at current
and constant (2004-2005) prices are given in Appendices 2.14-2.19.
Economic Review 2011
36
TabIe2.25
District wise and Sector-wise Distribution of Gross State Domestic product during 2010-11 at
constant (2004-05) Prices (Quick Estimate)
(` Crore)
SI .
No.
District
Primary Secondary Tertiary
GDDP
A n n u a I
G r o w t h
Rate (%)
GDDP
A n n u a I
Gr o wt h
Rate (%)
GDDP
A n n u a I
Gr o wt h
Rate (%)
1 Thiruvananthapuram 1508 2.02 4617.17 6.27 15248.27 11.75
2 Kollam 2450.16 1.25 2254.81 5.53 10081.78 11.38
3 Pathanamthitta 1053.38 0.28 924.05 4.85 5755.95 13.01
4 $ODSSX]KD 1212.11 0.32 2373.23 6.01 9117.55 11.32
5 Kottayam 1848.4 0.18 2074.92 5.63 9517.08 12.08
6 Idukki 1624.75 -0.24 930.3 5.69 3909.43 11.84
7 Eranakulam 2472.84 0.27 9338.74 6.97 16899.49 12.28
8 Thrissur 1333.1 0.92 3922.76 5.99 13659.02 11.67
9 Palakkad 1405.19 1.17 3317.48 7.26 9624.64 10.87
10 Malappuram 2142.83 0.53 2409.57 5.54 10635.82 10.99
11 .R]KLNRGH 1475.75 0.93 3256.36 5.22 11912.71 10.93
12 Wayanad 635.15 0.01 392.3 5.80 2420.73 11.41
13 Kannur 1358.86 0.54 2415.85 5.36 9933.67 11.06
14 Kasaragod 874.66 0.37 709.14 4.36 4335.39 11.44
STATE 21395.18 0.64 38936.68 6.12 133051.5 11.57
Source: Department of Economics and Statistics
Population
2.42 The population of India was provisionally estimated by the Census 2011, at 121.01 crore
comprising 62.37 crore males and 58.65 crore females. According to the provisional reports released
on March 31, 2011, the decadal growth was 17.64%. Adult literacy rate increased to 74.04% with a
decadal growth of 9.21%. The population of different states/Union Territories is given in Appendix 2.20.
Decadal Growth of Population
2.43 An analysis of the decadal growth rate of all- India population shows that it increased from
1921 to 1981 and since then declined gradually. As for Kerala, the decadal growth rate had been
higher from 1941 to 1971 and since then it had been sliding down. Details of decadal growth rate of
population at All India and Kerala from 1901 to 2011 are given in Table 2.26. Fig 2.4 and 2.5 shows
decadal growth rates of urban and rural population.
Kerala State Planning Board
37
TabIe2.26
PopuIation and its Growth from 1901 to 2011
Census
Year
AII India KeraIa
PopuIation (Iakhs) DecadaI
Growth
Rate(%)
PopuIation (Iakhs) DecadaI
Gr owt h
Rate(%)
RuraI Urban TotaI RuraI Urban TotaI
1 2 3 4 5 6 7 8 9
1901 2125.4 258.5 2383.9 - 59.4 4.5 63.9 -
1911 2261.5 259.4 2520.9 5.75 66.2 5.3 71.5 11.89
1921 2232.3 280.9 2513.2 -0.31 71.2 6.8 78.0 9.09
1931 2455.2 334.6 2729.8 8.62 85.9 9.2 95.1 21.92
1941 2745.1 441.5 3186.6 16.73 98.3 12.0 110.3 15.98
1951 2986.5 624.4 3610.9 13.32 117.2 18.3 135.5 22.85
1961 3602.9 789.4 4392.3 21.64 143.5 25.5 169.0 24.72
1971 4390.5 1091.1 5481.6 24.80 178.8 34.7 213.5 26.33
1981 5238.7 1594.6 6833.3 24.66 206.8 47.7 254.5 19.20
1991 6286.9 2176.1 8463.0 23.85 214.1 76.8 290.9 14.30
2001 7416.6 2853.6 10270.2 21.35 235.7 82.7 318.4 9.45
2011 8330.9 3771 12101.9 17.64 174.6 159.3 333.9 4.86
Source: Census of India
Fig: 2.4
Economic Review 2011
38
Fig: 2.5 g
2.44 The projected population of India by 2026 is 139.8 crore and for Kerala, 3.7 crore. Details
of the projected total population by sex as on 1st March-2001-2026 India and Kerala State is given in
Table 2.27.
TabIe2.27
Projected TotaI PopuIation by sex as on 1st March-2001-2026 India and KeraIa State
PopuIation ( in 000')
YEAR
INDIA KERALA
Persons MaIe FemaIe Persons MaIe FemaIe
2001 1,028,610 532,157 496,454 31,841 15,469 16,373
2002 1,045,547 540,936 504,611 32,132 15,615 16,517
2003 1,062,388 549,671 512,716 32,421 15,761 16,660
2004 1,079,117 558,354 520,763 32,707 15,907 16,801
2005 1,095,722 566,976 528,746 32,989 16,050 16,939
2006 1,112,186 575,529 536,657 33,265 16,191 17,074
2007 1,128,521 584,019 544,501 33,535 16,329 17,206
2008 1,144,734 592,451 552,283 33,802 16,466 17,336
2009 1,160,813 600,816 889,997 34,063 16,601 17,462
2010 1,176,742 609,107 567,634 34,317 16,732 17,585
2011 1,192,506 617,316 575,191 34,563 16,859 17,704
2012 1,208,116 625,446 582,670 34,802 16,983 17,819
2013 1,223,581 633,505 590,076 35,034 17,104 17,930
2014 1,238,887 641,484 597,403 35,258 17,221 18,037
2015 1,254,019 649,374 604,644 35,473 17,333 18,139
2016 1,268,961 657,168 611,793 35,677 17,440 18,236
2017 1,283,600 664,802 618,799 35,873 17,544 18,329
2018 1,298,041 672,334 625,707 36,062 17,644 18,417
Kerala State Planning Board
39
YEAR
INDIA KERALA
Persons MaIe FemaIe Persons MaIe FemaIe
2019 1,312,240 679,741 632,500 36,241 17,740 18,501
2020 1,326,155 686,998 639,157 36,410 17,831 18,579
2021 1,339,741 694,080 645,660 36,569 17,917 18,652
2022 1,352,695 700,811 651,884 36,722 18,001 18,721
2023 1,365,302 707,355 657,947 36,867 18,080 18,786
2024 1,377,442 713,643 663,799 37,004 18,156 18,847
2025 1,388,994 719,606 669,388 37,132 18,229 18,904
2026 1,399,838 725,176 674,663 37,254 18,297 18,956
Source : Census of India
Kerala population
2.45 Census 2011 had put Keralas population at 3,33,87,677, consisting of 1,60,21,290 males and
1,73,66,387 females. The population density is about 859 people per square kilometres, three times
the national average. Kerala is one of the densest states in the country and it recorded a decadal
population growth of + 9.43%. Kerala, with a sex-ratio (females per 1000 males) of 1084, is the only
VWDWH ZLWK D SRVLWLYH JXUH7KHVH SURYLVLRQDO SRSXODWLRQ JXUHV ZHUH DUULYHG DW E\ UDSLG WDEXODWLRQ
from enumerators abstracts and hence have limitations. In fact, there could be variations when the
QDOUHVXOWLVSXEOLVKHG
2.46 The total area of the State of Kerala is 38863 [Link]. which is only 1.275 of the total area of
the country but accounts for 2.76% of the total population. Among the districts, Palakkad is the largest
ZLWKVTNPFORVHO\IROORZHGE\,GXNNLZLWKVTNP7KHVPDOOHVWGLVWULFWLV$ODSSX]KDZLWK
only 1414 [Link]. of area.
2.47 Net addition to population has been continuously falling in Kerala since 1980. The trend has
been visible in all the districts of the State. Among the districts, Malappuram had the highest growth
UDWH LQ ZLWK ,W ZDV LQ .DVDUDJRG .R]KLNRGH 0DODSSXUDP
3DODNNDGDQG(UQDNXODPDUHWKHYHGLVWULFWVKDYLQJDJURZWKUDWHKLJKHUWKDQWKHDYHUDJHJURZWKUDWH
of the State in 2001-2011. The details of district wise population is given in Table 2.28 and Appendix
2.21.
TabIe2.28
Ranking of Districts by PopuIation Size, 2001 and 2011
Rank
in
2011
District PopuIation
2011
Per
cent to
totaI
PopuIation
2001
Per
cent to
totaI
Rank in
2001
1 Malappuram 41,10,956 12.31 36,25,471 11.39 1
2 Thiruvananthapuram 33,07,284 9.91 32,34,356 10.16 2
3 Ernakulam 32,79,860 9.82 31,05,798 9.75 3
4 Thrissur 31,10,327 9.32 29,74,232 9.34 4
5 .R]KLNRGH 30,89,543 9.25 28,79,131 9.04 5
6 Palakkad 28,10,892 8.42 26,17,482 8.22 6
7 Kollam 26,29,703 7.88 25,85,208 8.12 7
8 Kannur 25,25,637 7.56 24,08,956 7.57 8
9 $ODSSX]KD 21,21,943 6.36 21,09,160 6.62 9
Economic Review 2011
40
Rank
in
2011
District PopuIation
2011
Per
cent to
totaI
PopuIation
2001
Per
cent to
totaI
Rank in
2001
10 Kottayam 19,79,384 5.93 19,53,646 6.14 10
11 Kasaragod 13,02,600 3.90 12,04,078 3.78 12
12 Pathanamthitta 11,95,537 3.58 12,34,016 3.88 11
13 Idukki 11,07,453 3.32 11,29,221 3.55 13
14 Wayanad 8,16,558 2.45 7,80,619 2.45 14
Source: Finance department, Govt. of Kerala
2.48 Child population in the age-group of 0-10, which stood at 37.93 lakh in 2001, declined to 33.22
lakh in 2011. A net decline of about 4.71 lakh at the rate of about 50,000 per year, on an average, is
thus, noticed. Interestingly, it had been negative growth in all districts except Malappuram. Even in
Malappuram district, the rate of growth in child population had been is a very negligible. The district
that had the lowest growth rate, according to Census 2011, was Pathanamthitta (-27.97%). Inciden-
tally, the district had the lowest decadal growth rate in population
Sex Ratio
2.49 Kerala State has a very unique position with regard to sex ratio by dint of the fact that in all the
censuses, the number of females outnumbered the number of males in the State, contrary to the pat-
tern shown at the all-India level. The trend had a legacy of atleast 100 years. In the Census 2011 also,
sex ratio in the State registered an increase of 26 points and thus achieved a ratio of 1084 females
per 1000 males. Details of sex ratio for India and Kerala from 1951 to 2001 is given in Table 2.29.
TabIe2.29
Sex Ratio - India & KeraIa(1951 to 2011)
Year
Sex Ratio
India KeraIa
1951 946 1028
1961 941 1022
1971 930 1016
1981 934 1032
1991 927 1036
2001 933 1058
2011 940 1084
Source: Census of India 2011.
2.50 In 2001 Census, Pathanamthitta district topped with a sex ratio of 1094, followed by Thrissur
with 1092 and Kannur with 1090. This order underwent a change in 2011 when Kannur (1133) replaced
Pathanamthitta (1129). Idukki continued to enjoy the lowest rank in 2011 Census also. Details are
given in Table 2.30.
Kerala State Planning Board
41
TabIe2.30
Ranking of Districts by Sex-Ratio, 2001 and 2011
Rank
in
2011
Districts
Sex- ratio (Number of FemaIes
per 1000 MaIes)
Rank in 2001
2011 2001
1 Kannur 1133 1090 3
2 Pathanamthitta 1129 1094 1
3 Kollam 1113 1069 5
4 Thrissur 1109 1092 2
5 $ODSSX]KD 1100 1079 4
6 .R]KLNRGH 1097 1057 8
7 Malappuram 1096 1066 6
8 Thiruvananthapuram 1088 1060 7
9 Kasaragod 1079 1047 9
10 Palakkad 1067 1066 6
11 Kottayam 1040 1025 10
12 Wayanad 1035 995 12
13 Ernakulam 1028 1019 11
14 Idukki 1006 993 13
Child Sex ratio
2.51 Data on child sex ratio is very prominent since it is an indicator of future trends. A comparison
of child sex ratio of the State with 2001 Census indicates that there was very negligible decrease in
child sex ratio in 2001-2011, i.e., from 960 in 2001 to 959 in 2011. In all the districts, child sex ratio
KDGEHHQQHJDWLYHDQGLQWKHYHGLVWULFWVRI7KULVVXU(UQDNXODP,[Link]\DP
DQG$ODSSX]KDLWZDVEHORZ6WDWHDYHUDJH7KLUXYDQDQWKDSXUDPUHSRUWHGWKHKLJK-
est sex ratio of 967 female children for 1000 male children in the age-group 0-6. In 2001 Census, the
FRUUHVSRQGLQJSRVLWLRQZDVRFFXSLHGE\,GXNNLGLVWULFW$ODSSX]KDGLVWULFWLVUHSRUWHGWRKDYHWKH
lowest child sex ratio (947) in 2011 Census whereas in 2001 Census, the lowest position was claimed
by Ernakulam district (954).
Density of Population
2.52 As mentioned earlier, Kerala has a high density of population which, according to Census
2011, is 859 persons per [Link], against 819 in Census 2001. The State had only 134 persons per
VTNPLQ7KHSUHVHQWGHQVLW\JXUHVKRZVDVL[IROGLQFUHDVHLQWKHODVW\HDUV'HWDLOVRQ
density of population, district-wise is given in Table 2.31.
TabIe2.31
Ranking of Districts by PopuIation Density, 2001 and 2011
Rank in
2011
District
PopuIation Density
Rank in
2001
2011 2001
1 Thiruvananthapuram 1509 1476 2
2 $ODSSX]KD 1501 1492 1
3 .R]KLNRGH 1318 1228 3
4 Malappuram 1158 1021 5
Economic Review 2011
42
Rank in
2011
District
PopuIation Density
Rank in
2001
2011 2001
5 Ernakulam 1069 1012 6
6 Kollam 1056 1038 4
7 Thrissur 1026 981 7
8 Kottayam 896 885 8
9 Kannur 852 812 9
10 Kasaragod 654 604 10
11 Palakkad 627 584 11
12 Pathanamthitta 453 468 12
13 Wayanad 383 366 13
14 Idukki 254 259 14
Source : Finance Department, Govt. of Kerala
Literacy
2.53 Kerala has been the most literate state in the country (See Table 2.32 and 2.33). An analysis
of the literacy data brings to light the fact that after a gap of 60 years, the literacy rate of the State has
QHDUO\GRXEOHGIURPLQWRLQ&HQVXV3DWKDQDPWKLWWDGLVWULFWUDQNHGUVW
(96.93%) and Palakkad (88.49%) the lowest.
TabIe2.32
Literacy Rate 1951-2011
Year Persons MaIes FemaIes
1951 47.18 58.35 36.43
1961 55.08 64.89 45.56
1971 69.75 77.13 62.53
1981 78.85 84.56 73.36
1991 89.81 93.62 86.17
2001 90.86 94.24 87.72
2011 93.91 96.02 91.98
Note: Literacy rates for 1951, 1961 and 1971 related to population aged fve years and
above. The rates for the years 1981 to 2011 related to the population aged seven years and above.
7KHSUROHRIOLWHUDF\LQWKH6WDWHWKURZVXSLQWHUHVWLQJWUHQGV2IFRXUVHPDOHOLWHUDF\KDV
been quite high, it being as high as 97.90% in Census 2011. But, unlike in many other states, literacy
among women has also been quite high, as much as 91.98%, as per Census 2011. Quite importantly,
LWUHHFWVDKHDOWK\VRFLDOVWDWXVEHLQJHQMR\HGE\ZRPHQLQWKH6WDWH7KDWDSDUWLWLVVHHQDVDSUH-
cursor to other demographic indicators.
Kerala State Planning Board
43
TabIe-2.33
Ranking of Districts by Literacy Rate and Sex:2011
SI.
No
PopuIations MaIe FemaIe
District
Literacy
Rate
District
Literacy
Rate
District
Lit-
eracy
Rate
1 Pathanamthitta 96.93 $ODSSX]KD 97.90 Pathanamthitta 96.26
2 Kottayam 96.40 Pathanamthitta 97.70 Kottayam 95.67
3 $ODSSX]KD 96.26 .R]KLNRGH 97.57 $ODSSX]KD 94.80
4 Ernakulam 95.68 Kannur 97.54 Ernakulam 94.27
5 Kannur 95.41 Kottayam 97.17 Thrissur 93.85
6 Thrissur 95.32 Ernakulam 97.14 Kannur 93.57
7 .R]KLNRGH 95.24 Thrissur 96.98 .R]KLNRGH 93.16
8 Kollam 93.77 Kollam 95.83 Kollam 91.95
9 Malappuram 93.55 Malappuram 95.78 Malappuram 91.55
10 Thiruvananthapuram 92.66 Idukki 94.84 Thiruvananthapuram 90.89
11 Idukki 92.20 Thiruvananthapuram 94.60 Idukki 89.59
12 Kasaragod 89.85 Kasaragod 93.93 Kasaragod 86.13
13 Wayanad 89.32 Wayanad 92.84 Wayanad 85.94
14 Palakkad 88.49 Palakkad 92.27 Palakkad 84.99
Source : Finance Department, Govt. of Kerala
2.55 The continuous geographical belt of Pathanamthitta (96.26%), Kottayam (95.67%) and Alap-
SX]KD GLVWULFWV WRS LQ IHPDOH OLWHUDF\ 7KH GLVWULFWV ZKLFK DUH KDYLQJ ORZHU IHPDOH OLWHUDF\
rate are Kasaragod (86.13%), Wayanad (85.94%) and Palakkad (84.99%). In 10 districts, the female
literacy rate is above 90%. The district of Thiruvananthapuram is having literacy rate lower than the
state average in the case of total literacy, male literacy and female literacy.
Urbanization in Kerala
7KH8QLRQ*RYHUQPHQWKDVUHFRJQL]HGXUEDQDUHDVDVJHQHUDWRUVRIHFRQRPLFPRPHQWXP
But the economic potential of urban areas may depend on a number of factors like geographical lo-
cation, availability of economic infrastructure regional linkages and propensities for accepting further
investments and creating spread effects.
[Link]$VSHUWKH
census, 47.72% of the populations live in urban areas. This is higher than the national average of
+RZHYHU XQOLNH WKH RWKHU SDUWV RI WKH FRXQWU\ XUEDQL]DWLRQ LQ .HUDOD LV QRW OLPLWHG WR WKH
designated cities and towns. Barring a few panchayats in the hilly tracts and a few isolated areas here
and there, the entire State depicts the picture of an urban rural continuum. The Kerala society by and
ODUJHFDQEHWHUPHGDVXUEDQL]HG
2.58 In 1981, there were 106 towns with a population of 4,771,275, which worked out to 18.74% of
the total population. By 1991, there were 197 towns with a population of 76,80,294 which worked out
to 26.44% of the total population). Census 2001 recorded an urban population of 82,67,135 out of
DWRWDOSRSXODWLRQRIVSUHDGRYHUWRZQV7KHLQFUHDVLQJWUHQGLQXUEDQL]DWLRQZDV
however reversed in 1991-2001. This evidently was short lived as Census 2011showed an increase in
urban population from 82,67,135 to 15932171.
Economic Review 2011
Prices
C
H
A
P
T
E
R
46
Kerala State Planning Board
47
Consumer Price Index (CPI)
Consumer Price Indices (CPI) measure changes over time in general level of prices of goods and
services that households acquire for the purpose of consumption. CPI numbers are widely used as a
macroeconomic indicator of infation, as a tool by governments and central banks for infation target-
ing, monitoring price stability, and as defators in the national accounts. It is also used for indexing
dearness allowance to employees for increase in prices. At present CPIs covering different segments
of population ie; Industrial Workers (IW), Urban Non-Manual Employees (UNME), Agricultural and
Rural Labourers (AL/RL) are released at national level.
3.2 During 2011 (upto August) the Consumer Price Index of agricultural and industrial workers in
Kerala went up by 19 points (base 1998-99 =100), compared to the corresponding period of 2010 ie;
the index rose from 175 points in August 2010 to 194 points in August 2011 (Table 3.1). The increase
in 2010 was 16 points compared to 2009 which shows that infation in terms of Consumer Price Index
was higher in the State during 2011 compared to the previous year. The steady hike in the annual
average consumer price index of Agricultural and Industrial workers in selected centres of Kerala from
2007 to 2011 is shown in (Fig. 3.1).
Table - 3.1
Annual Average Consumer Price Index of Agricultural and Industrial workers of selected
centres in Kerala - 2007 to 2011.
SL
No
Centres Year % variaton over previous year
2007 2008 2009 2010* 2010 2011* 2007 2008 2009 2010* 2011*
1 2 3 4 5 6 7 8 9 10 11 12 13
1 Thiruvananthapuram 143 159 168 180 183 202 3.6 11.2 8.92 8.4 10.4
2 Kollam 143 158 169 178 182 201 3.6 10.5 7.69 6.0 10.4
3 Punalur 135 152 165 179 183 202 3.8 12.6 10.90 9.2 10.4
4 Pathanamthitta 142 159 170 183 188 206 6.8 12.0 10.58 8.3 9.6
5 Alappuzha 137 151 164 175 178 197 3.8 10.2 8.53 8.0 10.7
6 Kottayam 136 151 163 174 178 198 3.8 11.0 9.20 8.1 11.2
7 Mundakkayam 133 150 164 178 183 201 4.7 12.8 11.58 9.9 9.3
8 Munnar 129 144 155 168 172 189 3.2 11.6 10.96 10.5 9.9
9 Ernakulam 137 150 161 172 175 191 3 9.5 8.69 7.5 9.1
Prices
Economic Review 2011
48
SL
No
Centres Year % variaton over previous year
2007 2008 2009 2010* 2010 2011* 2007 2008 2009 2010* 2011*
10 Chalakkudy 135 152 165 175 178 193 4.7 12.6 7.87 7.4 8.4
11 Thrissur 137 148 156 168 170 183 4.6 8 8.97 9.1 7.0
12 Palakkad 139 155 166 179 182 199 5.3 11.5 9.63 9.1 9.3
13 Malappuram 137 153 163 173 176 190 5.4 11.7 7.97 7.5 8.0
14 Kozhikode 133 148 160 172 175 189 3.1 11.3 9.37 8.9 8.0
15 Meppady 132 148 157 169 172 183 3.1 12.1 9.55 8.3 6.4
16 Kannur 133 146 157 171 174 191 2.3 9.8 10.82 10.3 9.8
17 Kasaragod 136 148 157 172 175 191 2.3 8.8 11.46 11.0 9.1
State Average 136 151 162 175 178 194 3.8 11.0 9.57 8.7 9.7
Source: Directorate of Economics and Statistics
*Average of monthly indices up to Aug 2011
Fig. 3.1
Consumer Price Index of Agricultural and Industrial Workers in Kerala (Base 1998-99=100)
3.3 While analyzing the indices of seventeen Centres during 2011 (upto August), Pathanamthitta
recorded the highest index of 206 followed by Thiruvananthapuram and Punalur having the same
index (202). Meppadi and Thrissur are the two places showing the lowest price index of 183, preceded
by Munnar and Kozhikode (189). While the indices of 9 Centres fall below the state average of 194,
the indices for the rest of the 8 Centres stood above the State average. The variation of indices of
2011 over the previous year for various Centres ranged from 6 percent to 11 percent. The percentage
variation during 2011 (upto August) over previous year was highest in Kottayam (11.2%) and lowest in
Meppadi (6.4%).
Kerala State Planning Board
49
3.4 The month wise movements of Consumer Price Index are given in Appendix 3.1. The
movement of indices during 2011 is within the range of 180 to 210. The lowest Consumer Price Index
of 180 was recorded at Thrissur during March and reached at 184 in August 2011. Pathanamthitta
recorded the highest index of 210 during August 2011. The lowest index during August 2011 was
recorded at Thrissur (184).
Retail Prices
3.5 The average Retail Prices of essential commodities during December from 2008 to 2011 (upto
October) and its percentage variation over the previous years are given in Table 3.2. While analyzing
the prices of 18 essential commodities in 2011 (upto October), it was observed that among cereals,
rice recorded an increase of 7.98 percent over the corresponding period of previous year. Dhall and
greengram, registered a decrease of 5.80 percent and 6.01 percent respectively. The retail prices of
Blackgram and Redgram decreased by 5.10% and 4.80% respectively. Under other food items the
price of milk hiked by 12.55 percent and egg by 12.72 percent. Oil and oil seeds experienced a heavy
rise during October 2011 over the corresponding period of the previous year ie. Coconut oil by 67.93
percent, coconut by 72.68 percent, refned oil by 28.76 percent and ground nut oil by 22.42 percent.
Among spices and condiments the price of corriander increased by 33.62% and Chillies by 54.54%.
The price of Onion (small) increased by 48.57 percent. Under Tubers, price of Potato increased to
11.8 percent during October 2011 compared to the corresponding period of 2010.
Table - 3.2
Average Retail Prices of Essential Commodities in Kerala 2007 to 2011.
SL.
No
Commodites Unit % variaton over previ-
ous year
2008 2009 2010* 2011* 2010* 2011*
1 2 3 4 5 6 7 8 9
A Cereals
1 Rice (Red) OM Matta Kg 19.76 22.89 24.56 26.52 31.5 7.98
2 Greengram Kg 45.80 77.45 76.39 71.80 -0.5 -6.01
3 Blackgram Kg 49.75 83.23 79.31 75.27 18.3 -5.10
4 Redgram Kg 33.14 52.46 46.67 44.43 3.9 -8.0
5 Dhall (Tur) Kg 51.86 89.46 76.94 72.48 -18.7 -.80
B Other Food Items
6 Milk (Cows)) Lr 20.00 20.00 21.20 23.86 15.0 12.55
7 Egg (Hen's Nadan) Doz-
en
39.81 45.27 46.40 52.30 12.8 12.72
8 Sugar (OM) Kg 20.59 34.15 32.39 30.36 -7.7 -6.25
C Oil and Oil seeds
9 Coconut Oil Lr. 62.64 52.95 59.74 100.32 59.6 67.93
10 Groundnut Oil Lr. 90.02 78.64 78.08 95.59 6.1 22.42
11 Refned Oil Lr. 80.70 64.18 65.32 84.11 14.6 28.76
12 Coconut (without Husk) 10
Nos
69.93 60.75 64.17 110.80 42.3 72.68
D Spices & Condiments
13 Coriander Kg 99.52 64.27 52.61 70.30 -23.2 33.62
Economic Review 2011
50
SL.
No
Commodites Unit % variaton over previ-
ous year
2008 2009 2010* 2011* 2010* 2011*
14 Chillies (dry) Kg 76.39 80.00 70.60 109.10 -10.1 54.54
15 Onion (small) Kg 27.32 36.89 22.34 33.20 5.7 48.57
E Tubers
16 Tapioca Kg 8.70 8.96 11.38 14.78 5.9 29.89
17 Potato Kg 14.55 24.89 15.90 17.79 -31.6 11.88
F Fruits & Vegetables
18 Banana Kg 15.41 23.36 24.80 25.72 3.8 3.70
Source: Directorate of Economics & Statistics
*Upto October 2011
3.6 The month-wise average retail prices of essential commodities during 2011 is given in Ap-
pendix 3.2. The prices of almost all commodities except pulses, sugar in particular, the price of oil and
oilseeds, spices and condiments increased considerably.
Consumption Expenditure
3.7 The expenditure incurred by a household on domestic consumption during the reference period
is the households consumer expenditure. The 66th round of sample survey report on Household
Consumer Expenditure in India, 2009-10, carried out by National Sample Survey organization (NSSO)
relates to the period from J uly 2009 to J une 2010. The NSS concept of Monthly Per Capita Consumer
Expenditure (MPCE), is defned, at the household level (household monthly consumer expenditure
divided by household size). This measure serves as the indicator of the households level of living.
3.8 Average MPCE in 2009-10 was estimated as ` 1054 in rural India and ` 1984 in urban India
(NSS Report No. 538, [66th round] survey on house hold consumer expenditure). Among the major
states, Kerala (` 1835) had the highest rural MPCE. It was followed by Punjab (` 1649) and Haryana
(` 1510). In all other major States, average rural MPCE was between ` 750 and ` 1250. Average
rural MPCE was lowest in Bihar and Chattisgarh (around ` 780), and also low in Orissa and Jharkhand
(around ` 820). Maharashtra (` 2437) and Kerala (` 2413) were the two major states with the highest
MPCE in the urban sector, followed by Haryana (` 2321). The average MPCE
MMRP
in rural and urban
sectors of the major states of India is given in Appendix 3.3.
Box 3.1
Level of Consumption in 2009-10 All India
In 2009-10, the monthly per capita consumption expenditure level of the Indian
urban population was on the average about 88 % higher than that of the rural population.
Nearly 40 % of the rural population of India has MPCE below ` 800 and about 60%
had MPCE below `1000. About 10 % had MPCE above ` 1650
About 70 % of the urban population of India had MPCE above `1100, nearly 30 %
had MPCE above ` 2100, and 20 % had MPCE above ` 2600.
Source: NSSO 66th Round
Kerala State Planning Board
51
Box No. 3.2
Level of Consumption in 2009-10 Kerala
The percentage of rural population with MPCE above ` 1000 exceeded 70 % in Haryana
and Punjab, while in Kerala 80 %of the rural population had MPCE exceeding ` 977.
Only 10% of the urban population of Punjab and Haryana and only a slightly higher percent-
age in Kerala and Tamilnadu had MPCE below ` 850, compared to a little less than 30 %
in J harkand and over 40% in Bihar.
Source: N.S.S.O
3.9 Table 3.3 shows the percentage variation of average consumer expenditure per person in
Rural and Urban sectors of Kerala over All India, in various NSS rounds. The percentage variation in
the rural sector was 70 % while it was only 31.6% in the urban sector during 2000-01 (56th round). In
2009-10 (66th round), the percentage variation in the rural sector increased to 74.1 %, while in urban
sector the variation further declined to 21.5 %.
Table - 3.3
Trends in Average Consumer Expenditure per person for a period of 30 days
in various NSS Rounds (2009-10)
Year & Round of NSS Rural Urban
Kerala India % variation
of Kerala
over India
Kerala India % variaton
of Kerala
over India
1 2 3 4 5 6 7
2000-01 (56th) 841.31 494.91 70.0 1203.65 914.58 31.6
2002-03 (58th) 881.00 530.74 66.0 1266.64 1011.94 25.2
2003 J anuary to December (59th) 981.00 554.0 77.0 1300.0 1022.00 27.2
J anuary - J une
2004 60th round
Schedule Type - I 990.22 564.70 75.3 1371.51 1060.16 29.4
Schedule Type- II 1058.64 616.57 71.7 1403.89 1149.52 22.1
2004-05 (61st) 1013.15 558.78 81.3 1290.89 1052.36 22.7
2005-06 (62nd) 1055.61 624.53 69.0 1565.59 1170.60 33.7
2006-07(63rd ) 1250 695 80.0 1681 1312 28.1
2007-08 (64th) 1383 772 79.1 1948 1472 32.3
2009-10 (66th ) 1835 1053.64 74.1 2413 1984.46 21.5
Source: N.S.S.O
3.10 The percentage distribution of expenditure on food and non food items in various NSS rounds
from 2000-2001 up to 2009-10 (Table 3.4) shows that in Kerala, the share of expenditure on food items
varied between 40 % to 50.2 % and 34 % to 43.2 % in the rural and urban sectors respectively. At the
All India level, the share of expenditure on food items ranged between 52 % to 57.9 % and 39 % to 46
% in the rural and urban areas. The share of food in consumer expenditure was 13.97 % higher than
non-food items in rural India where as it was 11.23 % lesser than non-food items in urban India. The
share of food in consumer expenditure was 8.1 % lesser than non-food items in the rural sector and
19.6% lesser than non-food items in the urban sector of Kerala.
Economic Review 2011
52
Table - 3.4
Trends in percentage distribution of Food and Non-food Expenditure classifcation in various
NSS Rounds
Year & Round of NSS Rural Urban
Kerala India Kerala India
Food Nonfood Food Nonfood Food Nonfood Food Nonfood
1 2 3 4 5 6 7 8 9
2000-01 (56th) 49.63 50.37 56.29 43.71 43.22 56.78 43.80 56.20
2002-03 (58th) 50.23 49.77 55.07 44.93 40.25 59.75 42.47 57.53
2003 (J anuary to Decem-
ber) (59th)
44.92 55.08 53.88 46.12 38.36 61.64 41.98 58.02
J anuary -
J une 2004
60th round
Sch (Type - I) 46.54 53.46 53.94 46.06 40.76 59.24 41.64 58.36
Sch (Type- II) 50.23 49.77 57.96 42.04 40.92 59.08 46.00 54.00
2004-05 (61st) 44.97 55.03 55.05 44.95 39.97 60.03 42.51 57.49
2005-06 (62nd) 43.95 56.05 53.34 46.66 37.38 62.62 39.96 60.04
2006-2007(63rd ) 40.43 59.57 52.28 47.72 34.43 65.57 39.41 60.59
2007-08(64th) 40.79 59.21 52.35 47.65 36.10 63.90 39.58 60.42
2009-10 (66th ) 45.94 54.05 56.98 43.01 40.20 59.81 44.39 55.62
Source: N.S.S.O
3.11 States with low average MPCE tend to have a higher share of food in total consumer expendi-
ture (NSSO report No. 538). During 2009-10, the average expenditure on food items per person for 30
days in the rural areas of Kerala was ` 843 as against the All India fgure of ` 600.36. In rural areas,
the expenditure on non food items per person for 30 days was ` 992.92 in Kerala and ` 453.29 at the
all India level. In the urban sector, the average expenditure on food items per person for 30 days dur-
ing 2009-10 in Kerala was ` 969.76 and on non food items the expenditure was ` 1442.81 against the
All India fgure of ` 880.83 and ` 1103.63 respectively.
Kerala State Planning Board
53
Wholesale Price Index
3.12 Wholesale Price Index (WPI) is the most popular measure of infation in the country. The
Wholesale Price Index of agricultural commodities in Kerala in 2011 (upto March) went up by 1529.28
points compared to the corresponding period of 2010 registering an increase of 37.70 percent (Table
3.5). Among food crops, the highest price hike was recorded for Oil and Oilseeds (74.46%) followed
by fruits and vegetables (70.2 %) and non-food crops (59.08%). The price of food crops increased by
28.8 percent. Whereas the price of plantation crops decreased to 22.78 percent.
Table - 3.5
Wholesale Price Index of Agricultural Commodities in Kerala - 2010-11.
Base: 1952-53=100
SL
No
Crops
Weight Year % Variaton over
previous year
2008 2009 2009* 2010* 2011* 2008 2009 2010* 2011*
1 2 3 4 5 6 7 8 9 10 11 12
A Food Crops 635 3926 4106 4069 4509 5808.28 23.1 4.6 10.8 28.8
a) Rice 636 3704 3952 3889 4298 5036.08 27.1 6.7 10.5 17.17
b) Condiments and
spices
163 3678 3237 3054 3694 4679.40 14.6 -12.0 21.0 26.6
c) Fruits and Veg-
etables
169 5104 5368 5729 5882 10013.50 16.5 5.2 2.7 70.2
d) Molasses 32 3377 4921 4032 5600 4697.16 47.3 45.7 38.9 -16.12
B Non-Food Crops 365 3442 3127 3267 3267 5197.32 19.6 -9.2 0 59.08
a) Oil and Oil Seeds 698 3838 3269 3593 3288 5736.42 19.9 -14.8 -8.5 74.46
b) Plantation crops 302 2526 2798 2513 3218 3951.33 18.4 10.8 28.1 22.78
C All Crops 1000 3749 3748 3776 4056 5585.28 21.8 0 7.4 37.7
Source: Directorate of Economics and Statistics
*: Upto March
3.13 The month-wise wholesale price index of agricultural commodities in Kerala is given in Appendix
3.4. While analyzing the prices of commodities it can be seen that the price of condiments and spices
and also fruits and vegetables showed continuous increase during 2011. The price of molasses de-
creased and that of oil and oilseeds increased during the period under review.
Parity Index
3.14 Parity index is a relative measure as to the gains or loss to farmers as a consequence of the
price fuctuations in the economy. It is constructed to assess how the states consumer price situation
affects the farming community. It depends on the prices paid and received by farmers. The index is a
function of cost of farm cultivation, domestic expenditure and market rate of farm products.
Economic Review 2011
54
Table - 3.6
Index of Parity-Prices Received and Prices paid by Farmers from 2003-2011
Base:1952-53 = 100
Year Prices
received by
farmers
Farm
Cultivation
Cost
Domestic
Expendi-
ture
Prices
Paid
by Farm-
ers
Parity
index
Col.2 to 8
1 2 3 4 5 6
2003 2454 7056 2615 4295 57
2004 2651 7360 2705 4459 59
2005 2440 7703 2795 4640 53
2006 2474 8309 2947 4947 50
2007 2746 9135 3061 5288 52
2008 3167 10036 3394 5837 54
2009 3083 11468 3640 6460 48
2010 3727 12824 3970 7135 52
2011* 5075 14260 4345 7871 64
(Base year 1952-53 = 100)
* Average of monthly indices up to July 2011
(Source : Directorate of Economics and statistics)
3.15 The prices paid by farmers increased considerably year after year. Whereas the prices received
by them for their products are found to be less than what they pay (Table 3.6). In 2010 (upto J une) the
index of prices paid by farmers over the previous year increased by 412 points and the prices received
by farmers increased by 268 points signifes that the price situation is unfavourable to the farming com-
munity. In 2011 upto J uly the Index prices paid by farmers over the previous year increased by 736
points and the prices received by farmers increased by 1348 points shows that the price situation is
slightly favourable to the farming community. The farm cultivation cost increased by 1436 points dur-
ing J uly 2011 compared to the previous year and the domestic expenditure increased by 375 points.
The ratio of prices received and prices paid by farmers were well below 100 over the last several years
refecting the continuance of adverse terms of trade to the farming community.
Wages
3.16 The average daily wage rates of skilled and unskilled workers in agricultural sector from 2001-
2002 to 2010-11 are given in Tables 3.7 & 3.8. The daily wage rates of carpenter in the Agricultural
sector increased by ` 76.67 (22.42 percent) in 2010-11 over 2009-10 while that of Mason increased
by ` 76.33 (22.53 percent).
Table - 3.7
Average Daily-wage Rates of Skilled Workers in the Agricultural Sector (`)
Year Average Daily Wage Rates % Change Over Previous Year
Carpenter Mason Carpenter Mason
1 2 3 4 5
2001-02 182.42 180.06 3.56 3.57
2002-03 190.07 186.30 4.20 3.5
2003-04 192.00 188.00 1.02 0.9
2004-05 199.23 194.08 3.82 3.2
2005-06 207.88 206.25 4.34 6.27
Kerala State Planning Board
55
Year Average Daily Wage Rates % Change Over Previous Year
Carpenter Mason Carpenter Mason
2006-07 226.33 226.50 8.88 9.82
2007-08 254.67 253.75 12.52 12.03
2008-09 297.83 295.58 16.95 16.48
2009-10 341.83 338.67 14.77 14.58
2010-11 418.50 415 22.42 22.53
Source: Directorate of Economics & Statistics
3.17 In 2010-11, the daily wage rates of male unskilled workers in Agricultural Sector showed an in-
crease of ` 52.71 (20.26 percent) over 2009-10. Whereas for the female workers it was `.43.08(23.23
percent).
Table - 3.8
Average Daily-Wage Rates of Unskilled Workers in the Agricultural Sector (`)
Year Average Daily Wage Rates of Paddy Field Workers
Male % Growth over
previous year
Female % Growth over
previous year
1 2 3 4 5
2001-02 127.21 3 88.75 7.7
2002-03 144.90 13.9 99.73 12.4
2003-04 148.72 2.6 101.64 1.9
2004-05 165.58 11 115.75 13.9
2005-06 166.39 0.49 108.19 (-) 6.53
2006-07 179.01 7.58 123.96 14.58
2007-08 195.97 9.47 137.42 10.86
2008-09 224.40 14.51 159.02 15.72
2009-10 260.11 15.91 185.40 16.59
2010-11 312.82 20.26 228.48 23.23
Source: Directorate of Economics & Statistics
Farm Commodity Price
3.18 Data on average farm price of principal crops grown in Kerala are shown in Table 3.9. The table
shows increase in 2010-11 compared to previous year in respect of most of the commodities namely
tapioca (65.5%), coconut (64.5%), cashew (57.7%), Pepper (56.1%), Rubber (53.14%), car-
damom (26.6%), Arecanut (18.8%), Paddy (18.8%), Banana(7.8%) except Tea. Tea was the only one
commodity during 2010-11 marked the negative growth of 19.1%. Data on month wise prices of the
commodities during 2010-11 area shown in Appendix 4.18.
Economic Review 2011
56
Table 3.9
Average Farm Price of Important Agricultural Commodities
Year Paddy
(qtl.)
Coconut
with
husk (in
00 nos.)
Cashew-
nut (qtl.)
Banana
(qtl)
Tapioca
(qtl.)
Pepper
(qtl.)
Rubber
(qtl)
Tea
(kg.)
Cof-
fee
(kg)
Carda-
mom
(kg)
2002-03 649.76 475.63 32.11 971.34 394.01 7692.17 3919 47.21 28.12 561.13
2003-04 694.69 582.73 34.62 1167.00 389.36 6802.46 5040 45.78 32.29 361.02
2004-05 651.00 635.00 40.00 1112 404 6032 5224 52.14 53.36 330.44
2005-06 610.78 494.89 43.73 1247.81 432.63 5979.84 6699 54.41 62.86 217.44
2006-07 681.72 473.36 52.17 1333.58 469.54 10730.62 8325.16 68.65 65.34 312.03
2007-08 788.14 485.72 52.10 1467.95 520.33 12901.42 9390.77 67.28 67.73 463.14
2008-09 915.87 544.25 48.90 1565.33 555.86 11475.64 8915.85 110.30 53.06 506.44
2009-10 990.77 463.20 46.15 1952.40 587.77 13482.25 12489.48 107.81 38.49 800.08
2010-11 1177.08 762.02 54.84 2103.80 972.45 21046.85 19126.72 87.2 47.52 1013.15
% of varia-
tion over
2009-10
18.8 64.5 18.8 7.8 65.5 56.1 53.14 -19.11 23.5 26.6
Source: Directorate of Economics and Statistics
Kerala State Planning Board
Trade Flows
C
H
A
P
T
E
R
60
Kerala State Planning Board
61
The continuing economic crisis in most of the developed nations seemed to have severely slowed
world trade in 2011. Take the case of exports. From an impressive surge of 14.5% in 2010, world
exports (volume-wise) slipped to a modest 6.5% in the following year. Experts, including of the World
7UDGH2UJDQLVDWLRQIHHOWKDWWKHWUHQGLVOLNHO\WRSHUVLVWVZKDWZLWKWKHSHUVLVWLQJXQFHUWDLQLWLHVLQWKH
developed nations, more particularly the United States and Europe.
Box. 4.1
WTO Director-General Pascal Lamy said. The hangover, however, from the financial
crisis is still with us. High unemployment in developed economies and sharp belt-
tightening in Europe will keep fuelling protectionist pressures. WTO Members must
continue to be vigilant and resist these pressures and to work toward opening markets
rather than closing them. Stability shouldbe the name of the game for 2011.
Fig 4.1: Growth in voIume of worId merchandise trade and GDP, 2000-11 a
AnnuaI % change
a Figures for 2011 are projections
Trade Flows
Economic Review 2011
62
Source: WTO Secretariat
4.2 The uneven recovery in output produced an equally uneven recovery in global trade
RZVLQ:KLOHZRUOGPHUFKDQGLVH H[SRUWVURVHE\LQYROXPHWHUPVWKRVHRI
developed economies increased by 12.9%, and the combined shipments from developing
economies and the CIS jumped by 16.7% (Table 4.1). Imports of developed economies grew
more slowly than exports last year (10.7% compared to 12.9%), while the developing econo-
mies plus the Commonwealth of Independent States (CIS) saw the opposite happen (17.9%
growth in imports compared to 16.7% for exports).
TabIe4.1
GDP and merchandise trade by region, 2007-10
AnnuaI % change
a Includes the Caribbean.
b Hong Kong, China; Republic of Korea; Singapore and Chinese Taipei.
Source: WTO Secretariat, [Link].
4.3 The surge in 2010 was mainly contributed by Asian countries, the increase in their exports
being a whopping 23.1%, largely led by China and Japan. The US and the European Union, on the
other hand, reported a much slower growth at 15.4% and 11.4%, respectively. Imports were up
22.1% in real terms in China, 14.8% in the US, 10.0% in Japan, and 9.2% in the European Union.
5HJLRQVWKDWH[SRUWHGVLJQLFDQWTXDQWLWLHVRIQDWXUDOUHVRXUFHV$IULFDWKH&,6:HVW
Asia and South America), meanwhile, experienced relatively low growth in volume. But
in value terms, the increase was much higher, thanks to dollar appreciation. Africas ex-
ports, for example, were up 6% in volume terms but 28% in dollar terms (Appendix 4.1).
Indias Foreign Trade
4.5 Indias exports during 2011-12 (April-December) which was at US$ 217.7 billion, record-
ed a growth of 25.8% as compared to 36.0% in the previous year (Table 4.2). While exports
SHUIRUPHGZHOOGXULQJWKHUVWKDOIRIWKHUHZDVVLJQLFDQWGHFHOHUDWLRQLQWKHWKLUG
TXDUWHUUHHFWLQJZHDNHQLQJRIZRUOGGHPDQGLQWHUDOLDFDXVHGE\(XUR]RQHFULVLV
4.6 Imports during 2011-12 (April-December), on the other hand, were of the order of US$
350.9 billion, a growth of 30.4% as compared with 29.8% in the preceding year. Petroleum,
oil and lubricants, gold silver and machinery were the major items of imports.
Kerala State Planning Board
63
Exports of all commodities from India, destination-wise, are given in Appendix 4.2. Item-wise details of
Indias foreign trade (April-December 2011) are shown in Table 4.2
TabIe4.2
India's Merchandise Trade ApriI-December 2011 (US$ biIIion)
Item 2010-2011 (R) 2011-12(P)
1 2 3
Exports 173.0(36.0) 217.7(25.8)
2LOH[SRUWV 28.3(45.3) 43.9(55.0)
Non oil exports 144.7(32.8) 173.7(20.1)
Imports 269.1 (29.8) 350.9(30.4)
2LOLPSRUWV 75.2(22.0) 105.6(40.4)
Non oil imports 193.9(33.1) 245.3(26.5)
Trade Balance -96.1 -133.3
2LO7UDGH%DODQFH -46.9 -61.7
1RQ2LOWUDGH%DODQFH -49.2 -71.6
Note: Revised, (P) Provisional. .Figure in parentheses shows percentage change over the
corresponding period of the previous year.
Source: RBI Bulletin, December 2011, [Link]
$V WKH FUXGH RLO SULFHV RDWHG XSZDUGV LPSRUWV GXULQJ$SULO'HFHPEHU DPRXQWHG WR 86
ELOOLRQ DQ LQFUHDVH RI 7KHUH KDG EHHQ VLJQLFDQW ULVH LQ LPSRUW RI JROG VLOYHU DQG
PDFKLQHU\1RQRLOLPSRUWVGXULQJWKHUVWKDOIRIDW86ELOOLRQUHFRUGHGDJURZWKRI
26.5% as compared to 33.1% in the corresponding period of the previous year.
7KHWUDGHGHFLWGXULQJ$SULO'HFHPEHUWRXFKHG86ELOOLRQDVFRPSDUHGWR86
billion during the corresponding period of 2010. The data on commodity-wise merchandise exports
indicated that during 2011-12 (April-December) engineering goods, petroleum products, chemicals,
gems and jewellery and agricultural products contributed more than 80% of the overall exports. Export
growth was higher in sectors like leather and manufactures and textile and textile products while it was
lower for petroleum products and ores and minerals (See Appendix 4.3).
,QFUHDVLQJ GLYHUVLFDWLRQ RI H[SRUWV LQ WHUPV RI GHVWLQDWLRQ DQG FRPPRGLWLHV GXH WR VXSSRUWLYH
government policy facilitated export performance. Exports to the European Union, the US, and Asia
together accounted for a larger share of Indias exports. Indias foreign trade up to September 2011 is
shown in Table 4.3.
TabIe4.3
India's Foreign Trade - September 2011
Year
Exports
(Rs. in
crores)
Imports
(Rs. in crores)
Exports
US$ miIIion Imports
(US$ miIIion)
Trade baIance
Rs. in
crores
US$
miIIion
2009-10 70838(-1.5) 104275(-26.5) 14624(-7.4) 21527(-30.9) -33437 -6903
2010-11(R) 83928(18.48) 124366(19.27) 18221(24.60) 27000(25.42) -40438 -8779
2011-12(P)
up to July 2011
130339 179561 29344 40426 -49222 -11082
(Figures in bracket denote to percentage variation over the corresponding period of the previous year) Source:
RBI Bulletin March 2012. R-Revised, P-Provisional
Economic Review 2011
64
4.10 The Foreign Trade Policy 2009-14 released by the Union Government reiterated the possibility of
India coming back to high export growth path of around 25% per annum. Cross-country comparison
of export performance indicated that Indias export growth was the highest among the major advanced
DQGHPHUJLQJHFRQRPLHVGXULQJWKHUVWVL[PRQWKVRI/DWHVWPRQWKO\GDWDDYDLODEOHIURPWKH
International Monitory Fund showed that the value of world merchandise exports grew, on an average,
by 22.1% during April-September 2011.
4.11 Export performance of commodities like fresh vegetables, rice, poultry products, tobacco, iron
RUHFRDOSURMHFWJRRGVVLONFDUSHWVFRPSXWHUVRIWZDUHHWFPDUNHGDGHFOLQHGXULQJ9HJ-
etables exports contracted by 10.5%, rice by 37%, poultry products by 23%, tobacco by 14%, iron ore
by 23%, silk carpets by 59%, project goods by 39% and computer software by 62%. The depreciation
LQWKHUXSHHWULJJHUHGE\WKH(XUR]RQHFULVLVVWRRGLQWKHZD\RIH[SRUWVRIFHUWDLQFRPPRGLWLHV
Exports
4.12 Indias export earnings during 2011-12 increased to $301137 million from $251957 million in
2010-11, an increase of 19.5%. Item-wise analysis of exports for the period 2010-11 over 2009-10
showed that earnings from the export of agro products increased by 39.2%, ores and minerals by 23%
and manufactured goods 42.4%. A commodity-wise analysis of exports is shown in Table 4.4.
TabIe: 4.4
Commodity-wise anaIysis of exports from 2003-04 to 2010-11 (US$ miIIion)
Items 2003-
04
2004-
05
2005-
06
2006-
07
2007-
08
2008-
09
2009-
10
2010-
11
2011-
12
Agro Products 7538 8471 10212 12675 18442 17563 17747 24696 NA
2UHV0LQHUDOV 2370 5076 6163 6998 9124 7813 8669 10660 NA
Manufactured
goods
48525 60706 72552 84863 103032 123345 115262 164107 NA
Total(including
others)
63886 83503 103075 126276 162988 183091 178345 251957 301137
Source CMIE December2011
4.13 Given the on-going economic crisis in the US and Europe, which accounted for 30% of Indias
exports, the chances of demand picking up in the current year is bleak. The growth rate of exports
projected by CMIE is 19.5% for 2011-12 as against 41.3% recorded in the preceding year. In value
terms the expectation is US$ 301.1 billion.
4.14 A comparative study shows that Indias export growth had been much higher than the global
JURZWKUDWHGXULQJWKHFXUUHQW\HDUHQGHG6HSWHPEHU,Q1RYHPEHUWKH:RUOG7UDGH2UJD-
QL]DWLRQKDGIRUHFDVWWKDWZRUOGH[SRUWVZRXOGGHFOLQHIURPWRGXHWRWKHZRUVHQLQJRXWORRN
IRUWKHJOREDOHFRQRP\7KLVDSDUWWKHVRYHUHLJQGHEWFULVLVLQ(XUR]RQHZHDNQHVVLQWKH86DQG
PRGHUQL]DWLRQ RI HFRQRPLF DFWLYLW\ LQ &KLQD ZHUH VDLG WR DGYHUVHO\ DIIHFW ,QGLDV H[SRUW SURVSHFWV
Projection of exports and imports by CMIE for the period 2011-12 is given in Appendix 4.4. The CMIEs
forecast shows the export from India to be 19.5% in 2011-12 (Figure 4.2).
Kerala State Planning Board
65
Fig. 4.2
CMIE's Projection of Exports (%)
([SRUWJURZWKVKRZHGDQXSWUHQGGXULQJDOOWKHUVWVL[PRQWKVRIUHHFWLQJWKHLPSDFW
of export promotional measures announced by the Government. However, after peaking at 82% in July
2011, monthly export growth remained comparatively low in August and September 2011, but higher
than corresponding months of 2010-11. The commoditywise exports data available during 2011-12
(April-June), showed that manufactured goods continued to maintain the largest share with 66% fol-
lowed by petroleum products (18.4%) and primary products (13.2%). The rise in the share of manu-
IDFWXUHGJRRGVHVVHQWLDOO\HPDQDWHGIURPLPSURYHPHQWLQWKHVKDUHRIHQJLQHHULQJJRRGV5HHFWLQJ
the robust demand in new markets like Latin America and Africa, exports of engineering goods during
April-June 2011 were more than double than in the corresponding period of the previous year.
Indias export to principal region (percentage share) is shown in Appendix 4.5
4.16 In value terms too, there had been consistent increase (see Table 4.5), resulting in the countrys
foreign exchange reserve adding up to US$ 314.34 billion as on November 2011. Petroleum products,
ores and minerals were the sectors which recorded decelerated growth during April-June 2011. Lower
JURZWKLQWKHH[SRUWVRIRUHVDQGPLQHUDOVSRVVLEO\UHHFWHGUHGXFHGGHPDQGIRUEDVLFLQSXWVGXHWR
concerns with regard to global slowdown. The impact of quantitative restrictions imposed on exports
of raw cotton also resulted in negative growth during April-June 2011.
TabIe-4.5
India's Export Earnings from 2003-04 to 2010-11
( [Link] crore & US$ miIIion)
Export Earnings (Rs. In crores) Export Earnings (US$ miIIion)
Year OiI Non OiI TotaI OiI Non OiI TotaI
2003-04 16397 276969 293367 3568 60274 63843
2004-05 31404 343935 375340 6989 76547 83536
2005-06 51533 404885 456418 11640 91451 103091
2006-07 84520 487259 571779 18635 107779 126414
2007-08 114192 541672 655864 28363 134541 162904
Economic Review 2011
66
Export Earnings (Rs. In crores) Export Earnings (US$ miIIion)
Year OiI Non OiI TotaI OiI Non OiI TotaI
2008-09 123398 717357 840755 27547 157748 185295
2009-10 132899 712635 845534 28192 150559 178751
2010-11 190781 966694 1157475 41918 212484 254402
Source RBI Bulletin December 2011.
Imports
4.17 Imports during 2011-12 (April-December) registered a growth rate of 30.4% compared to 29.8%
in the preceding period. Though there had been a spurt in imports of petroleum, oil and lubricants,
gold & silver and machinery, certain categories of capital goods either declined or showed decelerated
growth raising concerns over the domestic investment scenario.
4.18 Higher growth in both oil and non-oil imports necessarily resulted in a wider merchandise trade
GHFLWRI86ELOOLRQGXULQJ$SULO'HFHPEHUDJDLQVW86ELOOLRQLQWKHFRUUHVSRQG-
ing period of the previous year.
TabIe: 4.6
India's Import during 2003-04 to 2010-11 (in ` in Crores and US$ miIIion)
Import (Rs. in crores) Import (in US$ miIIion)
Year OiI Non OiI TotaI OiI Non OiI TotaI
2003-04 94520 264588 359108 20569 57580 78149
2004-05 134094 366971 501065 29844 81673 111517
2005-06 194640 465769 660409 43963 105203 149166
2006-07 258572 581935 840506 56945 128790 185735
2007-08 320655 691657 1012312 76645 171795 251439
2008-09 419968 954468 1374436 93762 210025 303696
2009-10 411649 952086 1363736 87136 201237 288373
2010-11 482282 1201185 1683467 103952 265817 369769
Source: RBI Bulletin December 2011.
4.19 Imports during 2010-11 were valued at US$ 3,69,769 million against US$ 2,88,373 million in
VKRZLQJDVKDUSLQFUHDVHRI7DEOH,PSRUWVRI32/UHDFKHGWRDOHYHORI86
1,03,952 Million in 2010-11 registering an increase of 19.30 per cent over the previous year. Import of
1RQ32/VWRRGDW860LOOLRQDVDJDLQVW860LOOLRQRIWKHSUHYLRXVSHULRG,PSRUW
percentage of GDP stood at 23.2 per cent (provisional) in 2010-11. imports are expected to grow by a
VKDUSDQGQRQ32/LPSRUWVE\SHUFHQWVHH7DEOH7KHSHUFHQWDJHRI,QGLDVLPSRUWV
of commodities by share of groups/countries is given Appendix 4.6.
TabIe: 4.7
Commodity wise anaIysis of Imports from 2003-04 to 2011-12 ($ miIIion )
Items 2003-04 2004-
05
2005-
06
2006-07 2007-08 2008-09 2009-10 2010-11 2011-12
(p)
32/ 20584 29832 43957 57068 79659 91456 86827 105928 143003
Non
32/
57619 81640 105187 128014 170132 207855 200820 246346 305950
Source: CMIE December 2011. P-Provisional
Kerala State Planning Board
67
)RUWKH\HDUHQGLQJ0DUFK&0,(SUHGLFWHGLPSRUWVWRULVHE\DJDLQVWLQ32/
Export Import Trade by Kerala through Cochin Port
4.21 Cochin Port is the major gateway to the State. The trade menu of Kerala includes mainly pepper,
FDVKHZFRLUDQGFRLUSURGXFWVWHDFDUGDPRPJLQJHUVSLFHVRLODQGPDULQHSURGXFWV7RWDOWUDIF
handled by the port increased to 178.72 lakh MT in 2010-11 from 174.29 lakh MT by 2009-10, register-
LQJDQLQFUHDVHRI2XWRIWKLVH[SRUWVDFFRXQWHGIRUODNK07DQGLPSRUWVODNK
MT. (Table 4.8)
TabIe4.8
Cargo HandIed at Cochin Port during 2006-07 to 2010-11 (In Lakh MT)
Trafc
Export Import
2006-
07
2007-
08
2008-
09
2009-
10
2010-
11
2006-
07
2007-08 2008-
09
2009-
10
2010-11
1 2 3 4 5 6 7 8 9 10 11
Coastal 15.69 14.92 9.81 12.83 12.04 28.72 36.60 38.17 42.65 48.21
Foreign 19.05 19.99 17.29 23.13 22.00 89.11 86.04 89.67 95.68 96.47
Total 34.74 34.91 27.10 35.96 34.04 117.83 122.64 127.84 138.33 144.68
Source: Cochin Port Trust
Commodity Composition of Exports through Cochin Port
4.22 Tea, cashew kernels, sea foods, coir products, spices, coffee etc are the main items exported
WKURXJK&RFKLQ3RUW2IWKHWRWDOH[SRUWVRIWHDFRQVWLWXWHGFDVKHZNHUQHOV
sea foods 4.98%, coir products 3.85%, spices 2.38%, coffee 2.49% and miscellaneous, including
32/
4.23 Total quantity of exports through Cochin Port during the year under review had decreased to
34.04 lakh MT from 35.96 lakh MT in the previous year. In 2010-11 a rise of 2.54% in quantitative terms
and 17.6% in value terms could be seen. As compared to the previous year, during 2010-11 all commodi-
ties exported through the port showed an increasing trend except tea, coir products and spices. During
2010-11, exports of cashew kernels increased by 18.40%, coffee by 175.47% and sea foods by 22.67%.
Exports of tea decreased by 3.1%, coir products by 25.58% and spices by 0.9% (see Appendix 4.7).
Commodity Composition of Keralas Imports through Cochin Port
4.24 Imports through Cochin Port increased to 144.68 lakh MT in 2010-11 from 138.33 lakh MT of
VKRZLQJDJURZWKRI)HUWLOL]HUVDQGUDZPDWHULDOVIRRGJUDLQVLURQVWHHODQGPD-
FKLQHU\QHZVSULQWDQGUDZFDVKHZQXWDUHWKHPDLQLWHPVRILPSRUWV'XULQJLPSRUWRIIHUWLOL]-
ers and raw materials decreased by 0.30%. In the case of iron, steel and machinery imports, a higher
JURZWKRIZDVUHJLVWHUHGGXULQJ$OOLWHPVH[FHSWIHUWLOL]HUVDQGUDZPDWHULDOVPDUNHG
DQLQFUHDVLQJWUHQGRILPSRUWVGXULQJWKHSHULRGXQGHUUHYLHZ2IWKHWRWDOLPSRUWVLQIHUWLOL]HUV
and raw materials constituted 4.28%, food grains 0.06%, iron and steel and machinery 1.41%, news-
SULQWFDVKHZQXWDQGPLVFHOODQHRXVLQFOXGLQJ32/$SSHQGL[
Cargo handled by Cochin Port
4.25 During 2010-11, exports of cargo (both coastal and foreign) from Cochin Port decreased to 34.04
ODNK07IURPODNK07LQWKHSUHYLRXV\HDUDJRVKRZLQJDIDOORI2QWKHRWKHUKDQGLP-
ports of cargo registered a growth of 4.59% during the same period. While coastal exports decreased
to 12.04 lakh MT in 2010-11 from 12.83 lakh MT in 2009-10, foreign export decreased to 22.00 lakh
MT in 2010-11 from 23.13 lakh MT in 2009-10. Both coastal and foreign imports increased by 13.04%
Economic Review 2011
68
and 0.83%, respectively during 2010-11 (see Table 4.8).
Exports of Marine Products - National Scenario
4.26 Exports of Marine Products during 2010-11 totalled 813091 MT valued at Rs.12901.47 crore as
against 678436 MT valued Rs.10048.53 crore in 2009-10. In quantity there was an increase of 19.85%
and in value terms 28.39% over the previous year. During the year under review export earnings from
marine products in dollar terms stood at US$ 2856.92 million showing an increase of 33.95%.
4.27 South-East Asia emerged as the largest market for marine products from India accounting for a
share of 28.77% in quantity but 16.38% in value followed by European Union with 2% in quantity but
26.81% in value. In value terms China accounted for 15.33% and 19.57% in quantity. Japan share
was 13.04% in value and 8.70% in quantity, the US 15.42% in value and 6.16% in quantity and West
Asia 5.40% in quantity and 5.19 % in value. Exports to countries like Libya, Reunion islands, Australia,
3XHUWR5LFR'[Link]\D8NUDLQH%UD]LOHWFVKRZHGDSRVLWLYHJURZWK
4.28 Major importers of marine products from India and their share in value during 2010-11 is furnished
in the diagram (Fig.4.3) given below.
Fig.4.3
Source: The Marine Products Export Development Agency (MPEDA)
7KH PDMRU PDULQH SURGXFWV H[SRUWHG ZHUH IUR]HQ VKULPS IUR]HQ VK IUR]HQ FXWWOH VK IUR]HQ
squid, dried items, live items and chilled items. Details of item-wise exports of marine products from
,QGLDIRUWKHODVWYH\HDUVDUHJLYHQLQ$SSHQGL[&RPSDUHGWRWKHSUHYLRXV\HDULQWKH\HDUXQ-
GHUUHSRUWDOOLWHPVH[SRUWHGH[FHSWIUR]HQFXWWOHVKOLYHLWHPVDQGFKLOOHGLWHPVVKRZHGDQLQFUHDV-
ing trend. In the year under report an analysis of exports of marine products from our country showed
WKDWTXDQWLWDWLYHO\WKHH[SRUWRIIUR]HQVKWRSSHG07EXWLQYDOXHWHUPVWKHWRSFRQWULEXWRU
ZDVIUR]HQVKULPSZLWKDQHDUQLQJRI5VFURUHWKRXJKTXDQWLWDWLYHO\LWVWRRGVHFRQG
Exports of Marine Products from Kerala
4.30 During 2010-11, marine exports of Kerala stood at 124615 MT having a value of Rs.200210 lakh
as against 107293 MT valued at Rs.167002 lakh in 2009-10. Contribution of Kerala towards Indias
marine export in the year 2010-11 came down slightly to 15.33% from15.81% in 2009-10 in volume
and decreased in value to15.52% from 16.62 per cent of year ago period. This decreasing trend con-
tinued till 2008-09. Table 4.9 shows the export details of marine products of Kerala compared to all
India in quantity and value for years 2004-05 to 2010-11.
Kerala State Planning Board
69
Fig 4.4
Export trend of Marine products - KeraIa & India ([Link])
(2000-01 to 2010-11)
Source: The Marine Products Export Development Agency (MPEDA)
TabIe4.9
Export Trend of Marine Products - India & KeraIa 2004-05 to 2010-11
Year
INDIA KERALA KERALA's share%
Quantity
(Tonnes)
VaIue
( Rs Lakh
Quantity
(Tonnes)
VaIue
(Rs. Lakh
Quanti-
ty
VaIue
2004-05 461329 664669 87337 115742 18.93 17.41
2005-06 512164 724530 97311 125765 19 17.36
2006-07 612642 836353 108616 152412 17.74 19.00
2007-08 541701 762092 100318 143091 18.52 18.78
2008-09 602835 8607.94 100780 157218 16.72 18.26
2009-10 678436 1004853 107293 167002 15.81 16.62
2010-11 813091 12901.47 124615 200210 15.33 15.52
Source: The Marine Products Export Development Agency (MPEDA) [Link]
$QDQDO\VLVRIH[[Link]]HQFXWWOH
VKOLYHLWHPVDQGFKLOOHGLWHPVPDUNHGDQHJDWLYHWUHQGZKHUHDVIUR]HQVKULPSIUR]HQVKIUR]HQ
VTXLGGULHGLWHPVDQGRWKHUVVKRZHGSRVLWLYHWUHQG0DMRULWHPVRIH[SRUWVZHUHIUR]HQVKULPS
IUR]HQVKIUR]HQFXWWOHVKDQGIUR]HQVTXLG/LYHLWHPVDQGFKLOOHGLWHPVFRQWULE-
uted 0.2% and 2.3% respectively. (See Table 4.10)
Economic Review 2011
70
TabIe-4.10
Item wise Exports of Marine Products from KeraIa
During 2009-10 and 2010-11
[Link] Item
2009-2010 VaI. Rs (crores)
Qty. (Tons) VaI. Rs
(crores)
Qty. (Tons) VaI. Rs (crores)
1 2 3 4 5 6
1 )UR]HQ6KULPS 25290 646.75 25301 655.19
2 )UR]HQVK 29111 216.38 35636 263.26
3 )UR]HQ&XWWOH)LVK 23157 402.05 20625 481.67
4 )UR]HQ6TXLG 18713 209.18 31973 399.38
5 Dried Items 78 16.44 174 4.03
6 Live Items 431 27.93 372 31.78
7 Chilled Items 2856 71.89 2815 67.75
8 2WKHUV 7656 79.41 7719 99.05
Total 107293 1670.02 124615 2002.11
Source: MPEDA
Cashew
4.32 India continued to be the largest producer of raw cashewnuts in the world. Production of raw nuts
in India during 2010-11 was 6,53,000 MT as against the estimated production of 6,13,000 MT during
7KHRWKHUPDLQSURGXFLQJFRXQWULHVDUH9LHWQDP%UD]LO7DQ]DQLD,YRU\&RDVW*XLQHD%LV-
VDX 0R]DPELTXH DQG ,QGRQHVLD 7KH H[SRUW HDUQLQJV IURP FDVKHZ DQG DOOLHG SURGXFWV GXULQJ WKH
year 2010-11 added up to Rs. 2630 crore (US $ 577 Million)
Box: 4.2
The share of agricultural products in the total export earnings of the country during 2010-11
was5.47%and cashew kernels ranked 9
th
among them contributing 4.14%. This accounted to
0.23%of the total foreignexchange earnings of the country through exports.
4.33 Total export of cashew kernels from India during 2010-11 was 91559 MT valued at Rs. 2598.15
crore (US$ 570 million) as against 108120 MT valued at Rs. 2906 crore (US$613 million) in 2009-10.
When compared to the previous year it showed a decrease of 15.32% in quantity and 11% in rupee
terms and 7.0% in US$ terms. Though the quantum of exports decreased, the average unit export
SULFHUHDOL]HGZHQWXSGXULQJWKH\HDUWR5VSHUNJDVDJDLQVW5VSHUNJLQ
7DEOHVKRZVWKHH[SRUWRIFDVKHZNHUQHOVIURP,QGLDWRGLIIHUHQW]RQHV
Kerala State Planning Board
71
TabIe4.11
Export of Cashew KerneIs from India to Different Zones
Zone
2009-10 2010-11 Difference (%)
Quantity
(MT)
VaIue (Rs.
crores)
Quantity
(MT)
VaIue (Rs.
crores)
Quantity
(MT)
VaIue
(Rs.
crores)
America 34034 787.29 29415 859.22 -13.57 9.14
Europe 35820 836.06 26066 729.14 -27.23 -12.79
West Asia& Africa 34027 848.56 23160 691.33 -31.94 -18.53
South East &Far
East Asia
12328 291.66 11210 280.16 -9.07 -3.94
2FHDQLD 1750 37.12 1708 38.19 -2.40 2.88
Total 117959 2800.69 91559 2598.04 -22.38 -7.24
Source: Cashew Export Promotion council, [Link]
2XWRIWKHWRWDOTXDQWLW\RIFDVKHZNHUQHOH[SRUWHGGXULQJPDMRUVKDUHLHZDV
WRWKH$PHULFDQ]RQH7KH(XURSHDQ]RQHDFFRXQWHGIRUDQGWKH:HVW$VLDQ=RQH
There was a decrease of 13.57% in exports to American Zone.
4.35 Both in value and quantity terms Keralas share in cashew kernel export of India had been show-
LQJDQHJDWLYHWUHQGVLQFH2IWKHWRWDOH[SRUWVRIFDVKHZNHUQHOVIURP,[Link]-
tribution in quantitative terms stood at 54.27% and, in value terms, at 54.55% in 2010-11. This was
57.06% and 56.29%, respectively in 2009-10 (see Table 4.12).
TabIe4.12
Export of Cashew KerneIs: KeraIa and India (2004-05 to 2010-11)
(Quantity in MT and VaIue in Rs. Crores)
Year
KeraIa* India Share of KeraIa (%)
Quantity VaIue Quantity VaIue Quantity VaIue
2004-05 79950 1715.94 126667 2709.24 63.12 63.34
2005-06 74376 1622.82 114143 2514.86 65.16 64.53
2006-07 72860 1504.87 118540 2455.15 61.46 61.29
2007-08 69298 1395.02 114345 2289.02 60.60 60.94
2008-09 63730 1716.52 109523 2988.4 58.19 57.44
2009-10 61698 1635.79 108120 2905.82 57.06 56.29
2010-11** 49692 1417.28 91559 2598.15 54.27 54.55
Source: The Cashew Export Promotion Council of India
*Export through Cochin Port, **Provisional
4.36 A country-wise analysis of export of cashew kernels from India shows that the US remained the
main customer by importing 32% of the total export. UAE (13%) and the Netherlands (10%) came the
second and third largest customers of cashew kernels from India.
4.37 The export of cashewnut shell liquid from India during 2010-11 was 11364 MT valued Rs.
31.85 crore (US$ 7 million) as against an export of 11227 MT valued Rs. 27.62 crore (US$ 5.8
million) during 2009-10. There was an increase of 1.22% in quantity, 15.31% in rupee terms
and an of 20.69% in US$ terms. The unit value of cashewnut shell liquid during the period un-
Economic Review 2011
72
der report stood at Rs.28.03 per kg as against Rs. 24.60 per kg in the previous year. Export
details of cashewnut shell liquid from India during 2009-10 and 2010-11 are furnished in
Table 4.13.
TabIe.4.13
Export of Cashewnut SheII Liquid & CardanoI from India during 2009-10 & 2010-11
[Link] Countries
2009-10* 2010-11*
Qty (MT) VaIue ( crs.) Qty (MT) VaIue ( crs.)
1 2 3 4 5 6
1 USA 6117 12.81 5066 11.28
2 China 2910 8.26 3232 8.61
3 Korea R 1391 3.95 1395 5.05
4 Japan 281 0.82 630 1.89
5 Indonesia 178 0.37 98 0.26
6 Taiwan 69 0.36 122 0.81
7 Slovenia 41 0.15 247 1.05
8
Thailand 42 0.16 38 0.15
9 South Africa 16 0.06 54 0.20
10
Singapore 24 0.10 153 0.99
11 2WKHUV 158 0.58 329 1.57
TotaI 11227 27.62 11364 31.85
*Export through Cochin Port
Source: Cashew Export Promotion council of India
4.38 The share of Kerala in the export of cashewnut shell liquid decreased to 2717 MT during 2010-11
IURP07LQWKHSUHYLRXV\HDU2IWKHWRWDOFDVKHZVKHOOOLTXLGH[[Link]
at 24%. Trends in cashewnut shell liquid export from Kerala are given in the Fig 4.5 below. The major
markets of India`s export were the US, China, Korea, Japan and Indonesia. The details of export of
cashew nut shell liquid from Kerala & India are furnished in Table.4.14
Fig.4.5
Kerala State Planning Board
73
TabIe4.14
Export of Cashew nut sheII Liquid - KeraIa & India (2004-05 to 2010-11)
(Quantity in MT and vaIue in Rs. crore)
Year
KeraIa* India
Quantity
(MT)
VaIue
([Link])
Quantity (MT) VaIue
([Link])
1
2 3
4 5
2004-05 6674 6.58 7474 7.91
2005-06 5834 5.97 6405 7.09
2006-07 3736 5.70 6139 10.29
2007-08 5410 7.41 7813 11.98
2008-09 2217 3.91 9099 26.06
2009-10 3079 6.65 9748 24.12
2010-11** 2717 6.30 11364 31.85
Source: The Cashew Export Promotion Council of India
*Export through Cochin Port, ** Provisional
4.39 The total raw cashewnuts imported into India during 2010-11 was 5,04,138 MT valued at
Rs.2479.75 crore against 7,52,854 MT valued at Rs. 3037.35 crore in 2009-10. (see Table 4.15). The
unit import price for raw cashew nut was Rs.49.19/kg during 2010-11 as against Rs. 40.31/kg during
the previous year.
TabIe: 4.15
Import of raw Cashewnuts into India :KeraIa
(2006-07 to 2010-11)
Year
KeraIa* India
Quantity
(MT)
VaIue
([Link])
Quantity (MT) VaIue
([Link])
1
2 3
4 5
2006-07 322443 971.79 586044 1811.62
2007-08 372497 1071.21 605985 1746.84
2008-09 345366 1476.87 605850 2632.40
2009-10 375467 1445.24 752854 3037.35
2010-11** 215590 1010.43 504138 2479.75
*import through Cochin Port , ** Provisional
Source: The Cashew Export Promotion Council of India
Coffee
4.40 World Coffee export was 100.08 million bags in 2009-10. Total world coffee production during
2010-11 was calculated at 133.63 million bags. Indian coffee exports in quantity terms were 297808
MT valued at Rs. 3343.33 crores in 2010-11. (See Table 4.16)
Economic Review 2011
74
4.41 India produces only 4.5 per cent of the worlds coffee but exports 70-80 per cent of its output.
Indias export of coffee during 2011-12 (up to 31st December 2011) was calculated at 247773 MT, the
value being Rs. 3423.23 crore. Italy, Russia and Germany are the top three buyers of Indian coffee.
TabIe4.16
Domestic Coffee Export from 2004-05 to 2011-12 (up to December, 2011)
Year Quantity
Tonnes
%change over
the previous year
VaIue
(Rs. crore)
%change over
the previous
year
1 2 3 4 5
2004-05 211765 -13.38 1224.67 5.72
2005-06 201555 17.58 1510.38 23.33
2006-07 248991 8.58 2007.6 32.92
2007-08 218852 -20.98 2044.71 1.85
2008-09 196762 -10.44 2238.41 9.47
2009-10 196002 51.35 2070.68 -7.49
2010-11 297808 26.41 3343.33 61.46
2011-12* 247773 -- 3423.23 --
Source: Coffee Board, [Link].
*Up to December 2011 (Provisional)
4.42 Exports of coffee through Cochin Port during 2010-11 registered a record increase of 175.47%.
Exports went up to 84,792 MT valued Rs. 689.20 crore. During 2009-10 it was 30,781 MT having a
value of Rs. 426.52 crore.
Tea
4.43 The general macro economic trends in the world market are not conducive to promotion of tea ex-
SRUW1HFHVVDULO\JOREDOWHDH[SRUWVKDYHEHHQIDOOLQJ$VDSHUVSHFWLYHRIZRUOGPDUNHWXFWXDWLRQVH[-
port of tea from India during 2010-11 decreased to 1789.27 lakh kgs from 2134.34 lakh kgs of 2009-10.
In value terms also export declined to Rs.2450.49 crore in 2010-11 from Rs.3038.69 crore in 2009-10, a
fall by 19.36%. Exports of tea from India through north Indian ports and south Indian Ports are given in
Table 4.17.
TabIe4.17
Export of Tea from North Indian and South Indian Ports
Year
North Indian Ports South Indian Ports AII India % Change
over the previ-
ous year
Quan-
tity
(Lakh
Kg)
VaIue
(Rs. Lakh)
Quan-
tity
(Lakh
Kg)
VaIue
(Rs. Lakh)
Quantity
(Lakh
Kg)
VaIue (Rs.
Lakh)
Quan-
tity
(Lakh
Kg)
VaIue
(Rs.
Lakh)
1 2 3 4 5 6 7 8 9
2007-08 1101.48 129117.69 751.74 59750.29 1853.22 188867.98 - -
2008-09 1063.04 156095.96 843.34 82083.37 1906.38 238179.33 2.87 26.11
2009-10 1225.88 200135.66 908.46 103733.22 2134.34 303868.88 11.96 27.58
2010-11 927.49 159541.29 861.78 85507.96 1789.27 245049.25 -16.17 -19.36
Source: Tea Board, [Link]
Kerala State Planning Board
75
Coir and Coir Products
4.44 Exports of coir & coir products from India in 2010-11 reached an all-time high of 3,21,016.02
MT valued at Rs. 807.07 crore. This recorded an increase of 9% in quantity and a marginal increase of
0.4% in value over that in the previous year. During 2009-10, exports of coir and coir products were to
the tune of 2,94,508.05 MT valued at Rs. 804.05 crore. Destinations of Indias exports of coir and coir
products are furnished in Appendix 4.11.
4.45 Exports of coir and coir products through Cochin port decreased to 131046 MT in 2010-11 from
1,76,105 MT of 2009-10. In the year under report, exports decreased by 25.58%. Export item com-
prised coir mat, coir yarn and other coir products. The trend of export of coir products through the
Cochin port for the period 2005-06 to 2010-11 is shown in the following graph (Fig 4.6).
Fig. 4.6
Trends of Coir and Coir Products from Cochin Port (Quantity in Tons)
(2005-06 to 2010-11)
Source: Cochin Port Trust
4.46 During 2010-11, as many as 111 countries imported coir and coir products. China became the
major importer of coir and coir products in terms of quantity, its share being 26.26%. The US contin-
ued to be a prime importer in terms of value with its share of 25.46%. The European Union countries
imported 29.97% in terms of quantity and 35.74% in terms of value
Spices
4.47 Spices exports from India registered and all-time, both in quantity and value, during 2010-11. A
total of 5,25,750 MT of spices and spices products valued Rs.6840.71 crore (US$1502.85 million) was
exported against 502750 MT valued Rs.5560.50 crore (US$1173.75 million) in 2009-10, an increase
of 5% in volume and 23% in rupee. In dollar terms the increase was 28%.
4.48 During 2010-11, a total quantity of 18,850 MT of pepper valued Rs.383.19 crore was exported
as against 19,750 MT valued Rs.313.93 crore in the previous year, an increase of 22% in value. Exports
of cardamom (small) during the same added up to 1175 MT having a value of Rs.132.16 crore. In the
year under review, chilli exports from India touched an all-time high in both volume (2,40,000 MT) and
value (Rs.1535.54 crore). Chilli exports also registered an increase of 18% in quantity and 19% in value.
4.49 Exports of ginger too showed a similar trend during 2010-11, marking a hike of 186% in volume
and 159% in value as compared to 2009-10. During the same period, export of spices oils and oleo-
Economic Review 2011
76
resins also increased to 7600 MT valued Rs. 910.62 crore from 6750 MT having value of Rs. 708.75
crore in the previous year. In 2010-11, India exported 15,250 MT of curry powder/paste valued Rs.
210.50 crore as against 14,300 MT valued Rs.189.19 crore of 2009-10.
4.50 The major markets of Indias spices exports are USA, UK, Canada, Italy, Japan, Germany, UAE,
Iran, Bangladesh and Malaysia. Item wise export of Spices from India is given in Appendix 4.12.
Spices Export from Kerala
4.51 Exports of spices through port in Kerala stood at 73,733.38 MT valued at Rs.1885.42 crore in
2010-11. When compared to the previous year, this showed an increase of 5.85% in quantity and
29.42% in value. Pepper, cardamom, chilli, ginger, turmeric, corriander, cumin, celery, fennel, garlic,
tamarind, vanila, curry power, spices oil, mint products, nutmeg and maces etc are the main items
exported through the ports of Kerala.
4.52 In the year under review Kerala exported 16,294.97 MT of pepper valued at Rs.330.61 crore as
against 16,840.65 MT valued at Rs.267.33 crore in the previous year. Keralas exports of pepper had
been declining since 2008-09. Even so, they represented more than 85% of Indias total exports of
pepper, both in quantity and value. In the year under review exports of cardamom fell by 18.5% and
chilli by 2%. While, ginger registered an increase, cumin decreased by 16%, fennal by 15% and fenu
greek by 6%. Exports of garlic, however, increased by 7%. So were the exports of spices oil & oleores-
ins (20%), turmeric (15 %) and coriander (4%) Item-wise export of spices through ports in Kerala from
2005-06 to 2010-11 are furnished in Appendix 4.13.
Kerala State Planning Board
Labour and Employment
C
H
A
P
T
E
R
80
Kerala State Planning Board
81
Generation of productive and gainful employment with decent working conditions is viewed as a
crucial strategy for Inclusive Growth (Planning Commission 2010). Indian labour market is character-
ised by complex situations which arise due to many reasons such as full time and part time workers,
variations in the availability of work during different seasons of a year, workers engaging themselves in
multiple jobs, workers ready to work at low wages, social and cultural factors restricting large number
of women workers to participate in the labour market etc.
5.2 Productive employment and Decent work are key elements to achieve a fair gloablisation and the
UHGXFWLRQRISRYHUW\7KH,/2KDVGHYHORSHGDQDJHQGDIRUWKHFRPPXQLW\RIZRUN3XWWLQJWKH'H-
cent Work Agenda into practice is achieved through four strategic pillars: job creation, rights at work,
social protection and social dialogue, with gender equality as a crosscutting objective.
0RUHDQGPRUHVHFWLRQVRIWKHZRUNLQJFODVVDUHEURXJKWLQWRWKH$PELWRI,/2VWDQGDUGV7KH
WK 6HVVLRQ RI ,QWHUQDWLRQDO /DERXU 2UJDQLVDWLRQ DW *HQHYD GHFLGHV WR EULQJ DQ HVWLPDWHG WR
PLOOLRQGRPHVWLFZRUNHUVZRUOGZLGHXQGHUWKHUHDOPRIODERXUVWDQGDUGV7KHQHZ,/2VWDQGDUGV
set out the domestic workers around the world who care for families and households, must have the
same basic labour rights as those available to other workers: reasonable hours of work, weekly rest
of at least 24 consecutive hours, a limit on in-kind payment, clear information on terms and conditions
of employment, as well as respect for fundamental principles and rights at work including freedom of
association and the right to collective bargaining.
5HFHQW,/2HVWLPDWHVEDVHGRQQDWLRQDOVXUYH\VRUFHQVXVHVRIFRXQWULHVSODFHWKHQXPEHU
of domestic workers at around 53 million. The fact is that this kind of work is often hidden and unreg-
istered; the total number of domestic workers could be as high as 100 million. Around 83 percent of
WKHVHZRUNHUVDUHZRPHQRUJLUOVDQGDPRQJWKHPPDQ\DUHPLJUDQWZRUNHUV7KH&RQYHQWLRQGHQHV
domestic work as work performed in or for a household or households.
7KHWK6HVVLRQRIWKH,QGLDQ/DERXU&RQIHUHQFH,/&ZDVKHOGRQ)HEUXDU\DW9LJ\DQ
%KDYDQ1HZ'HOKL7KHFRQIHUHQFHIRFXVHGRQWKUHHFULWLFDOLVVXHVYL]L0LQLPXPZDJHVLL6RFLDO
Security and (iii) Employability and Employment. The Key recommendations of 44th Session of Indian
Labour Conference is given in the box No. 5.1
Box No. 5.1
44th Session of Indian Labour Conference - Key Recommendations
0LQLPXP:DJHV$FW&RYHUDJHIRUDOO(PSOR\PHQW
5DLVLQJWKHZDJHFHLOLQJLQWKH(PSOR\HHV3URYLGHQW)XQG(QKDQFHPHQWRI
Pension, under Employees Pension Scheme 95, Portability of Provident Fund
Account, Reduction in the Requirement of Minimum continuous Service etc
Labour and Employment
Economic Review 2011
82
6WUHVVRQ0DWFKLQJWKH/DUJHVFDOH6NLOOLQJ7DUJHWVZLWKFUHDWLQJVLPLODUQXP-
ber of openings in the Area of Employment
0DWHUQLW\ /HDYH XQGHU 0DWHUQLW\ %HQHW$FW EH LQFUHDVHG IURP WKH SUHVHQW
level of 12 weeks to 24 weeks
5.6 The Government has given top priority to accelerate industrial growth and a major area that re-
TXLUHVXUJHQWDWWHQWLRQLVFRQLFWUHVROXWLRQLQWKHLQGXVWULDOODQGVFDSH0RUHLPSRUWDQWO\WKHHVWDE-
lished institutions are more concerned about the organised sector, and the entire gamut of unorgan-
ised labour is ignored.
5.7 The State has a work force of around 83 lakh of which 19 lakh are women workers. The vast
majority of the workforce in the unorganised or informal sector; sometimes in conditions of partial em-
ployment, often without adequate wages or Social security protection. The attention of Government
has been largely focused on protecting of workers in the organised sector.
5.8 Unemployment is one of the basic problems of the State. Government has to create new employ-
ment opportunities. Productive employment is being created in the States economy at very low rates.
Despite the relatively high skill and adaptability levels of the States workforce, labour market has not
been perceived as a positive factor by prospective investors in Kerala.
Box. No. 5.2
Labour sector probIems in KeraIa
7KHKLJKUDWHVRIXQHPSOR\PHQWDQGXQGHUHPSOR\PHQW
7KHORZUDWHVRISURGXFWLYHHPSOR\PHQWFUHDWLRQ
7KHXQSURWHFWHGFRQGLWLRQVLQWKHXQRUJDQLVHGVHFWRU
7KHSHUFHSWLRQRIDGYHUVHODERXUUHODWLRQV
7KHLQDGHTXDWHOHYHOVRIVNLOOFUHDWLRQDQGWUDLQLQJ
7KHLQHIFLHQWO\WDUJHWHG6RFLDO6HFXULW\SURJUDPPHV
5.9 The competitive market reform policies have turned some industries unviable. The forces of
globalisation, the dismantling of trade barriers, the new production paradigm in sunrise areas like
information technology and biotechnology, the practice of home working, intangible value addition
and other phenomena are making their presence felt in India also. The organised sector worldwide
is moving away from an employment security regime, towards an income security regime. The new
HQYLURQPHQWGHPDQGVDKLJKGHJUHHRIDGDSWDELOLW\DQGH[LELOLW\LQWKHODERXUPDUNHW
Social Security
3URYLGLQJVRFLDOVHFXULW\WRZRUNHUVLVDQLPSRUWDQWIXQFWLRQRI/DERXUSROLF\9DULRXVNLQGVRI
social security schemes are already in operation for workers in organised sector. But the unorganised
VHFWRUZRUNHUVODFNIDFLOLWLHVRIVXFKVFKHPHV5HFRJQL]LQJWKHQHHGWRDGGUHVVWKLVOLPLWDWLRQ*RY-
ernment has taken several initiatives to safeguard the interest of unorganised sector workers.
5.11 Kerala has made considerable progress in extending Social Security coverage through the mech-
anism of welfare fund boards. However, many of these schemes lack clear perspective, and need to
EHUHVWUXFWXUHG7KHLUGHOLYHU\PHFKDQLVPLVRIWHQLQHIFLHQWDQGH[SHQVLYH([WHQGLQJWKHFRYHUDJH
of the social security net to cover vulnerable workers in the unorganised sector is one of the major
priorities of the Government. New welfare schemes will be introduced for domestic workers, self em-
ployed workers in the service sector and other unprotected categories. These new schemes will be
LQWURGXFHGE\XWLOL]LQJH[LVWLQJDGPLQLVWUDWLYHVWUXFWXUHV7KHGHOLYHU\V\VWHPZLOOEHFRPSXWHUL]HGWR
IDFLOLWDWHHIFLHQWGLVEXUVHPHQWDQGVRFLDOVHFXULW\FDUGVZLOOEHLQWURGXFHGWRIDFLOLWDWHXQLYHUVDODF-
cess and to prevent leakage and malpractice.
5.12 The fund management of the welfare fund boards will be improved by deploying professional
expertise, keeping in view the twin objectives of fund security and income generation. An investment
SROLF\ ZRXOG EH IRUPXODWHG WR PD[LPL]H LQFRPH DQG FRQWURO RI H[SHQGLWXUH WKDW ZRXOG EH XQLIRUPO\
Kerala State Planning Board
83
DSSOLFDEOHWRDOO%RDUGV$FRPSUHKHQVLYHPHPEHUVKLSUHYHULFDWLRQGULYHZLOOEHFRQGXFWHGLQDOOWKH
welfare fund boards to identify and eliminate fraudulent registrations.
7KHQDQFLDOUHVRXUFHVRI*RYHUQPHQWDYDLODEOHWRVXSSRUWWKHVRFLDOVHUYLFHV\VWHPDUHOLPLWHG
*RYHUQPHQWZLOOHQGHDYRXUWRUHSULRULWL]HWKHDOORFDWLRQRIIXQGVWRHQVXUHWKDWYXOQHUDEOHZRUNHUVDQG
HVVHQWLDOVFKHPHVEHQHWWKHPRVW7KHZHOIDUHIXQGERDUGVZRXOGDOVRKDYHWREHVHOIVXVWDLQLQJ
drawing upon the resources of community and non governmental organisations.
Unorganised Workers Social Security Act, 2008
5.14 An important initiative to safeguard the interest of unorganised workers has been the enactment
of the Unorganised Workers Social Security Act, 2008. The Act provides for constitution of National
Social Security Board, which will recommend for formulation of social security schemes for unorgan-
ised workers. Accordingly, the National Board was constituted in 2009, and the Board has recom-
PHQGHG WKDW VRFLDO VHFXULW\ VFKHPHV YL] 5DVKWUL\D 6ZDVW\D %LPD<RMDQD 56%< SURYLGLQJ KHDOWK
insurance, Janasree Bima Yojana (JBY) providing death and disability cover and Indira Gandhi Na-
WLRQDO2OG$JH3HQVLRQ6FKHPH,*12$36SURYLGLQJROGDJHSHQVLRQPD\EHH[WHQGHGWR%XLOGLQJ
and other construction workers, MGNREGA workers, Asha workers, Anganwadi workers & helpers
etc. The National Social Security Fund for Unorganised Sector Workers with initial allocation of ` 1000
crore has been set up.
Plantation Sector
5.15 Kerala accounts for 71% of production of plantation crops in the country. About 14.5 lakh families
are dependent on plantation sector for livelihood. Excluding the marginal farmers the labour employed
in the plantation sector comes to about four and a half lakh, while the total number of factory workers in
the industrial sector is 4.51 lakh. Problems faced by plantation sector are mainly due to unremunera-
WLYHSULFHVIRUSURGXFWVDQGODFNRISURGXFWLYLW\,QFUHDVHGSURGXFWLYLW\FRXSOHGZLWKVFLHQWLFPDQDJH-
ment, technological innovations can only salvage the plantation sector from ruin.
Labour Welfare
5.16 Kerala is a model State for labour welfare measures. About 28 labour welfare fund boards are
IXQFWLRQLQJLQ.HUDODXQGHUGLIIHUHQWGHSDUWPHQWV2XWRIWKLVDUHXQGHUWKHFRQWURORI/DERXU'H-
partment. Major welfare measures provided by different labour welfare fund boards are the following.
0DWHUQLW\%HQHW
0DUULDJH%HQHW
0HGLFDO%HQHW
'HDWK5HOLHI
3HQVLRQ)DPLO\3HQVLRQ
6XSHUDQQXDWLRQ%HQHWV
$VVLVWDQFHIRU3HUPDQHQW'LVDELOLW\
(GXFDWLRQDO$VVLVWDQFH
+RXVH%XLOGLQJ$GYDQFHHWF
5.17 In Kerala, 30 lakh families have joined the scheme RSBY CHIS, out of which 11.79 lakh fami-
lies come under RSBY and the balance under CHIS. During 2011-12, ` 10.00 crore has been provided
in the State Budget for the scheme RSBY as 25% state share and ` 150.00 crore has been provided
for the scheme CHIS. Premium for a family during the year 2011-12 is ` 748.00. For the RSBY portion,
75% of the premium will be borne by Government of India. Balance premium and the administrative
expenses are met by the State Government. For CHIS, the entire premium of ` 748/- per family along
with administrative expenses is borne by the State Government. Apart from that there is expenditure
for CHIS PLUS scheme through additional free treatment upto ` 70000/- is being provided to the
56%<&+,6EHQHFLDULHVIRUWUHDWPHQWRIFDQFHUKHDUWGLVHDVHVDQGNLGQH\GLVHDVHV7KLVVFKHPHLV
being implemented through non insurance route and payments to the hospitals are being paid directly
Economic Review 2011
84
by CHIAK (Comprehensive Health Insurance Agency Kerala). Expenditure for this scheme is also be-
LQJPHWIURPWKHSURYLVLRQXQGHU&+,6DVWKLVIRUPVSDUWRI&+,67KHSK\VLFDODQGQDQFLDOGHWDLOVRI
RSBY/CHIS for the period 2008 2011 are given in the table 5.1
TabIe5.1
PhysicaI and FinanciaI Achievements of RSBY/CHIS
Year EW
W Private d W Private d
2008-2010 47858 94842 142700 18.09 27.76 45.85
2010-2011 143791 216437 360228 51.52 61.06 112.58
Total 191649 311279 502928 69.61 88.82 158.43
Source: CHIAK6
Child Labour
5,QWHUQDWLRQDO/DERXU2UJDQL]DWLRQHVWLPDWHVPLOOLRQFKLOGZRUNHUVDJHGDQGZHUHLQ-
YROYHG LQ FKLOG ODERXU RI ZKLFK PLOOLRQ ZHUH LQYROYHG LQ ZRUN WKDW E\ LWV QDWXUH LV KD]DUGRXV WR
their safety, physical or mental health and moral development. 8.4 million children were engaged in
VRFDOOHGXQFRQGLWLRQDOZRUVWIRUPVRIFKLOGODERXUWKHXVHRIFKLOGUHQLQDUPHGFRQLFWWUDIFNLQJ
in children and commercial sexual exploitation. The proportion of child labour varies from country to
country. 61% in Asia, 32% in Africa and 7% in Latin America, to 1% in US, Canada, Europe and other
wealthy nations in Asia. The proportion of child labour varies a lot among countries and region inside
those countries and region.
7KHJOREDOWRWDOLQFOXGHVPLOOLRQFKLOGUHQXQGHUHQJDJHGLQKD]DUGRXVZRUNVXFKDVKDQ-
dling chemicals, carrying heavy loads, and mining, quarrying or enduring long hours. Almost 70% of
child labour is in unpaid work within extended family networks. In the developing countries, about 60%
RIFKLOGZRUNHUVDUHHQJDJHGLQDJULFXOWXUHDQGVKHULHV
5.20 The rights of child domestic workers-who may contribute as much as 30% of global domestic
ODERXUPDUNHWKDYHEHHQDGGUHVVHGLQDQHZ,/2WUHDW\DSSURYHGLQ$ULJKWEDVHGDSSURDFK
WRFKLOGODERXUUHO\LQJRQODZVDQGWKHLUHQIRUFHPHQWLVDQHFHVVDU\EXWLQVXIFLHQWVROXWLRQWRFKLOG
ODERXU3URJUHVVWRZDUGVHGXFDWLRQIRUDOOLVWKHGHYHORSPHQWLQGLFDWRUPRVWFORVHO\OLQNHGZLWKFKLOG
labour. Unfortunately, the Millennium Development Goal (MDG) for primary school enrolment aims for
DWRWDORIRQO\YH\HDUVRIHGXFDWLRQIDUOHVVGHPDQGLQJWKDQLPSOLHGE\WKH0LQLPXP$JH&RQYHQ-
tion. The integration of child labour concerns into national development strategies, backed by effective
legislation, is therefore the preferred route to lasting solution.
5.21 The magnitude of child labour problem could be considerably reduced through rehabilitation
PHDVXUHV DQG HQDFWPHQW RI ODZV ,W PXVW EH UHFRJQL]HG DV D KXPDQ ULJKWV SUREOHP ERWK GLUHFWO\
(Eg:- Slavery) and indirectly (Eg:- Compulsory labour that results in denial of the right to education).
The National Policy of Child Labour enforces legal actions to protect the interests of children, makes
GHYHORSPHQWSURJUDPPHVIRUWKHEHQHWRIFKLOGODERXUDQGSURMHFWVEDVHGSODQRIDFWLRQLQWKHDUHDV
of high concentration of child labour. The need for awareness generation among the public has to be
highlighted. Currently the magnitude of child labour in India is estimated to be approx. 10 million.
5.22 In Kerala, special attention was paid to the Programme on eradication of child labour from the so-
FLHW\VXFKDVDVHQVLWL]DWLRQSURJUDPPHVWKURXJKUDGLRDQGGLVWULFWOHYHOVHPLQDUVE5HHQUROPHQW
of dropout students in to formal education. As a result of States intervention, the number of working
children has been decreased considerably (i.e. 76.6 %) from 111801 in 1971 to 26156 in 2001.
5.23 Decreasing tendency in the distribution of working children in Kerala during the last four Cen-
suses are shown in the table 5.2
Kerala State Planning Board
85
TabIe No. 5.2 No. of Working ChiIdren
^E z Et
1 1971 111801
2 1981 92854
3 1991 34800
4 2001 26156
Source: Census Reports
Welfare of Non Resident Keralites (NRKs)
.HUDODLVWKHUVWVWDWHLQ,QGLDWRVHWXSDVHSDUDWHGHSDUWPHQWIRUWKHZHOIDUHRI1RQ5HVLGHQW
Indians hailing from the State. Government of Kerala has launched the department of Non Resident
.HUDOLWHV$IIDLUV125.$RQWK'[Link]
125.$VWULYHVWRVROYHWKHJULHYDQFHVUDLVHGLQSHWLWLRQVIRUUHPHGLDODFWLRQVWKUHDWWRWKHOLYHVDQG
property of those who are left back at home, tracing of missing persons abroad, compensation from
sponsors, harassment from sponsors, cheating by recruiting agents, educational facilities for children
[Link]
125.$ 52276 WKH HOG DJHQF\ RI 125.$ 'HSDUWPHQW DFWV DV D FRXQVHO IRU WKH QRQ
[Link]\WRWKHPDQGWKHLUIDPLO\0DLQDFWLYLWLHVRI125.$
52276DUH
$WWHVWDWLRQRIHGXFDWLRQDOFHUWLFDWHVLVGRQHWKURXJKWKHWKUHH&HUWLFDWH$XWKHQWLFDWLRQ&HQWUHV
DQGFHUWLFDWHVKDYHEHHQDWWHVWHGDQGDQDPRXQWRI ` 16.00 crore collected as regis-
tration fees during the period under review.
[Link]-
come is below ` 25,000/-, for cases like marriage of children, medical assistance, death etc and
SHUVRQVZHUHEHQHWWHGLQWKHUHSRUWHGSHULRG
3UHGHSDUWXUH 2ULHQWDWLRQ 3URJUDPPHV ZHUH FRQGXFWHG LQ ORFDWLRQV WR LPSDUW PLQLPXP
awareness about the adopted country of employment, their culture and prevailing labour laws,
matters relating to visa stamping, immigration, baggage, customs clearance etc in which 800
FDQGLGDWHVEHQHWWHG,QWKHUHSRUWSHULRG,'&DUGVZHUHSULQWHG
,VVXDQFHRI15.,GHQWLW\&DUGIRUWKRVHVWD\LQJZRUNLQJDEURDGIRUWKHODVWVL[PRQWKVZLWKLQVXU-
ance coverage.
6NLOO8SJUDGDWLRQ3URJUDPPHVWRXSJUDGHWKHVNLOORI\[Link]-
lenges in the overseas employment market through 8 districts in Kerala
.$581$<$0IXQGIRUPHHWLQJWKHH[SHQGLWXUHLQFXUUHGRQUHSDWULDWLRQRIPRUWDOUHPDLQVRI
the NRKs who die abroad or those who die outside the State. Seven such cases were assisted
during the period under review.
$ZDUHQHVV FDPSDLJQV RQ SURPRWLQJ OHJDO RUGHUO\ DQG RUJDQLVHG PLJUDWLRQ DQG WR GLVFRXUDJH
illegal migration by making the people aware of the procedure involved in the emigration process.
125.$1(:6DQHZVOHWWHUWRSXEOLFL]HWKHYDULRXVLQLWLDWLYHVXQGHUWDNHQE\WKH125.$'H-
partment
[Link]\VLWXDWLRQVLQ/LE\DDQG<HPHQ
6HWWLQJXSRI125.$52276&HOOVLQ'LVWULFW&ROOHFWRUDWHV
KRXUKHOSOLQHIRULQIRUPDWLRQGLVVHPLQDWLRQDQGJULHYDQFHUHGUHVVDORIWKH15.V
-RE3RUWDO5HFUXLWPHQW
Industrial Relations
5.26 The main function of the Labour department is to maintain or improve the welfare of the working
people of Kerala, through enforcement of various labour laws, settlement of industrial disputes through
conciliation and administration of various welfare measures. All the activities of this department are
Economic Review 2011
86
focused on to ensure fair working and living conditions of the workers in the State and maintaining
cordial relationship between the employer and employee to develop a harmonious industrial economy.
5.27 During 2011, the Department had taken adequate steps to face the challenges of economic re-
cession and its impact on the production, producers and labourers. The Government has announced
a draft Labour Policy augmenting revival and development of industries to make Kerala an investor
friendly state. The highlights of Labour Policy are given in Box No.5.3
Box No. 5.3
Labour PoIicy HighIights
&UHDWLYHPHDVXUHVWRDWWUDFWSXEOLFDQGSULYDWHLQYHVWPHQW
ODNKQHZMREVLQWKHFRPLQJYH\HDUV
$XQLHGDQGFRQVROLGDWHGOHJLVODWLRQIRUVRFLDOVHFXULW\VFKHPHV
1HZVRFLDOVHFXULW\VFKHPHVIRUZRUNHUVLQWKHXQRUJDQLVHGVHFWRU
6RFLDO6HFXULW\&DUGVIRUZRUNHUV
8QLHGDQGEHQHFLDOPDQDJHPHQWRIIXQGVRI:HOIDUH%RDUGV
5HSULRULWLVDWLRQRIDOORFDWLRQRIIXQGVWREHQHWYXOQHUDEOHZRUNHUV
0RGHOHPSOR\HHHPSOR\HUUHODWLRQVKLSV
/RQJWHUPVHWWOHPHQWVEDVHGRQSURGXFWLYLW\
9LWDOLQGXVWULHVDQGHVWDEOLVKPHQWGHFODUHGDVSXEOLFXWLOLWLHV
6SHFLDOFRQFLOLDWLRQPHFKDQLVPIRUSURMHFWVZLWKLQYHVWPHQWVRICFURUHRUPRUH
,QGXVWULDOUHODWLRQVFRPPLWWHHLQPRUHVHFWRUV
(PSRZHUHGERG\RIH[SHUWVWRVXJJHVWUHTXLUHGFKDQJHVVRDVWRPDNH/DERXU/DZUHIRUPVLQ
tune with the times
5HIHUHQGDIRUUHFRJQLWLRQRIWUDGHXQLRQV
6WDWXWRU\DPHQGPHQWVIRUH[SHGLWLQJDQGVWUHDPOLQLQJWKHPHFKDQLVPRI/DERXU-XGLFLDU\
$PHQGPHQWVWR,QGXVWULDO'LVSXWHV$FWLQWXQHZLWKWKHWLPHV
(IFLHQWIXQFWLRQLQJRI/DERXU'HSDUWPHQW
0RUHODERXUVHFWRUVXQGHUPLQLPXP:DJHV$FW
&KLOGODERXUDFWWREHDJJUHVVLYHO\HQIRUFHG
0RGHUQPHGLFDOIDFLOLWLHVIRUZRUNHUV
5HKDELOLWDWLRQSDFNDJHVIRUGLVSODFHGZRUNHUV
5HVWUXFWXULQJLQIXQFWLRQLQJRIHPSOR\PHQWH[FKDQJHVFRPSXWHULVDWLRQDQGXSGDWLQJ
of data base
5HYDPSLQJRIFXUULFXOXPDQGFRXUVHFRQWHQWLQ,QGXVWULDOWUDLQLQJ
-RLQWFHOORIODERXUGHSDUWPHQWWRVWXG\FKDQJHVLQODZVDQGUXOHV
.HUDOD,QVWLWXWHRI/DERXU(PSOR\PHQWWREHXSJUDGHG
3ROLF\SURJUHVVPRQLWRULQJWHDPWRUHYLHZSURJUHVVRILPSOHPHQWDWLRQSROLF\
5.28 The Department has taken initiatives to ensure a better employer- employee relationship result-
LQJLQWKHSURJUHVVRIWKHLQGXVWU\$VDUHVXOWRIWKHLQWHUYHQWLRQE\WKHODERXURIFLDOVDQGVWDWXWRU\
committee a good labour relation have been evolved and rights of workers protected. The industrial
atmosphere is calm and the workers and Trade Unions have contributed their share in production.
During 2010-11 2357 industrial disputes were settled. The details of strikes, lockouts, layoffs and
industrial accidents are given in the Table No. 5.3
TabIe 5.3 Strikes ( Numbers)
Items 2006 2007 2008 2009 2010
30.09.2011)
Pending 0 1 0 4 3 3
Arose 6 2 22 18 12 11
Total 6 3 22 22 15 14
Man-day lost 86977 86746 394198 177494 173044 77038
Source: Labour Commissionerate
Kerala State Planning Board
87
TabIe5.4
Lockouts (Numbers)
Items 2006 2007 2008 2009 2010
30.09.2011)
Pending 23 27 4 8 10 13
Arose 6 0 5 13 10 7
Total 29 27 9 21 20 20
Man-day lost 1811755 1505370 758144 506606 741221 428698
Source: Labour Commissionerate
TabIe5.5
Layoffs (Numbers)
Items 2006 2007 2008 2009 2010
30.09.2011)
Pending 8 6 2 4 4 6
Arose 3 3 9 12 6 4
Total 11 9 11 16 10 10
Man-day lost 564669 533872 64316 41809 23820 31,240
Source: Labour Commissionerate
TabIe5.6
IndustriaI Accidents 2006-2010 ( Numbers)
2006 2007 2008 2009 2010 h
30.09.10)
Fatal 62 115 173 256 196 40
Non Fatal 355 524 964 830 730 36
Source: Labour Commissionerate
5.29 Kerala is acclaimed nationally for Social security and Welfare measures it has extended for the
past so many years. Almost 45 lakh of labour force in the State are protected under any one of the
social security schemes. During 2010-11 Government have spent ` 321.79 crore through different
:HOIDUH)XQG%RDUGVIRUEHQHWVRIYDULRXVQDWXUHLQFOXGLQJSHQVLRQ7KH*RYHUQPHQWKDVHQKDQFHG
WKHUDWHRIZHOIDUHSHQVLRQV.HUDODPLJKWEHWKHUVW6WDWHLQ,QGLDZKLFKKDVLQWURGXFHGDZHOIDUH
scheme for the migrant labourers ensuring their pay, welfare, health, educational aid etc to their fami-
lies through Kerala Building and other Construction Workers Welfare Fund Board with assistance of the
JRYHUQPHQW7KH'HSDUWPHQWLVDOVRRUJDQL]LQJDFDPSDLJQWRUHJLVWHUPLJUDQWZRUNHUVLQWKH6WDWH
5.30 There were no strikes or disputes in Coir/Fisheries/Handloom industry in Kerala in spite of the ba-
VLFSUREOHPVEHLQJXQDGGUHVVHG0HFKDQL]DWLRQLVWREHSURPRWHGLQWKHVHVHFWRUVZLWKFRRSHUDWLRQ
of labourers without affecting labour opportunities. Government has declared an income support
VFKHPHWRWKHVHVHFWRUVZKHUHSD\PHQWRIPLQLPXPZDJHVLVIRXQGGLIFXOW7KHVFKHPHLVWRJLYH
support to workers engaged in traditional sector activities who have an annual income of ` 25000/- or
less. Beedi workers, Khadi workers, Fish processors, Coir workers, Fishermen, Basket and mat work-
ers are some of the categories of workers included under this scheme during 2011-12. An income
support of not less than ` 1250/- per annum has been given to each such worker engaged in these
activities. The scheme will be in addition to the MGNREGS. A major joint welfare activity taken up by
the Central and State government is the implementation of an insurance scheme, Rastriya Swastya
%LPD<RMDQD56%<[Link]\FDOOHG
CHIAK. The scheme provides treatment assistance upto ` 30,000 from the empanelled hospitals in
the State. The Scheme Aam Admi Bima Yojana (AABY) is also implemented through Labour Depart-
Economic Review 2011
88
ment with the assistance of Central Government. The workers in the rural area holding 5 cents of land
or below is eligible to enrolee in the scheme and get insurance claims of ` 75000 and scholarship to
the students of 9th standard and above @` 100 per month. Another Insurance Schem called Compre-
hensive Health Insurance Scheme (CHIS) to the labourers who come above the poverty line is also
implemented through CHIAK. It is estimated that 35 lakh of labourers have got enrolled in the scheme.
Major achievements of labour department is detailed in the Box. No. 5.4.
Box No.5.4
Major achievements of Labour Department during 2010-11
,PSOHPHQWHG+HDOWK,QVXUDQFHWRERWK%3/DQG$3/[Link]&+,$.
,QWURGXFHG$$%<DVD6WDWH&[Link]
,PSOHPHQWHG8QRUJDQLVHGUHWLUHGZRUNHUVSHQVLRQVFKHPH
.HSWLQGXVWULDOSHDFHLQWXQHZLWKLQYHVWRUIULHQGO\SROLF\
3DLGNHHQDWWHQWLRQLQHQIRUFLQJODERXUODZV
7LPHO\DFWLRQWDNHQWRUHYLVHPLQLPXPZDJHVWRWKHVFKHGXOHGZRUNHUV
$FWLRQWDNHQWRVHWWOHWKHGLVSXWHVLQ,5&VDQGRWKHUVWDWXWRU\ERGLHV
$ZDUHQHVVFUHDWLRQDJDLQVWFKLOGODERXU
+HOSLQJ0LJUDQW:RUNHUVERWKQDQFLDOO\DQGPHGLFDOO\
0LJUDQW ZRUNHUV ZHOIDUH VFKHPH DQG .HUDOD *ROG :RUNHUV :HOIDUH )XQG %RDUG
were approved and started functioning
5.31 The industrial Disputes Arose, Handled, Settled etc in Kerala is given in the table. No. 5.7
TabIe No 5.7
IndustriaI Disputes Arose, handed, SettIed etc, in KeraIa during 2010-11
^
No
W 2005-06 2006-07 2007-08 2008-09 2009-10 2010-11
1 No. of disputes pending at the begin-
ning of the year
2658 2749 2904 2819 2770 2765
2 No. of disputes that arose during the
year
3405 3376 3482 3143 2352 2246
3 No. of disputes handled during the year 6063 6125 6386 5962 5122 5011
4 No. of disputes settled during the year
a By voluntary negotiation between par-
ties
374 341 484 831 626 423
b By conciliation 1124 1361 1644 1675 1008 905
c By withdrawal 1290 1066 795 426 497 366
d Referred for adjudication 526 453 644 260 226 136
e referred for Arbitration 0 0 0 0 0 5
f Total No. of disputes settled 3314 3221 3567 3192 2357 1935
5 No. of disputes pending at the end of
the year
2749 2904 2819 2770 2765 3176
6 No. of disputes led to
a Strike (including pending previously) 7 8 7 27 20 14
b Lockout (including pending previously) 29 29 23 15 21 20
7 No. of workers affected due
a strike 446144 25926 697 69114 14108 2165
Kerala State Planning Board
89
^
No
W 2005-06 2006-07 2007-08 2008-09 2009-10 2010-11
b Lockout 7301 7910 6410 5150 25239 4452
8 Man days lost
a strike 3224163 172177 23192 413037 186897 133098
b Lockout 1807511 1821036 1192022 833535 652891 504804
Source: Labour Commissionerate
Safety of Workers
5.32 The goal of all occupational safety and health programmes is to foster a safe work environment.
2+6$6LVDQLQWHUQDWLRQDOO\UHFRJQL]HGDVVHVVPHQWVSHFLFDWLRQIRURFFXSDWLRQDOKHDOWKDQG
safety management systems. The enforcement of laws & measures like the Factories Act and Rules
IRUDVVXULQJZRUNSODFHVHFXULW\DQGIRUWKHDEDWHPHQWRIRFFXSDWLRQDOKD]DUGVDQGGLVHDVHVZLOOEH
made more effective. Enforcement of Acts relating to industrial safety and prevention of pollution
would be strengthened.
5.33 Department of Factories and Boilers, under the Department of Labour is the statutory Authority to
ensure safety, health and welfare of workers in factories and the general public living in the vicinity of
factories through the implementation of various laws. The Department is in the pursuit of prevention of
industrial accidents and creation of an environment conducive to industrial hygiene as well as preven-
tion of occupational diseases by inspection and advisory services. During 2010- 2011, priority inspec-
WLRQDW0$+IDFWRULHVDLUPRQLWRULQJVWXGLHVLQKD]DUGRXVIDFWRULHVZRUNVKRSWUDLQLQJSURJUDPPHVIRU
ZRUNHUVDQGPDQDJHUVLQVSHFWLRQDWKD]DUGRXVIDFWRULHVE\VSHFLDOLVWLQVSHFWRUVPHGLFDOH[DPLQD-
tion of factory workers etc were the major activities of the Department. License Adalat was conducted
DV SDUW RI SXEOLF LQWHUDFWLRQ DQG DOVR UVW DLG WUDLQLQJ ZDV JLYHQ WR WKH SXEOLF 0DMRU SURJUDPPHV
conducted by the Department during 2009-10, 2010-11 and 2011-12 (upto 30.09-2011) are given in
the Table 5.8
TabIe5.8
Programmes conducted by Factories and BoiIers Department
^
No
Programmes 2009-10 2010-11
30.09.2011)
1 Priority inspection at MAH factories 37 41 61
2 $LU0RQLWRULQJVWXGLHVLQKD]DUGRXVIDFWRULHV 2 30 45
3 Workshop/training programmes for workers/managers 10 12 42
4 ,QVSHFWLRQDWKD]DUGRXVIDFWRULHVE\VSHFLDOLVWLQ-
spectors
8 10 15
Total 57 93 163
Source: Factories and Boilers Department
5.34 Medical Examination of factory workers has not been carried out by the Department during the
last three years. As per the Factories Act, the periodical medical examination of factory workers should
EHFRQGXFWHGE\WKHIDFWRU\0HGLFDO2IFHUV7KHGHSDUWPHQWDO0HGLFDO2IFHUVLQWHUYHQHLQWKHPDW-
WHUDV&HUWLI\LQJ6XUJHRQVZKHQGLVSXWHDULVHVZKHUHWKHUHDUHQRPHGLFDORIFHUVDYDLODEOH,QERWK
WKHFDVHVWKH0HGLFDO2IFHUVLQWHUYHQHVDVSHUWKHUHTXHVWIURPWKHLQGXVWULHVLQGXVWULDOZRUNHUV
A total of 6.40 lakh workers of 19081 establishments are coming under the control of various acts
enforced by the Department during 2011 (upto 30.09.2011). Table No.5.9 shows the number of Estab-
lishments and Workers coming under the purview of various Acts enforced by Factories and Boilers.
Economic Review 2011
90
TabIe No 5.9
EstabIishments and workers coming under the purview of various Acts enforced by
Factories and BoiIers
Year t
2007 18160 579348
2008 18131 497326
2009 18740 6,24,388
2010 19055 6,39,286
2011 (upto 30.09.2011) 19081 6,40,208
Source: Factories and Boilers Department
5.35 Recent Amendments in Labour Laws for promoting Equity and welfare are given in Box No. 5.4
Box No.5.5
Recent Amendments in Labour Laws
7KH3D\PHQWRI:DJHV$FWDPHQGHGWRHQKDQFHWKHZDJHFHLOLQJIRULWVDSSOLFDELOLW\,W
LVSUHVHQWO\[HGDW` 10,000/- per month
7KH3D\PHQWRI%RQXV$FWDPHQGHGWRHQKDQFHWKHHOLJLELOLW\OLPLWIURP` 3,500/- per
month to ` 10,000/- and calculation ceiling from ` 25,000 to ` 3,500/- per month while making
employees employed through contractors on building operations eligible for payment of bonus
under the Act
7KH$SSUHQWLFH$FWDPHQGHGLQWHUDOLDWRSURYLGHIRUUHVHUYDWLRQIRURWKHU%DFNZDUG
Classes
7KH0DWHUQLW\%HQHW$FWDPHQGHGWRHQKDQFHWKHPHGLFDOERQXVIURP` 250/- to `
2500/-and also empowering the Central Government to increase it from time to time before
HYHU\WKUHH\HDUVE\ZD\RIQRWLFDWLRQLQWKH2IFLDO*D]HWWHVXEMHFWWRDPD[LPXPRI5V
20,000/-
7KH(PSOR\HHV6WDWH,QVXUDQFH$FWDPHQGHGWRLPSURYHWKHTXDOLW\RIGHOLYHU\RIEHQ-
HWVXQGHUWKHVFKHPHDOVRWRHQDEOH(6,LQIUDVWUXFWXUHWREHXVHGWRSURYLGHKHDOWKFDUHWR
workers of the unorganised sector
7KH3D\PHQWRI*UDWXLW\$FWDPHQGHGIRUUDLVLQJWKHFHLOLQJRI*UDWXLW\IRUHPSOR\HHVLQ
the private sector to ` 10.00 lakh from ` 3.5 Lakh
7KH3ODQWDWLRQ/DERXU$FWDPHQGHGWRSURYLGHVDIHW\DQGRFFXSDWLRQDOKHDOWKFDUHWR
plantation workers
International Labour Migration
5.36 International labour migration has emerged as a major global issue that affects most of the na-
tions in the world and ranks high on the international, regional and national policy agendas. Migration
IRU HPSOR\PHQW LV YHU\ PXFK D SDUW RI WKH JOREDO DJHQGD RI WKH ,QWHUQDWLRQDO /DERXU 2UJDQLVDWLRQ
which is based on the vision of Decent work for all and expressed in its 2008 Declaration on Social
Justice for a Fair Globalisation.
5.37 According to the UN Department of Economic and Social Affairs, in 2010 there were 200 million
international migrant workers and their families. The majority of migrants live in the richer countries of
Europe and North America, including about 40 million in the US and 10 million in Germany. In Europe,
one in eight people of working age is a migrant; in North America this ratio is one in four. In most of the
*XOIFRXQWULHVXSWRRIWKHODERXUIRUFHLVOOHGZLWKPLJUDQWZRUNHUV7KHPDMRUODERXUH[SRUWLQJ
countries are Philippines, Indonesia, Sri Lanka, Nepal and Bengladesh. Even though the percentage
of the global population who migrate internationally is small (about 3 percent per year), the total num-
EHULVODUJHDQGLWKDVPRUHWKDQGRXEOHGVLQFH7KH81JXUHVVKRZWKHODUJHVWLQFUHDVHIRU
UHHFWLQJWKHEUHDNXSRIWKH8665LQWRDQXPEHURILQGHSHQGHQWFRXQWULHVZKLFKDGGHGDERXW
27 million people to the total international migrant stock.
Kerala State Planning Board
91
$FFRUGLQJWRWKH,/2*OREDO5HSRUWRQ'LVFULPLQDWLRQPLJUDQWZRUNHUVHQFRXQWHUGLVFULPL-
nation on a daily basis. The report says that while many of them are already at risk of all kinds of
DEXVHWKH\DOVREHFDPHWKHUVWYLFWLPVRIWKHQDQFLDODQGHFRQRPLFFULVLV,/22QOLQHUHSRUWVIURP
the Russian Federation which has been the biggest receiving, sending and transit country for migrant
workers in Eastern Europe and Central Asia since early 1990s.
Migration of Women
5.39 According to the United Nations Population Division (UNPD), global migration rates for women
have remained high since the 1960s. In developed regions, women migrants, estimated at 51.6 per-
cent of all migrants in 2010, outnumber their male counterparts. The average emigration rate of uni-
versity educated women is 17.6 percent, as compared to 13.1 percent for men, in spite of the fact that
women still face unequal access to university education in many less developed countries. The growth
rates form skilled women migrants are larger than the growth rates for either low skilled women or
skilled men for the vast majority of source regions.
Globalisation and Migration
5.40 Migration has occurred throughout history, and current trends certainly indicate that it will con-
tinue to increase in the future. While the forces of globalisation have created opportunities for greater
integration of labour markets, a complex web of national immigration laws and border controls has
restricted the mobility of people across borders. Yet growing disparities in wealth, incomes, human
security, human rights and demographic trends across the countries are all exerting upward pressure
Economic Review 2011
92
on migration. Every year, many millions of young men and women enter the labour force in develop-
ing countries where jobs are not created fast enough to absorb them. The impact of demographic
trends in the form of population decline and ageing is being felt most profoundly in advanced destina-
tion countries, where scarcities of labour are emerging in many sectors. The shrinking of labour force
in the countries has generated a demand for workers in many sectors of the economy, particularly in
VHUYLFHVZKLFKKDVEHHQPHWWRDVLJQLFDQWH[WHQWE\PLJUDQWV1HZWHFKQRORJLHVDOVRDOORZPRUH
people to acquire the information they need to access the global labour market.
Migration and economic growth
0LJUDQWVFRQWULEXWHWRHFRQRPLFJURZWKLQQXPHURXVZD\VE\OOLQJODERXUPDUNHWQHHGVLQKLJK
VNLOODQGORZVNLOOVHJPHQWVRIWKHPDUNHWUHMXYHQDWLQJWKHSRSXODWLRQLPSURYLQJODERXUPDUNHWHI-
ciency, promoting entrepreneurship, spurring urban renewal, and injecting dynamism and diversity into
destination countries and societies.
5.42 The World Bank has used a general equilibrium model to estimate overall economic gains to
the global economy through international migration. Assuming a modest increase in migration from
developing countries to high income countries (14.2 million workers, consisting of 4.5 million skilled
and balance low skilled), the share of migrants in the stock of workers in high income countries will
increase by 3 percent by the year 2025.
5.43 The current emphasis on migration and development projects a positive image of international
PLJUDWLRQ7KLVKDVUHVXOWHGLQJUHDWHULQWHUQDWLRQDOFRRSHUDWLRQWRPD[LPL]HWKHSRVLWLYHDVSHFWVDQG
PLQLPL]HWKHQHJDWLYHRQHV7KH,/2'LUHFWRU*HQHUDOKDVHPSKDVL]HGJDLQVIURPPLJUDWLRQDQG
protection of migrant rights are indeed inseparable. Migrant workers can make their best contribution
to host and source countries when they enjoy decent working conditions, and when their fundamental
human and labour rights are respected.
Migration in Kerala
$UHFHQWWUHQGLQWKHHPSOR\PHQWVHFWRULQWKH6WDWHLVWKHLQRZRILQWHUVWDWHPLJUDQWODERXUIURP
RWKHU6WDWHVOLNH:HVW%HQJDO%LKDU2ULVVD&KDWWLVJDUK-KDUNKDQGHWFEHVLGHVIURPWKHDGMDFHQW
States. Higher wages for unskilled labour in the State, large opportunities for employment and short-
age of local labour, paradoxically, despite the high unemployment rate in the State, led to massive
LQX[RIPLJUDQWODERXUWRWKH6WDWH7KHVHZRUNHUVDUHOHVVDGYDQWDJHGJURXSLQWKHODERXUPDUNHW
working for a subsistence living. Even though a comprehensive data on migrant labour is not available,
different micro studies indicated that the incidence of migrant labour is increasing in the State. Since
they are not engaged through a contractor or an intermediary, the legal protections envisaged under
the Interstate Migrant Workmen (Regulation of Employment and Conditions of Service) Act, 1979 are
alien to them in their employment. According to Census, 2001, among the districts, Ernakulam district,
UHFRUGHGWKHKLJKHVWLQRZRIPLJUDQWVIURPRWKHU6WDWHV7DEOH1R6KRZVWKHGLVWULEXWLRQRIPL-
grants from other States/ Union Territories in the districts of Kerala 5.10
TabIe No. 5.10
Distribution of Migrants from other States/ UTs in the districts of KeraIa
ED ^
Ernakulam 55977 13.56
Idukki 53056 12.85
Thiruvananthapuram 48575 11.77
Palakkad 47955 11.62
Kasaragod 31884 7.72
Kannur 28115 6.81
Kerala State Planning Board
93
ED ^
Thrissur 25358 6.14
.R]KLNRGH 23118 5.60
Malappuram 22092 5.35
Wayanad 18710 4.53
Kollam 16797 4.07
Kollam 16349 3.96
Pathanamthitta 13683 3.31
Aleppey 11180 2.71
Total 412849 100
Source : complied from Census of India 2001-D series
5.45 The migrant labourers get much higher monetary wages than in their native places and they work
for longer hours and their real wages may be lower. They live in shanty houses/rooms in slums like
localities often on a sharing basis. They have limited access to sanitation facilities and safe water and
the working and living conditions and habits make them suffer from a number of diseases. But their
access to public services like health and education is limited and they enjoy very limited protection
from labour laws. They also face problems of social integration in Kerala.
5.46 Though these workers are predominantly engaged in the construction, plywood and steel in-
dustries, their presence is noticeable in almost all employments including service sector in the State.
%HFDXVHRIWKHLUORZHUOHYHOVRIUHVHUYDWLRQZDJHVDQGWKH\GRQRWKDYHRUJDQL]DWLRQDQGXQLRQDQG
ODFNRIYRLFHUHFHQWO\WKHUHLVDQLQFUHDVLQJWHQGHQF\WRHPSOR\PLJUDQWODERXUHVSHFLDOO\LQWKHHOG
of constructions. Since measures had not been developed to improve the weak conditions of these
labour, Social Security, compensation in case of job loss, health problems etc, the State Government
KDYHHQYLVDJHGDVFKHPHFDOOHG,QWHU6WDWH0LJUDQW:RUNHUV:[Link]
%XLOGLQJDQG2WKHU&RQVWUXFWLRQV:RUNHUV:HOIDUH)XQG%RDUG
5.47 A pertinent issue here is the cause of migrant labour. Kerala hitherto known for outbound migra-
tion is faced with a new phenomenon called inbound migration which has been creating ripples not
only in the labour market but also has its impact on the social fabric of the society. Attack against
migrant workers in several parts of the State has been increasing. Two such recent instances of brutal
and senseless attack by locals on migrant labourers were reported from Kayamkulam and Ernakulam.
,QVWDQFHVOLNHWKHVHDUHQRZGLPHDGR]HQ6RPXFKVRWKHORFDOPHGLDQRZVWDUWHGWUHDWLQJVXFK
instances as `routine and not even treat as a new item worth carrying.
Kerala Institute of Labour and Employment (KILE)
5.48 Kerala Institute of Labour and Employment (KILE) is an autonomous institution functioning under
Ministry of Labour, Government of Kerala for conducting Training, Workshop, Seminar and Research
of labour and allied subjects. In addition, it is conducting memorial lecture series in the names of prom-
inent Trade Union leaders of Kerala, women development initiatives and special training programmes
for unorganised sectors and interstate migrant workmen in construction sector and industries in Ker-
DOD'XULQJWKH,QVWLWXWHKDVSXEOLVKHGWKH0DOD\DODPYHUVLRQRI/DERXU.HUDOD7KR]KLO
meghalayum Keralavum 2011 in the period under review. During the year 2011-12 the Institute has
FRQGXFWHGWKHWUDLQLQJSURJUDPPHVVHPLQDUVRQHZRUNVKRSRQH2ULHQWDWLRQSURJUDPPHDQG
published a book . It is also conducted two days residential seminar on Pottery Industry and problems
faced by Pottery workers, besides demonstration cum Exhibition for pottery workers named Kalimon
Mela 2011. The activities of KILE during 2010-11 are given in the Table No. 5.11
Economic Review 2011
94
TabIe No 5.11
Activities of KILE during 2010-11
^E Programmes E E
1 Training Programme 2 347
2 Workshop 1 100
3 Seminars 23 17
4 7DONV2WKHU3URJUDPPHV 3 93
Total 29 715
Source : KILE
5.49 As part of 100 days programme, KILE has conducted 22 awareness seminars for Interstate Mi-
JUDQW:RUNPHQDWYDULRXVSODFHV$ERXWLQWHUVWDWHPLJUDQWZRUNPHQGHULYHGEHQHWVIURPWKHVH
seminars.
Fire and Rescue Services
5.50 The primary function of the department is to save life and property of people. The Fire and Res-
cue Services Department has saved human lives, animal life and properties to the tune of `1358.00
FURUHGXULQJWKHODVWYH\HDUV7KHGHWDLOVDUHLQWKH7DEOH1R
TabIe No 5.12
The vaIue of properties and Iives saved by Fire and Rescue Services Department
Year
d-
&^-
E
E
2006-07 117.75 Crore 621 260
2007-08 132.56 ,, 762 328
2008-09 329.87 ,, 822 378
2009-10 382.94,, 928 391
2010-11 394.83,, 1053 428
Source : Fire and Rescue Services Department
5.51 In addition to the services, the Department earn revenue by way of standby duty charges, pump-
LQJFKDUJHVUHQWDOFKDUJHVRIDPEXODQFHVHUYLFHVIHHIRULVVXDQFHRI1R2EMHFWLRQ&HUWLFDWHWRKLJK
rise buildings, Industries, Petrol Bunks etc under various Acts and Rules like Explosive Acts, Arms and
Ammunition Rules, Kerala Municipalities Building Rules etc. The earnings of the Department for the
last three years are given in the Table No5.13
TabIe No. 5.13
Revenue earnings of the Department for the Iast three years
Year Z>
2008-09 325.16
2009-10 350.17
2010-11 518.34
Source : Fire and Rescue Services Department
5.52 Eight new Fire and Rescue Stations were opened during 2010 11 as detailed in the Table
No.5.14
Kerala State Planning Board
95
TabIe No.5.14
New Fire and Rescue Stations opened during 2010-11
^E &Z^
1 Kottarakkara Kollam
2 Iritty Kannur
3 Koduvally .R]KLNRGH
4 Mala Thrissur
5 Puthukadu Thrissur
6 Kuttikkol Kasaragod
7 Eloor Ernakulam
8 7HFKQRSDUN.D]KDNNXWWDP Thiruvananthapuram
Source : Fire and Rescue Services Department
Industrial Training Institutes
5.53 Industrial Training Department implements Craftsman Training Scheme through Government and
private ITIs and Apprenticeship Training Scheme through the RI Centres of the State. Industrial Train-
ing Institutes are rendering service by imparting Craftsman training to trainees to make them skilled
labour force. There are 118 Government ITIs ( 71 ITIs under Industrial Training Department, 44 ITIs
under Scheduled Caste Development Department and 3 ITIs under Scheduled Tribes Development
'HSDUWPHQWDQGRQH%DVLF7UDLQLQJ&HQWUH7ZR$976RQH6WDII7UDLQLQJ,QVWLWXWHDQG3ULYDWH
ITIs. The present sanctioned seat capacity of these ITIs is 75,218 approximately. The Apprenticeship
Training Scheme under Apprenticeship Act 1961 is implemented through 9 RI Centres and 5 ITIs (Total
14 Centres).
5.54 71 Industrial Training Institutes (including 15 new ITIs which began functioning in August 2010)
DQGD%DVLF7UDLQLQJ&HQWUHJLYLQJWUDLQLQJDVSHUWKH1&97V\OODEXVDUHIXQFWLRQLQJLQWKH6WDWH$
total of 16503 seats are available in these ITIs 30% of the seats are reserved for women candidates.
The new ITIs during 2010-11 is given in the Table No. 5.6.
Box No.5.6
New ITIs during 2010-11
,7,0DOD\DQNHH]KX 9. ITI Cheriyamundam
2. ITI Thevalakkara 10. ITI Maniyoor
3. ITI Ranni 11. ITI Thiruvampady
,7,$URRU9D\DODU ,7,9DGDNDUD
,7,9HQJRRU ,7,3HULQJRP9D\DNDUD
6. ITI Cherppu 14. ITI Seethmgoli
7. ITI Manaloor 15. ITI Maradu/Palluruty
8. ITI Kollengode
Advanced Vocational Training System (AVTS)
$976 LV WKH ,QVWLWXWH LQWHQGHG WR JLYH WUDLQLQJ WR WKH LQGXVWULDO ZRUNHUV WR XSGDWH WKHLU VNLOOV LQ
PRGHUQWHFKQRORJ\DQGPDFKLQHU\$[Link]\ZDVVWDUWHGGXULQJXQGHU81'3/2
Economic Review 2011
96
3URMHFWDQG$976DW7KLUXYDQDQWKDSXUDPZDVVWDUWHGGXULQJXQGHU:RUOG%DQN3URMHFWJLYLQJ
VKRUWWHUPWUDLQLQJLQ79WHFKQLFLDQDQG$XWR(OHFWULFLDQFRXUVHVKDYLQJWRZHHNVGXUDWLRQ
High Tech training Scheme
7KH+LJK7HFK,QVWLWXWHIXQFWLRQLQJDORQJZLWKWKH$GYDQFHG9RFDWLRQDO7UDLQLQJ6\VWHP$976
Kalamassery is an Institution started under World Bank Aided Skill Development Project during 2000.
Short term High-Tech Courses in the following areas are given
Auto CADD
PC maintenance
Industrial Automation
Analogs Digital Electronics
Placement Cell
3ODFHPHQW&HOOLVIXQFWLRQLQJLQDOO,7,V$QXPEHURIWUDLQHHVJHWSODFHPHQWLQYDULRXVUPV
through these cells. In addition to this regular Job Fairs are being arranged.
Finishing School
:LWKWKHREMHFWLYHRIVXSSOHPHQWLQJWKHVRIWVNLOOVDQGRWKHUGHFLHQF\RIWKH,7,SDVVHGRXWD
FKDLQRIHPSOR\PHQWDQGQLVKLQJVFKRROSURJUDPPHZDVGHYLVHGDQGLQWURGXFHGE\WKH,QGXVWULDO
Training Department. Initially 14 ITIs are selected for the implementation of this programme and this is
a state sponsored programme for which an amount of ` 00.00 lakh was provided in the budget 2010-
11. The training under the scheme is continuing.
Centres of Excellence
5.59 Government of India through DGE& T has introduced a Centrally Sponsored Scheme for Upgra-
dation of ITIs into Centres of Excellence in order to produce world class work force which can keep
pace with the technological demands of the industry. With this view, Government of India decided to
upgrade 500 ITIs in the country into Centres of Excellence in a phased manner at the rate of 100 ITIs
in a year. Government of India has upgraded 12 ITIs in Kerala into Centres of Excellence with World
Bank assistance (7 ITIs) and domestic funding (5 ITIs) and eight ITIs under the scheme of Upgradation
of 1396 government ITIs through Public Private Partnership.
Skill Development
5.60 Skill and knowledge is the driving force of economic growth and social development. Skill de-
velopment is a major focus in the programmes and policies of all developing nations. Productive skills
IRUP DQRWKHU FRPSRQHQW RI WKH SUHFLRXV KXPDQ UHVRXUFH WKDW WKDW PXVW EH IXOO\ XWLOL]H DV OHYHUDJH
for national development. A large reserve of unskilled people may be perceived as a problem, but a
large population of skilled workers is a huge asset. The Government is giving more importance to skill
development which has to be strengthened. More funds should be allocated to Industrial Training
Department for improving the infrastructure facilities of the institutions. New ITIs should be opened
during 2011-12, as the National Skill Development Mission aims at providing 500 million trained work
forces by 2022. The Government also proposes to strengthen the placement activities of ITI train-
ees by conducting Job Fairs and Skill Fest in different regions periodically. The department has also
planned to upgrade all existing ITIs into Centres of Excellence with the assistance of Government of
India and Public Private Partnership Mode
Kerala State Planning Board
97
Employment
5.61 After three years of continuous crisis conditions in global labour markets and against the pros-
pect of a further deterioration of economic activity, the world enters the year 2012 facing a serious
MREV FKDOOHQJH DQG ZLGHVSUHDG GHFHQW ZRUN GHFLWV ZLWK D EDFNORJ RI JOREDO XQHPSOR\PHQW RI
PLOOLRQDQLQFUHDVHRIPLOOLRQVLQFHWKHVWDUWRIWKHFULVLVVD\VWKH,/2LQWKHODWHVWHGLWLRQRILWV
annual publication, Global Employment Trends 2012; released on 24th January 2012. It is estimated
that more than 400 million new jobs will be needed over the next decade to avoid a further increase in
unemployment. Hence, to generate sustainable growth while maintaining social cohesion, the world
must rise to the urgent challenge of creating 600 million productive jobs over the next decade.
5.62 For the fourth consecutive year, global unemployment remained elevated in 2011, with more than
PLOOLRQXQHPSOR\HGDURXQGWKHZRUOGDJXUHXQFKDQJHGIURPWKH\HDUEHIRUHDQGVWLOOQHDUO\
million more than in 2007. The number of unemployed around the world increased by 5.8 million in
DQGWKHQDJDLQLQFUHDVHGE\PRUHWKDQPLOOLRQLQ$FFRUGLQJWRWKH,/2\RXWKDUHSDU-
ticularly hard hit by the crisis. In 2011, 74.7 million youth aged 1524 were unemployed, an increase of
PRUHWKDQPLOOLRQVLQFH7KHJOREDOXQHPSOR\PHQWJXUHVFDQEHVHHQLQ7DEOH
TabIe5.15
UnempIoyment in the WorId (miIIions)
Year D & d
(2+3)
z
(1) (2) (3) (4) (5) (6)
2000 101.80 73.60 175.40 73.40 102.00
2005 106.20 81.30 187.50 78.70 108.80
2006 103.10 76.90 180.00 75.50 104.50
2007 97.60 73.00 170.60 70.70 99.99
2008 101.40 75.00 176.40 71.60 104.80
2009 115.30 82.40 197.70 76.30 121.40
2010 113.20 84.10 197.30 75.80 121.50
2011* 113.50 83.70 197.20 74.70 122.50
* Preliminary Estimates Source: Global Employment Trends-2012, ILO
$VSHUWKHJXUHVUHOHDVHGE\WKH,/2JOREDOXQHPSOR\PHQWUHPDLQVVWXFNDWDUDWHRIDURXQG
6.0 per cent, despite rapid economic growth of 5.1 per cent in 2010 and 4 per cent in 2011. The un-
employment rate in South Asia is estimated to have been just 3.8 per cent in 2011, down from 3.9 per
cent a year before. Similar to other regions, the unemployment rate in South Asia is higher for youth
(9.9 per cent in 2011) and women (4.8 per cent). At the country level in South Asia, the unemployment
rate fell fastest in Sri Lanka in recent years, from 8.5 per cent in 2004 to 4.9 per cent in 2010. The
unemployment rate by sex, world and regions are given in Appendix 5.6.
,/2UHSRUWUHYHDOVWKDWWKHQXPEHURIZRUNHUVDURXQGWKHZRUOGFRQWLQXHVWRLQFUHDVHWKRXJKWKH
pace of increase has slowed in recent years. After an average increase in global employment of 52 mil-
lion workers each year over the four years from 2004 to 2007, job expansion decelerated sharply to an
average of only 33 million over the crisis years from 2008 to 2011. In 2008, it reached a record low of
only 14.2 million, which is the lowest level of global employment growth ever recorded (with estimates
available since 1991). The number of workers around the world grew by 38.1 million in 2009, the year in
which global economic growth contracted by 0.7 per cent. Despite the sharp upturn in global economic
growth in 2010, to a rate of 5.1 per cent, the number of employed around the world increased by only
37.5 million still well below the pre-crisis trend. While employment growth picked up somewhat in 2011,
thus far the world has failed to return employment generation to the levels achieved before the crisis.
Economic Review 2011
98
5.65 The Eleventh Plan (2007-12) of Govt. of India aims at generation of 58 million work opportunities in
twenty-one high growth sectors so that the unemployment rate falls to 4.83 per cent by the end of the Plan.
5.66 The overall impact of the economic slowdown is not considered to be acute in India as experi-
enced in most of the countries in recent years. However it had moderate impact on the Indian labour
PDUNHW/DERXU%XUHDXDQRUJDQL]DWLRQXQGHU0LQLVWU\RI/DERXUDQG(PSOR\PHQW*2,FRQGXFWHG
YHTXDUWHUO\VXUYH\VGXULQJ2FWREHUWR'HFHPEHUFRYHULQJFHUWDLQVHFWRUVWRDVVHVVWKH
impact of economic meltdown on job loss. The estimated employment in the selected sectors has
experienced a net addition of 12.8 lakh employment during the study period; which indicates that job
ORVVZDVPLQLPDO$GHWDLOHGVWXG\FRQGXFWHGE\99*LUL1DWLRQDO/DERXU,QVWLWXWH1RLGDLQIRU
WKH0LQLVWU\RI&RPPHUFH,QGXVWU\*2,LQWKLVUHJDUGLQGLFDWHGWKDWPRVWRIWKHMREORVVHVGXULQJWKH
HFRQRPLFVORZGRZQKDGWDNHQSODFHLQXQRUJDQL]HGVHFWRU,QWKHRUJDQL]HGVHFWRUWKHMREORVVZDV
minimal as indicated by the Labour Bureau study.
5.67 In Kerala from the decade of 1970s onwards there has been a rapid rise in the labour supply be-
cause of the increase in the number of women seeking wage employment. Though the supply of work
seekers increased, the demand for them did not increase. As a consequence there was an alarming
increase in unemployment rate from time to time.
5.68 The unemployment problem in Kerala is not only about educational unemployment of the general
category but also about unemployment of skilled, professional, semi-skilled, and unskilled workers.
7KLV LV WKH KLJKHVW LQ WKH FRXQWU\ 2QH LPSRUWDQW IHDWXUH RI .HUDOD (FRQRP\ LV WKH RXW PLJUDWLRQ RI
ODERXUIRUFHSDUWLFXODUO\WR*XOIUHJLRQDQGRZRIKXJHUHPLWWDQFHVLQWRWKH6WDWH+XJHRXWPLJUD-
tion is because of lack of employment opportunity within the State. However over the last one decade
Kerala has been witnessing large number of inmigration of labour force to Kerala from other parts of
the country.
5.69 Unemployment and under employment among workers in traditional sectors are indeed of major
FRQFHUQV2QHRIWKHPRVWLPSRUWDQWJURXSVRIVXFKZRUNHUVLVWKHWUDGLWLRQDODJULFXOWXUDOZRUNHUV$F-
cording to the 2001 Census, the number of agricultural workers in Kerala was around 16.20 lakh and
this is more than twice the number of cultivators (7.20 lakh) and more than four times the number in
the household industry (3.70 lakh). Close to three-fourth of workers in the household industry is in rural
areas and nearly half of them are female workers.
5.70 As the economy developed, the demand for unskilled and less skilled labour seems to have de-
FOLQHG2QWKHRWKHUKDQGWKHGHPDQGIRUVNLOOHGODERXURQDFFRXQWRIWHFKQRORJLFDOGHYHORSPHQWDQG
upgradation and changes in the organisation of work has begun to increase.
Employability and Skill Development
5.71 Skills and knowledge are the driving forces of economic growth and social development of any
country or region. As India moves progressively towards becoming a Knowledge Economy it becomes
increasingly important to focus on skill development to make it relevant in the emerging economic
development. The target group for skill development comprises all those in labour force including
WKRVHHQWHULQJWKHODERXUPDUNHWIRUWKHUVWWLPHWKRVHHPSOR\HGLQWKHRUJDQL]HGVHFWRUDQGWKRVH
ZRUNLQJLQWKHXQRUJDQL]HGVHFWRU$VNLOOHGDQGHGXFDWHGZRUNHUSURYLGHVKLJKHUOHYHORISURGXFWLY-
ity leading to higher employability, higher levels of earnings and income and thereby helping poverty
reduction in the country. It is with this perspective that India has initiated National Skill Development
Initiatives and set an overall target of creating 500 million skilled workers by 2022 to cater to the need
and productivity of the country and also for the reduction in the global market. A three tier institutional
structure consisting of Prime Ministers National Council on Skill Development, Skill Development Co-
ordination Board and National Skill Development Corporation has been set up to take forward the skill
development agenda.
Kerala State Planning Board
99
Box 5.7
Vision for SkiII DeveIopment in India
Against the various challenges, a National Skill Development Policy has been formulated
in February, 2009 which targets creating 500 million skilled people by 2022 with the fol-
lowing vision:
Skill development should harness inclusivity and reduce economic and social divi-
sions among Indian workforce particularly across rural-urban, male-female, orga-
QL]HGXQRUJDQL]HGDQGWUDGLWLRQDOFRQWHPSRUDU\
Matching the emerging demands for skills across various industries and economic
enterprises.
(YROYLQJ 1DWLRQDO 9RFDWLRQDO 4XDOLFDWLRQ )UDPHZRUN FRPSDUDEOH ZLWK LQWHUQD-
tional standards.
'HYHORSLQJVWDQGDUGFHUWLFDWLRQV\VWHPE\UHFRJQL]LQJDQGLQFOXGLQJTXDOLW\VNLOOV
acquired through any informal system of learning.
*UHDWHUDQGPRUHDFWLYHUROHIRUZRUNHUVRUJDQL]DWLRQVLQGXVWU\FLYLOVRFLHW\3DQ-
chayati Raj Institutions and other professional bodies.
Greater reduction of poverty through enhanced earnings of skilled workers
Employment Generation Programmes at the National Level
5.72 Government of India have been implementing several employment generation and poverty re-
duction programmes with a view to generate more employment and to address poverty. The important
among these are the National Rural Employment Guarantee Scheme (NREGS), SGSY, PMEGP and
SJSRY. The scheme NREGS have enhanced the livelihood of the rural population to a great extent.
During the year 2010-11, 5.57 crore households have been provided employment under the NREGS
DVDJDLQVWFURUHKRXVHKROGVLQ2IWKHWRWDOFURUHSHUVRQGD\VRIHPSOR\PHQW
generated in 2010-11, the percentage of participation on SC, ST and Women are 30.6%, 20.9% and
47.7% respectively.
Employment and Unemployment Survey conducted by NSSO
1DWLRQDO6DPSOH6XUYH\2UJDQLVDWLRQ1662LVFRQGXFWLQJKRXVHKROGVXUYH\VRQWKHVXEMHFWRI
Employment-Unemployment in India at periodic intervals with the aim of getting estimates on level of
parameters of various employment and unemployment characteristics at national and state level. The
results of the latest survey, eight in the series, conducted during the period July 2009- June 2010 as
SDUWRIWKURXQGRI1662VXUYH\SURJUDPPHZHUHUHOHDVHGRQ-XO\
(VWLPDWHVRQLQGLFDWRUVRIHPSOR\PHQWDQGXQHPSOR\PHQWDUHREWDLQHGE\WKH1662LQWKUHH
GLIIHUHQWDSSURDFKHVXVHGIRUFODVVLFDWLRQRIWKHDFWLYLW\VWDWXVHVRIWKHSHUVRQDVIROORZV
(i) number of persons usually unemployed based on usual status approach: which itself worked
out in two different methods one principal status (PS) method indicates the numerical mag-
nitude of the persons unemployed for a relatively longer period during a reference period of
365 days and the other Usual status (adjusted) or Usual status (ps+ss) method here the
number of unemployed is arrived at excluding those employed in a subsidiary capacity during
the reference period. The number arrived in second method will be lower than the former as
VRPHSHUVRQVFDWHJRUL]HGDVXQHPSOR\HGDFFRUGLQJWRWKHUVWPHWKRGPLJKWEHZRUNLQJLQD
subsidiary capacity and this persons are excluded in the second method)
(ii) number of persons unemployed on an average in a week, based on the current weekly status
(CWS) approach and
(iii) number of persons-days unemployed on an average, on a day during the reference period of
seven days preceding the date of survey, based on the current daily status (CDS) approach.
5.75 As per the survey conducted in 2009-10 the Unemployment Rate (UR) in India is estimated at
Economic Review 2011
100
6.6% in Current Daily Status (CDS) approach. Unemployment Rate was found to be higher in rural
areas than those in urban areas; it was 6.8 per cent in rural areas compared to 5.8% in urban areas.
Unemployment rate among rural female was 8% compared to 6.4% of rural male and urban female
Unemployment Rate was 9.1% compared to 5.1% for urban male.
(VWLPDWHVRQVRPHLPSRUWDQWLQGLFDWRUVUHHFWLQJWKHSUHYDOHQFHRIHPSOR\PHQWXQHPSOR\PHQW
in India based on the surveys conducted in 2004-05 and 2009-10 are given in Appendix 5.7. As per the
survey conducted in 2009-10 the Unemployment Rate in India is 6.6% in CDS approach as against 8.2%
based on the 2004-05 survey. In the rural areas, the Unemployment Rate among male was 8.0 per cent
asper the 2004-05 sample survey. This rate diminished to 6.4 per cent as per the 2009-10 sample sur-
[Link] in the urban areas, the unemployment rate among male decreased from 7.5 per cent to 5.1 per
FHQWGXULQJWKHYH\HDUSHULRG$PRQJUXUDOIHPDOHWKHXQHPSOR\PHQWUDWHGHFUHDVHGIURPSHUFHQW
to 8.0 per cent and among urban female, from 11.6 per cent to 9.1 per cent during the same period.
5.77 2009-10 survey reveals that among the Indian States, Kerala (16.7%) has highest Unemployment
Rate based on Current Daily Status approach; followed by Nagaland (15%). In Kerala UR among male
was 12.7% and that of female 25.9% based on CDS approach. In the rural area, the UR is estimated at
17.3% (male -12.9% and female -27.4); whereas in urban area it is estimated at 14.8% (male -12.1%
and female -21.3%). The unemployment rate according to Current Daily Status approach based on
2009-10 survey for each State/UT is given in the Appendix 5.8.
5.78 Some important indicators on employment/ unemployment in Kerala as per the surveys con-
ducted in 2004-05 and 2009-10 are given in Table 5.16 which shows that the number of unemployed
KDYLQJFRPHGRZQLQWKH6WDWHGXULQJWKHYH\HDUSHULRG7KH8QHPSOR\PHQW5DWHEDVHGRQ&'6
approach among male in rural area was 21.1 per cent in 2004-05. This rate diminished to 12.9 per
cent as per the 2009-10 sample survey. And in the urban areas, the unemployment rate among male
GHFUHDVHGIURPSHUFHQWWRSHUFHQWGXULQJWKHYH\HDUSHULRG$PRQJUXUDOIHPDOHWKH
unemployment rate decreased from 34.6 per cent to 27.4 per cent and among urban female, from 42.3
per cent to 21.3 per cent during the same period. This trend may be attributed to the poverty allevia-
tion and employment generation programmes like NREGS, vibrant functioning of the Kudumbasree
movement, and the stress given to traditional industries over the years.
TabIe5.16
Some important EmpIoyment and UnempIoyment Indicators (per 1000) - KeraIa
(Based on the surveys conducted in 2004-05 and 2009-10)
Age:All Ages
Z Urban
D & D
&
D & D
&
(1) (2) (3) (4) (5) (6) (7)
NSS 61st round (July 2004-June 2005)
usual principal status
LFPR 572 258 407 565 260 410
WPR 524 178 343 514 149 329
UR 83 309 158 90 429 199
usual status (ps+ss)
LFPR 589 321 448 583 301 440
WPR 559 256 400 547 200 371
UR 51 201 107 62 334 154
current weekly status
LFPR 568 285 420 560 260 408
Kerala State Planning Board
101
Z Urban
D & D
&
D & D
&
WPR 512 211 354 510 165 335
UR 98 260 156 91 365 180
current daily status
LFPR 548 246 390 544 240 390
WPR 432 161 290 450 139 292
UR 211 346 256 174 423 252
NSS 66th round (July 2009-June 2010)
usual principal status
LFPR 572 223 389 553 213 375
WPR 550 176 354 534 171 344
UR 38 210 90 34 198 83
usual status (ps+ss)
LFPR 583 260 414 564 233 391
WPR 564 218 383 547 194 363
UR 32 161 75 29 168 73
current weekly status
LFPR 566 238 394 555 218 379
WPR 539 191 357 526 179 344
UR 47 199 95 52 181 91
current daily status
LFPR 541 213 370 534 201 360
WPR 471 155 306 469 158 307
UR 129 274 173 121 213 148
Source: Compiled from the NSSO Reports 'Employment and Unemployment Situation in India 2004-
05' and 'Key Indicators of Employment and Unemployment in India 2009-10'
Economic Review 2011
102
/DERXU)RUFH3DUWLFLSDWLRQ5DWH/)35/)35LVGHQHGDVWKHQXPEHURISHUVRQVSHUVRQGD\VLQ
the labour force per 1000 persons/person-days
:RUNHU3RSXODWLRQ5DWLR:35:35LVGHQHGDVWKHQXPEHURISHUVRQVSHUVRQGD\VHPSOR\HG
per 1000 persons/person-days
8QHPSOR\PHQW5DWH8585LVGHQHGDVWKHQXPEHURISHUVRQVSHUVRQGD\VXQHPSOR\HGSHU
1000 persons/person-days in the labour force (which inclued both the employed and unemployed.)
Employment in the Organised Sector
5.79 The number of persons employed in the organised sector; which comprises public and private
sector in India as on March 2000 was 279.60 lakh. It declined to 264.59 lakh in March 2005 and
WKHUHDIWHULWVKRZVDSRVLWLYHWUHQG(PSOR\PHQWRIZRPHQLQWKHRUJDQL]HGVHFWRUDVRQ0DUFK
was 49.23 lakh constituting 17.6 per cent of the total organised sector employment in the country.
This number moderately increased to 50.16 lakh in March 2005 and again increased to 55.12 lakh
LQ0DUFKRIWKHRUJDQLVHGVHFWRUHPSOR\PHQW$URXQGWZRWKLUGVRIWKHWRWDORUJDQL]HG
sector employment in India is in the public sector. Analysis shows that the employment in the public
sector is decreasing over the years. The details of organised sector employment in India are given in
Appendix -5.9.
,[Link]\PHQWLQWKHRUJDQL]HGVHFWRULVGHFHOHUDWLQJRYHUWKH\HDUV7KHWRWDOQXP-
EHURISHUVRQVHPSOR\HGLQWKHRUJDQL]HGVHFWRULQDVRQ'HFZDVODNKSHUVRQV,WGH-
clined to 11.02 lakh persons in 2005 and then increased to 11.17 lakh in 2009. In 2010 it declined to
11.00 lakh; of which 4.92 lakh persons were in private sector and 6.08 lakh persons in public sector.
Details on employment in organised sector in Kerala are given in Appendix 5.10 and Figure 5.1.
Fig. 5.1
6.51
6.46
6.38
6.19
6.15
6.10 6.07 6.1 6.07
6.15
6.08
6.00
5.88
5.82
5.50
5.31
4.93
5.04
4.94
5.25
5.01
4.92
4
4.5
5
5.5
6
6.5
7
2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010
W
>
Year
K^- <
Public
Private
Source: Directorate of Employment, Govt. of Kerala, 2011
Kerala State Planning Board
103
Box 5.8
Women EmpIoyment in the State Govt.
The percentage of women employed in the State Government is lower as compared to the percent-
DJHRIPHQHPSOR\HG2IWKHWRWDOSHUVRQVHPSOR\HGLQWKH6WDWH*RYHUQPHQWDVRQVW0DUFK
2011 only 38.57 % are women.
Source: Directorate of Employment, Govt. of Kerala, 2011
2IWKHWRWDORUJDQL]HGVHFWRUHPSOR\PHQWRIODNKSHUVRQVDVRQVW'HFHPEHUWKH
share of women employees is 39.91%. The share of women in public sector in Kerala is about 31.3
percent; where as in the case of private sector it is 50.6% (See Table 5.17).
TabIe5.17
EmpIoyment in Organised Sector in KeraIa - PubIic & Private (as on December 2010)
W > %
Public Sector
Male 4.18 68.75
Female 1.90 31.25
Total 6.08 100.00
Private Sector
Male 2.43 49.39
Female 2.49 50.61
Total 4.92 100.00
Total
Male 6.61 60.09
Female 4.39 39.91
Total 11.00 100.00
Source: Directorate of Employment, Govt. of Kerala, 2011
5.82 The total employment in the public sector in Kerala as on 31st December 2000 was 6.51 lakh. It
declined to 6.09 lakh in 2005 and then increased to 6.15 lakh in 2009. However as on December 2010
it declined to 6.08 lakh; of which 0.60 lakh Central Government employees, 2.64 lakh State Govern-
ment employees, 2.58 lakh Quasi Government employees and 0.26 lakh Local Government Employ-
ees. The percentage distribution of employment in public sector is shown in the following graph. (Fig.
5.2)
Fig.5.2
Source: Directorate of Employment, Govt. of Kerala, 2011
Economic Review 2011
104
7KH EUDQFKZLVH DQDO\VLV VKRZV WKDW SHUVRQV HPSOR\HG LQ WKH &HQWUDO *RYHUQPHQW RIFHV LQ
Kerala are decreasing over the years. At the end of December 2000 there were 1.02 lakh central
Government employees in Kerala. This declined to 0.77 lakh in 2005 and declined further to 0.60 lakh
in 2010. Branch-wise details on employment in the Public Sector in Kerala for the last 10 years are
IXUQLVKHGLQWKH7DEOH$OO,QGLDJXUHVDUHJLYHQLQ7DEOH
TabIe5.18
EmpIoyment in PubIic Sector in KeraIa
(Lakh persons as on 31st December)
Year
Govt.
State
Govt.
Y' LSGIs d
(1) (2) (3) (4) (5) (6)
2000 1.02 2.93 2.31 0.25 6.51
2001 0.97 2.94 2.28 0.26 6.45
2002 0.83 2.89 2.39 0.27 6.38
2003 0.81 2.72 2.39 0.27 6.19
2004 0.78 2.80 2.31 0.26 6.15
2005 0.77 2.78 2.29 0.25 6.09
2006 0.77 2.77 2.27 0.26 6.07
2007 0.76 2.76 2.32 0.26 6.10
2008 0.63 2.66 2.51 0.27 6.07
2009 0.62 2.68 2.60 0.27 6.17
2010 0.60 2.64 2.58 0.26 6.08
2011 March 0.61 2.65 2.60 0.26 6.12
Source: Directorate of Employment, Govt. of Kerala, 2011
TabIe5.19
EmpIoyment in PubIic Sector - AII India (Lakh persons as on 31 March)
Year ' State Govt. Y' LSGIs d
(1) (2) (3) (4) (5) (6)
1991 34.11 71.12 62.22 23.13 190.58
1995 33.95 73.56 65.20 21.97 194.66
2000 32.73 74.60 63.26 22.55 193.14
2001 32.61 74.25 61.92 22.61 191.38
2002 31.95 73.84 60.20 21.75 187.73
2003 31.33 73.67 59.01 21.79 185.80
2004 30.27 72.22 58.22 21.26 181.97
2005 29.38 72.02 57.48 21.18 180.07
2006 28.60 73.00 59.09 21.18 181.88
2007 28.00 72.09 58.61 21.32 180.02
2008 27.39 71.71 57.96 19.68 176.74
Source: Economic survey 2010-11
Kerala State Planning Board
105
'LVWULFWZLVHHPSOR\PHQWLQRUJDQL][Link]$SSHQGL[$QG
WKH%UDQFKZLVHDQG'LVWULFWZLVHJXUHVRISXEOLFVHFWRUHPSOR\PHQWDVRQVW0DUFKDUHRXW-
lined in the Appendix 5.12. District-wise employment in public sector as on 31st March 2011 revealed
that out of the total 6.12 lakh employees, 1.40 lakh (22.9%) belongs to Thiruvananthapuram district, of
which 0.40 lakh are women. The lowest number of 16,002 public sector employees is in Idukki district,
of which 4176 persons are women.
6HFWRUZLVHHPSOR\PHQWLQRUJDQL]HGVHFWRUHVWDEOLVKPHQWVLQ.HUDODDVRQVW0DUFKLVJLYHQ
LQ7DEOHDQGWKHDOO,QGLDJXUHVDUHJLYHQLQ$SSHQGL[
TabIe5.20
EmpIoyment in Organised Sectors in KeraIa - PubIic and Private as on 31st March
(No. of persons)
^
No
/ 2006 2007 2008 2009 2010 2011
(1) (2) (3) (4) (5) (6) (7) (8)
1 Agriculture and allied
Industries
83203 81863 80080 79642 79769 75835
2 Mining and Quarrying 21138 2982 4243 4945 2666 5127
3 Manufacturing 213661 244796 255095 263135 254682 253532
4 Construction 27366 21162 21348 21509 21277 28235
5 Electricity, Gas. Water &
Sanitary Services
21490 25723 24270 27786 29317 22065
6 Trade, Restaurants &
Hotels
27452 31923 38121 37107 36635 36426
7 Transport, Storage &
Communication
101644 101060 102889 96335 92490 95717
8 Financing, Insurance,
Real Estate & Business
Services
82201 86901 86081 102140 102280 100632
9 Community, Social & Per-
sonal Services
523375 514570 505290 499357 492260 493749
Total 1101530 1110980 1117417 1131956 1111376 1111318
Source: Directorate of Employment, Govt. of Kerala, 2011
$QDO\VLVRIWKHVHFWRUZLVHGDWDRQHPSOR\PHQWLQRUJDQL][Link]
on March 2011 revealed that the highest employment is in the sector community, social and person-
QHOVHUYLFHVIROORZHGE\PDQXIDFWXULQJQDQFLQJDQGEXVLQHVVVHUYLFHV
Transport (8.61%), Agriculture (6.82%), Trade, Restaurants & Hotels (3.28%), Construction (2.54%),
Electricity, Gas, Water and Sanitary services (1.99%) and the lowest employment is in the mining and
Quarrying (0.46%).
Employment in the Unorganised Sector
,Q,QGLDDPDMRUFKXQNRIODERUIRUFHLVHPSOR\HGLQWKHXQRUJDQL]HGVHFWRUZKLFKDFFRXQWHG
QHDUO\RIWKHWRWDOHPSOR\PHQWDVSHUWKHVDPSOHVXUYH\FRQGXFWHGE\WKH1662LQ
2YHUWKH\HDUVRUJDQL]HGVHFWRUHPSOR\PHQWKDVJURZQVORZO\WKDQWKHWRWDOHPSOR\PHQWUHHFWLQJ
WKHIDVWHUJURZWKRIWKHHPSOR\PHQWLQWKHXQRUJDQL]HGVHFWRU7KHSDVWWUHQGVDQGDOOWKHDYDLODEOH
evidence suggest that the bulk of the growth in employment in future will come from the unorgansed
sector. As per the estimation of a Sub-committee of the National Commission for Enterprises in the
8QRUJDQL]HG6HFWRU1&(86LQ-XQHWKHFRQWULEXWLRQRIXQRUJDQL]HGVHFWRUWR*'3LVDERXW
7KXVXQRUJDQL]HGVHFWRUKDVDFUXFLDOUROHLQRXUHFRQRP\LQWHUPVRIHPSOR\PHQWDQGLWVFRQ-
tribution to the National Income.
Economic Review 2011
106
$FFRUGLQJ WR WKH ODWHVW VXUYH\ RQ HPSOR\PHQW DQG XQHPSOR\PHQW FDUULHG RXW E\ WKH 1662 LQ
the 66th round of NSS during July 2009 June 2010 it is estimated that the self employed workers in
India constituted 51.0% of the total workers. Whereas the percentage share of regular wage/salaried
employee accounted for 15.5% and that of casual labour 33.5%. In the case of Kerala the shares are
as follows: self-employed-38.4%, regular wage/salaried employee-23.2% and casual labour 38.4%.
%DVHGRQWKHVXUYH\FRQGXFWHGLQ1662SXEOLVKHGDUHSRUWLQ-DQXDU\YL],QIRU-
mal Sector and Conditions of Employment in India; which provides estimates of workforce in respect
of certain characteristics of the enterprise where the workers worked with reference to those engaged
in the informal sector. (Informal Sector in India is broadly charactarised as consisting of units engaged
in the production of goods and services with the primary objectives of generating employment and
incomes to the persons concern)
5.90 The report reveals that among self-employed workers in Kerala about 99 per cent in the rural ar-
eas and 97 per cent in urban areas reported to have worked in the informal sector. In the case of work-
ers in casual labour in other than public works about 82% in the rural areas and 86% in the urban areas
reported to have worked in the informal sector. Table 5.21 depicts proportion (Per 1000) of informal
sector (Proprietary & Partnership) workers among workers engaged in AGEGC (Agriculture excluding
growing of crops, market gardening, horticulture and growing of crops combined with farming of ani-
mals) and non-agriculture sectors for different statuses in employment in respect of Kerala and India.
TabIe5.21
Per 1000 distribution of informaI sector (P & P) workers among workers (ps+ss) engaged
in AGEGC and non-agricuIture sectors for different statuses in empIoyment - KeraIa and India
^
No
^
Z Urban Zh
D & D
&
D & D
&
D & D
&
A) Kerala
1 Self Employed 986 992 988 969 960 967 981 984 982
2 Regular wage/
salaried
employees
460 361 423 397 293 356 437 334 398
3 Casual labour
in other than
public work
862 642 817 893 672 857 870 649 828
All categories 809 662 765 759 560 703 793 633 746
B) India
1 Self Employed 922 960 935 949 967 953 935 962 942
2 Regular wage/
salaried em-
ployees
417 274 390 427 288 402 423 283 398
3 Casual labour
in other than
public work
748 697 740 760 623 737 751 674 739
All categories 742 744 742 685 616 673 715 698 711
Source: 'Informal Sector and Conditions of Employment in India' published by NSSO in January 2012 based on
2009-10 survey.
Kerala State Planning Board
107
Employment Generation Programmes implemented by the
Department of Employment and Training, Govt. of Kerala
a) KeraIa State SeIf EmpIoyment Scheme for Registered UnempIoyment (KESRU)
5.91 Self Employment Scheme known as KESRU has been implementing in the State since March
1999. Unemployed persons in the Live Register of Employment Exchanges, within the age group of
21 to 50 years having annual family income less than Rs. 40,000 and personal monthly income below
Rs. 500 are eligible for assistance under this scheme. Bank loan up to Rs. one lakh and a Government
subsidy of 20% of the loan amount is provided as assistance. An amount of Rs. 236.87 lakh was dis-
EXUVHGWREHQHFLDULHVLQDVVXEVLG\ZKHUHDVGXULQJWKH\HDUXSWR6HSWHPEHU5V
ODNKGLVEXUVHGWREHQHFLDULHV<HDUZLVHGHWDLOVDUHJLYHQLQ$SSHQGL[7DEOH
VKRZVWKHVXEVLG\DPRXQWGLVEXUVHGLQHDFK'LVWULFWGXULQJWKHQDQFLDO\HDU
TabIe5.22
District-wise Distribution of Subsidy Amount during the year 2010-11
^
No.
E
to 31.03.11
Z
(1) (2) (3) (4)
1 Thiruvananthapuram 45 6.94
2 Kollam 100 14.02
3 Pathanamthitta 48 6.40
4 $ODSSX]KD 56 8.82
5 Kottayam 71 11.52
6 Idukki 45 7.82
7 Ernakulam 38 5.73
8 Thrissur 50 8.33
9 Palakkad 40 6.09
10 Malappuram 124 22.00
11 .R]KLNRGH 24 3.69
12 Wayanad 15 1.75
13 Kannur 57 10.33
14 Kasargod 43 7.56
TotaI 756 121.00
Source: Directorate of Employment, Govt. of Kerala, 2011
b) Multipurpose Service Centres/Job Clubs
5.92 The scheme is intended for the establishment of Multipurpose Service Centres/Jobs Clubs formed
E\JURXSVRITXDOLHGDQGUHJLVWHUHGXQHPSOR\HGSHUVRQV7KHVFKHPHLVLPSOHPHQWHGWKURXJKWKH
(PSOR\PHQW([FKDQJHVLQWKH6WDWH7KH'LVWULFW(PSOR\PHQW2IFHUZLWKWKHKHOSRI(PSOR\PHQW2I-
FHUFRQFHUQHGZLOOVHOHFWFDQGLGDWHVIRUWKHVFKHPHIURPWKH/LYH5HJLVWHURI(PSOR\PHQW([FKDQJ-
HV DQG IRUP JURXSV RI FDQGLGDWHV ZKR KDYH JRW VDPH W\SH RI TXDOLFDWLRQ DIWHU DVFHUWDLQLQJ WKHLU
willingness. Thereafter entrepreneurial training is imparted to these groups. The maximum amount of
loan admissible to each group will be Rs. 10 lakh depending upon the nature of the project; of which
RIWKHSURMHFWFRVWZLOOKDYHWREHSDLGE\WKHJURXSPHPEHUVDVEHQHFLDU\FRQWULEXWLRQ
Economic Review 2011
108
of the loan amount subject to a maximum of Rs. 2.00 lakh will be given as subsidy. Altogether 65 job
clubs were granted a total subsidy of Rs. 94.78 lakh in 2010-11. (See Table 5.23)
Box 5.9
KeraIa State Entrepreneur DeveIopment Mission
'XULQJ*[Link]].HUDOD6WDWH(QWUHSUH-
neur Development Mission, aimed at providing self-employment to one lakh youths through 10,000
new ventures. It aims to launch 2,000 ventures every year and providing employment to 20,000
persons annually. Kerala Financial Corporation (KFC) is the nodal agency for the scheme.
Salient Features
7KHREMHFWLYHLVWREULQJLQJGRZQWKHOHYHORIXQHPSOR\PHQWDQGWREXLOGHQWUHSUHQHXUVKLSFXOWXUHDPRQJ
the youth of the State.
7KHVFKHPHLVSURSRVHGWREHLPSOHPHQWHGZLWKWKHSDUWLFLSDWLRQRI3XEOLF3ULYDWH6HFWRUVDQG3DQFKD\-
ats.
7KHSURVSHFWLYHHQWUHSUHQHXUVZLOOEHVHOHFWHGEDVHGRQWKHLUFDSDELOLW\DQGSURMHFWLGHDV
&DQGLGDWHVPLQLPXPTXDOLFDWLRQLVKLJKHUVHFRQGDU\YRFDWLRQDOWUDLQLQJ
2ULHQWDWLRQ SURJUDPPHV ZLOO EH RUJDQL]HG IRU WKH UHJLVWHUHG DSSOLFDQWV DW %ORFN 'LVWULFW 0XQLFLSDOLW\
Corporation levels to explain the features and eligibility criteria of the scheme.
7KHDSSOLFDQWVZLOOEHHYDOXDWHGRQWKHLUDSWLWXGHTXDOLFDWLRQVNLOOSURMHFWLGHDVSURMHFWIHDVLELOLW\DQG
available infrastructure facilities.
$IWHUVHOHFWLRQHQWUHSUHQHXUVKLSWUDLQLQJZLOOEHRUJDQL]HGLQEDWFKHVLQFROODERUDWLRQZLWKYDULRXVWUDLQLQJ
LQVWLWXWHVOLNH(QWUHSUHQHXUVKLS'HYHORSPHQW,QVWLWXWH.,7&256(7,VHWXSE\1$%$5'&HQWUHIRU
Management Development etc.
8SRQVXFFHVVIXOFRPSOHWLRQRIWUDLQLQJJURXSVLQGLYLGXDOVZRXOGEHHOLJLEOHIRUQDQFLDODVVLVWDQFHXQGHU
WKHVFKHPH7KHLQWHUHVWIUHHORDQDVVLVWDQFHWRDJURXSRIYHSHUVRQVZLOOEHOLPLWHGWRRIWKHWRWDO
project cost subject to the ceiling of Rs.20 lakh. The ceiling will be reduced for smaller groups on pro rata
basis.
7KHQDQFLDOEXUGHQRILQWHUHVWRQWKHORDQVZRXOGEHERUQHE\WKH*RYHUQPHQW7HFKQRFUDWVZKRDUH
QRWPHPEHUVRIJURXSVZLOOEHFRQVLGHUHGRQLQGLYLGXDOEDVLVIRUDPD[LPXPQDQFLDODVVLVWDQFHRI5V
lakh.
7KHORDQZLOOEHUHSD\DEOHLQDPD[LPXPSHULRGRI\HDUVZLWKWKHLQLWLDOPRUDWRULXPRIRQH\HDU
7KH*RYHUQPHQWZLOOEHDUWKHHQWLUHLQWHUHVWEXUGHQRQWKHORDQVSURYLGHGWRWKHVHOHFWHGDQGWUDLQHG
entrepreneurs under the mission who set up the units successfully.
)RUQDQFLQJWKHSULQFLSDODPRXQWVDVVLVWDQFHRIEDQNV1$%$5'DQGRWKHUQDQFLDOLQVWLWXWLRQVZLOOEH
WDNHQ*[Link])LQDQFLDO&RUSRUDWLRQIRUUDLVLQJIXQGVIURPQDQFLDO
institutions.
)RUWUDLQLQJRIWKHVHOHFWHGHQWUHSUHQHXUWKHIXQGVZRXOGEHPRELOL]HGIURPYDULRXVDJHQFLHVOLNH1$%-
ARD, National Skill Development Corporation, SC/ST Development Department, Labour Department and
other similar institutions. Balance amount will be provided by the Government.
TabIe5.23
Subsidy reIeased to MuItipurpose Service Centre/Job CIubs during 2010-11
(District wise Statistics)
^E
E:
^
Z>
(1) (2) (3) (4)
1 Thiruvananthapuram 4 6.31
2 Kollam 11 13.12
3 Pathanamthitta 1 1.63
4 $ODSSX]KD 2 1.02
5 Kottayam 7 9.54
Kerala State Planning Board
109
^E
E:
^
Z>
6 Idukki 2 1.07
7 Ernakulam 3 4.30
8 Thrissur 3 4.18
9 Palakkad 2 1.50
10 Malappuram 6 10.75
11 .R]KLNRGH 6 10.69
12 Wayanad 1 1.00
13 Kannur 6 9.74
14 Kasargod 11 19.93
Total 65 94.78
Source: Directorate of Employment, Govt. of Kerala, 2011
c) Saranya
5.93 This is a self employment scheme meant for uplifting the most backward and segregated women
in the State like widows, divorced deserted, spinsters and unwedded mothers belonging to the Sched-
uled Tribe Community. The women should be in the age group of 18 to 55 years and their annual family
LQFRPHVKRXOGQRWH[FHHG5V2QHODNK7KHEHQHFLDULHVZLOOEHJLYHQDORDQDPRXQWRI5V
ZLWKVXEVLG\VXEMHFWWRDPD[LPXPRI5V7KHEHQHFLDULHVRIWKLVVFKHPHVKRXOGKDYHD
valid registration in any of the employment Exchanges in the State of Kerala. They will not be consid-
ered for unemployment allowance or for temporary vacancies. However, they are eligible for full time
regular and part time regular vacancies.
Employment Exchanges and the Registered Job Seekers
5.94 In India, as on 31-10-2010, there are 969 Employment Exchanges which include 83 University
Employment Information and Guidance Bureau, 42 Special Employment Exchanges for Physically
Handicapped, 15 Professional and Executive Employment Exchanges and one Special Employment
Exchange for Plantation Labour. The main activities of the Employment Exchanges are placement of job
seekers, career counseling & vocational guidance and collection of employment market information.
5.95 As on December 2006, the number of employment seekers in the live register of employment
exchanges in all over India was 414.66 lakh. This declined to 399.74 lakh in December 2007 and again
declined to 391.12 lakh in December 2008. It further declined to 381.52 lakh in July 2009. However
LWVKRZVDPDUJLQDOLQFUHDVHDVRQ-XO\DVODNK2IWKHWRWDORIODNKMREVHHNHUV
258.21 lakh are men (66.8%) and 128.33 lakh women (33.2%). Year-wise all India registration, place-
PHQW YDFDQFLHV QRWLHG VXEPLVVLRQ PDGH DQG /LYH 5HJLVWHU IRU WKH SHULRG WR -XO\ DUH
given in Table 5.24.
Box No 5.10
SaIient features of Registration at the EmpIoyment Exchanges and PIacements in India
As on 31.12.2009, maximum number of job seekers (62.89 lakh) awaiting employment were
in West Bengal while minimum (0.08 lakh) were in Dadra & Nagar Haveli. This status remains
unchanged in 2010. As on 31.07.2010 maximum numbers of job seekers (64.50 lakh) were awaiting
employment in West Bengal while minimum 0.04 lakh were in Dadra & Nagar Haveli.
As on 31.12.2009, placement was highest at 1.53 lakh in Gujarat whereas registration was maximum
10.03 lakh in Tamil Nadu. Whereas on 31.07.2010 placement was maximum 0.95 lakh in Gujarat, and
registration was maximum 7.01 lakh in Tamil Nadu.
As on 31.12.2009, placement was 10.1% of total submission made by the employment Exchange. Whereas
on 31.07.2010, placement was 9.5 percent of total submission made by the Employment Exchanges.
As on 31.12.2009, 32.5% of the total job seekers were women. Whereas on 31.07.2010 31.5% of the
total job seekers were women.
Source: Annual Report 2010-11, Ministry of Labour & Employment, GOI
Economic Review 2011
110
TabIe5.24
DetaiIs on Year-wise Registration, PIacement and Live Register - AII India
(In Thousands)
Year Z W sE-
^
D
Live Register
(1) (2) (3) (4) (5) (6)
2002 5064.0 142.6 220.3 1748.8 41171.2
2003 5462.9 154.9 256.1 1917.3 41388.7
2004 5373.0 137.7 274.6 1801.4 40457.6
2005 5437.1 173.2 349.2 2402.0 39347.8
2006 7289.5 177.0 358.2 3029.5 41466.0
2007 5434.2 263.5 525.8 3666.1 39974.0
2008 5315.9 305.0 570.8 3344.0 39112.4
2009 5693.7 261.5 419.5 2589.3 38152.2
2010
(Upto July)
3353.6 139.9 283.2 1872.0 38653.8
Source: Ministry of Labour and Employment, Govt. of India
5.96 In Kerala, the Industrial Training Department and the Employment Department play comple-
mentary roles in providing employment to the unemployed registered labour force in the State. The
former undertake skill training to make the manpower marketable and the latter looks after the needs
of the work seekers. All categories of employment seekers above the age of 14 are allowed to reg-
ister in the Employment Exchanges. The Employment Service in Kerala has a network of 3 Profes-
VLRQDODQG([HFXWLYH(PSOR\PHQW([FKDQJHVDW7KLUXYDQDQWKDSXUDP(UQDNXODPDQG.R]KLNRGH
'LVWULFW(PSOR\PHQW([FKDQJHV2QH5XUDO(PSOR\PHQW([FKDQJH7RZQ(PSOR\PHQW([FKDQJ-
es, 6 Special Employment Exchanges for Physically Handicapped, 2 Coaching Cum Guidance Cen-
tres for SC/ST, 7 University Employment Information & Guidance Bureau and 6 Employment Informa-
tion and Assistance Bureau.
5.97 According to the Employment Directorate 43.42 lakh of employment seekers are there in the
Live Register of Employment Exchanges in Kerala as on 31.08.2011; of which 25.68 lakh (59.1%) are
female. The details of registered job seekers in Employment Exchanges are given in Table 5.25.
TabIe5.25
Registered job seekers in EmpIoyment Exchanges - KeraIa
(As on 31st August 2011)
^E E
(1) (2) (3)
1 Illiterate 98
2 Below SSLC 5,85,731
3 SSLC 27,29,937
4 Higher Secondary 7,18,196
5 Degree 2,60,831
6 Post Graduates 47,474
Total 43,42,267
Source: Directorate of Employment, Govt. of Kerala, 2011
Kerala State Planning Board
111
5.98 In Kerala, the total number of work seekers registered in the employment exchanges as on 31st
December 2001 was 44.31 lakh. It declined to 36.70 lakh in 2005 and thereafter the number has been
increasing every year. The number of job seekers increased to 41.44 lakh in 2008 and again increased
to 43 lakh in 2009. It rose slightly to 43.10 lakh in 2010 and now stood at 43.42 lakh as on August 2011.
The number of general work seekers increased from 34.93 lakh in 2005 to 41.54 lakh in 2009. It slightly
increased to 41.60 lakh in 2010 and again increased to 41.88 lakh as on August 2011. Whereas the
registered number of professional and technical work seekers declined from 1.77 lakh in 2005 to 1.46
lakh in 2009. But then it marginally increased to 1.50 lakh in 2010 and again increased to 1.55 lakh as
on August 2011. Details of work seekers both general and professional & technical from 2001 to 2011
are given in Appendix 5.15.
5.99 The number of work seekers below SSLC is on a declining trend. It declined from 9.67 lakh in
2001 to 6.29 lakh in 2005. It further declined to 5.94 lakh in 2010 and again declined to 5.86 lakh as
on August 2011. The total number of work seekers who possess SSLC and above are increased from
30.41 lakh in 2005 to to 37.16 lakh in 2010. It again increased to 37.56 lakh in 2011 (as on August
2011). The percentage of work seekers who possess below SSLC to the total work seekers is also
showing a decreasing trend. Whereas the percentage of work seekers who possess SSLC and above
is showing an increasing trend. The trend of work seekers in Kerala since 2001 is shown in Fig.5.3.
Fig: 5.3
Trends of Work seekers in KeraIa
Source: Directorate of Employment, Govt. of Kerala, 2011
Economic Review 2011
112
7KHQXPEHURI+6&TXDOLHGFDQGLGDWHVZKRKDYHUHJLVWHUHGDWWKHHPSOR\PHQWH[FKDQJHVLV
increased from 5.75 lakh in 2005 to 7.08 lakh in 2009. It increased to 7.18 lakh in 2010 and remains
XQFKDQJHGLQ,QWKHFDVHRIUHJLVWHUHGJUDGXDWHVDQGSRVWJUDGXDWHVWKHJXUHVVKRZWKDWQRW
VLJQLFDQWLQFUHDVHLVPDGHLQIURPWKHSUHYLRXV\HDU7KHGLVWULEXWLRQRIZRUNVHHNHUVDFFRUGLQJ
WROHYHORIHGXFDWLRQIRUWKHSHULRGIURPWRLVJLYHQLQ$SSHQGL[2IWKHWRWDOHPSOR\-
ment seekers as on Auguest 2011, 13.49 percent is below SSLC, 62.87 percent SSLC, 16.54 percent
HSC or equivalent, 6.01 percent graduates and 1.09 percent postgraduates. The percentage share of
work seekers in various levels of education is given in Table 5.26.
TabIe5.26
Percentage Share of EmpIoyment Seekers according to IeveI of Education-KeraIa
^E >
^W
2008 2009 2010 8/2011
(1) (2) (3) (4) (5) (6)
1 Below SSLC 15.00 14.50 13.78 13.49
2 SSLC 61.53 62.23 62.41 62.87
3 HSC or equivalent 16.54 16.46 16.65 16.54
4 Degree 5.66 5.57 6.05 6.01
5 Post Graduate 1.28 1.24 1.10 1.09
Total Work Seekers 100.00 100.00 100.00 100.00
Source: Directorate of Employment, Govt. of Kerala, 2011
5.101 The number of professional and technical work seekers as on Aug 2011 is 1.55 lakh. The
VKDUHRIHPSOR\PHQWVHHNHUVZLWKSURIHVVLRQDODQGWHFKQLFDOTXDOLFDWLRQVFDQEHVHHQLQ7DEOH
'DWD DV RQ$XJXVW VKRZV WKDW ,7, FHUWLFDWH KROGHUV DQG 'LSORPD KROGHUV WRJHWKHU FRQVWLWXWH
92.6% of the total professional and technical work seekers.
TabIe5.27
Percentage Share of ProfessionaI and TechnicaI work seekers in KeraIa
^E
Y
^W
2008 2009 2010 8/2011
(1) (2) (3) (4) (5) (6)
1 Medical Graduates 1.55 1.66 1.38 1.43
2 Engineering Graduates 5.54 6.49 5.41 5.39
3 Diploma holders in Engineering 22.21 24.80 23.37 23.12
4 ,7,&HUWLFDWHKROGHUV 69.85 66.25 69.30 69.51
5 Agricultural Graduates 0.46 0.40 0.27 0.27
6 9HWHULQDU\*UDGXDWHV 0.40 0.41 0.27 0.27
Total 100.00 100.00 100.00 100.00
Source: Directorate of Employment, Govt. of Kerala, 2011
5.102 The number of job seekers with engineering degree in 2006 was 8466. It declined to 7941 in
EXWVKRZVDVLJQLFDQWLQFUHDVHLQWKHQH[W\HDUDV+RZHYHUWKHQXPEHUGHFOLQHGWR
in 2010; but the trend again reversed and increased to 8341 in August 2011. Engineering diploma
holders who had registered their names in employment exchanges increased from 35,164 in 2010
Kerala State Planning Board
113
WRLQ,QWKHFDVHRI,7,17&&HUWLFDWHKROGHUVWKHUHLVDQLQFUHDVHRISHUVRQVLQ
the year 2011. The number of medical graduates who had registered their names in the employment
exchanges increased from 2070 in 2010 to 2211 in 2011. The number of veterinary graduate work
seekers has also increased from 411 in 2010 to 419 in 2011. Agricultural graduates who had registered
at the employment exchanges increased from 411 in 2010 to 419 in 2011. Data on professional and
technical work seekers for the period from 2001 to 2011 are given in Appendix 5.17.
5.103 Women outnumber men seeking employment through employment exchanges. This position
LVUHHFWHGLQDOOWKHGLVWULFWVRI.HUDOD2XWRIWKHWRWDOQXPEHURIODNKZRUNVHHNHUVDVRQ
March 2011, women number 25.12 lakh (59.18%). The district-wise unemployment of women and men
in 14 districts of Kerala as on 31.03.2011 is shown in the following graph (Fig.5.4).
Fig 5.4
Source: Directorate of Employment, Govt. of Kerala, 2011
7KLUXYDQDQWKDSXUDP 'LVWULFW UDQNV UVW LQ WKH QXPEHU RI ZRUN VHHNHUV LQ ERWK JHQHUDO DQG
professional categories as on 31.3.2011. The total number of work seekers in Thiruvananthapuram
district is 6.26 lakh of which 3.81 lakh are women and 2.44 lakh men. The second largest number of
ZRUNVHHNHUVLVIURP$ODSSX]KDGLVWULFW7KHUHDUHODNKMREVHHNHUVLQ$ODSSX]KD'LVWULFWDVRQ
March 2011, out of which 2.39 lakh are women and 1.83 lakh men. The lowest number of work seekers
is in Wayanad district preceded by Kasargod District. In Wayanad, there are 0.94 lakh work seekers,
whereas in Kasargod the number is 1.05 lakh as on March 2011. Details of district-wise distribution of
work seekers are given in Appendix 5.18.
Placement through Employment Exchanges in Kerala
7KH JXUHV IXUQLVKHG E\ WKH 'LUHFWRU RI (PSOR\PHQW 7UDLQLQJ VKRZ WKDW WRWDO SODFHPHQW
through Employment Exchanges in Kerala is declining since 2008. Total placement declined from
18,099 in 2008 to 15,612 in 2009 and further declined to 12,643 in June 2010, which shows 30% re-
duction in a span of two years. The placement through employment exchanges in Kerala since 2000
is illustrated through following graph Fig.5.5.
Economic Review 2011
114
Fig. 5.5
PIacement through EmpIoyment Exchanges -KeraIa
Source: Directorate of Employment, Govt. of Kerala, 2011
Unemployment Allowance Scheme (UAS)
5.106 Unemployment Allowance Scheme, started in 1982, is an important social security scheme
implemented by Government of Kerala with the aim of providing a monthly allowance of Rs. 120 to
WKHUHJLVWHUHGXQHPSOR\HHV&RQVHTXHQWWRWKHGHFHQWUDOL]DWLRQRISRZHUVLQLWLDWHGE\*[Link]
in accordance with 73rd and 74th constitutional amendments this scheme was transferred to Grama
Panchayats in rural areas and Municipalities/Corporations in urban areas with effect from 1998. The
EHQHFLDULHVVKRXOGEHDERYHWKHDJHRIDQGKDYHDVHQLRULW\RI\HDUVRIFRQWLQXRXVUHJLVWUDWLRQ
in any of the Employment Exchanges in the State. The upper age limit is 35 years and educational
TXDOLFDWLRQLVDSDVVLQ66/&IRUJHQHUDOFDQGLGDWHVDQGUHJXODUVFKRROLQJXSWR66/&IRU6&67
candidates. Physically handicapped candidates need only a seniority of two years of continuous reg-
istration. As per the revised norms, an eligible candidate can submit his application to the concerned
/RFDO6HOI*RYW,QVWLWXWLRQ$QDPRXQWRI5VODNKKDVEHHQGLVEXUVHGWRODNKEHQHFLD-
ULHVLQZKHUHDVGXULQJWKHUVWQLQHPRQWKVRIWKH\HDU5VODNKGLVEXUVHGWR
ODNKEHQHFLDULHV7KHGHWDLOVPD\EHVHHQDW$SSHQGL[
Placement through ODEPC
2YHUVHDV'HYHORSPHQWDQG(PSOR\PHQW3URPRWLRQ&RQVXOWDQWV/LPLWHG2'(3&ZDVHV-
WDEOLVKHGLQIRUUHFUXLWLQJFDQGLGDWHVWRIRUHLJQFRXQWULHV7KHDXWKRUL]HGVKDUHFDSLWDORI2'(3&
/LPLWHGLV5V2QHFURUHDQGSDLGXSFDSLWDOLV5VODNK,QDWUDYHOGLYLVLRQZLWKDFFUHGLWD-
tion from the International Air Transport Association (IATA) was established with Government approval.
2'(3&KDVDOVRLQWURGXFHGWLFNHWLQJIDFLOLWLHVIRUORZIDUHDLUOLQHV7KLVZDVLQLWLDWHGLQYLHZRIWKHIDFW
WKDWVDOHRIDLUWLFNHWVKDVLQFUHDVHGFRQVLGHUDEO\RYHUWKH\HDUV1RZ2'(3&KDVGHFLGHGWRVHWXS
D'RPHVWLF5HFUXLWPHQWZLQJWRXWLOL]HWKHMRERSSRUWXQLWLHVDYDLODEOHLQ,QGLDHVSHFLDOO\LQWKH,7HOG
Kerala State Planning Board
115
2'(3& LV WKH RQO\ UHFUXLWLQJ DJHQF\ LQ WKH *RYHUQPHQW 6HFWRU IRU 'HYHORSPHQW RI ,QGLDQ
PDQSRZHU WR IRUHLJQ FRXQWULHV &DWHJRU\ZLVH GHSOR\PHQW RI SHUVRQQHO E\ 2'(3& GXULQJ WKH UVW
VHYHQPRQWKVRIWKHQDQFLDO\HDULVJLYHQLQ7DEOH
TabIe-5.28
Category-wise depIoyment of PersonneI by ODEPC Ltd -
(as on 31.10.2011)
E
Nurse 44
Teacher 8
Doctor 7
Driver 4
Engineer 4
Sales Executive 5
Administration Staff 2
Total 74
Source: OEPEC, 2011
1XPEHURIFDQGLGDWHVUHFUXLWHGWRIRUHLJQFRXQWULHVWKURXJK2'(3&KDVGHFOLQHGIURPLQ
2008-09 (up to 30-11-2009) to 228 in 2009-10. It further declined to 74 during 2011 (up to 31-10-2011).
As in the previous years, during 2010-11 also the highest number of recruitment was in the category
RI1XUVHSHUVRQV$VSHUWKHVWDWLVWLFVJLYHQE\2'(3(&WKHKLJKHVWGHSOR\PHQWZDVWR6DXGL
$UDELDIROORZHGE\4DWDU8$(DQG6XOWDQDWHRI2PDQ
Migration
0LJUDWLRQ KDV EHHQ D VLJQLFDQW IDFWRU LQ KHOSLQJ UHGXFH SRYHUW\ XQHPSOR\PHQW DQG UHODWLYH
deprivation in Kerala. For over three decades there has been steady migration from the State of Kerala
to countries in the Gulf and different parts of India and the world. It is estimated that today over 10%
of the population of Kerala lives outside the State, in various parts of India and abroad particularly in
the Gulf region, the US and Europe.
5.111 According to the latest study Kerala Migration Survey 2011 conducted by [Link] and
[Link] Rajan of the Centre for Development Studies, Thiruvananthapuram, 22.8 lakh Kerala
emigrants are living abroad in 2011. The number of Kerala migrants living in other States of India in
2011 is estimated at 9.31 lakh.
Box 5.11
HighIights of the study 'Kera Ia Migration Survey 2011' undertaken by
Centre for DeveIopment of Studies, Thiruvananthapuram
7KHVWXG\LVWKHIWKLQWKHVHULHVRIFRPSUHKHQVLYHVWXGLHVRQLQWHUQDWLRQDODQGLQWHUQDOPLJUD-
tion from Kerala since 1998 and it is based on primary data collected from 15,000 households selected
DWUDQGRPE\DVWUDWLHGPXOWLVWDJHUDQGRPVDPSOLQJWHFKQLTXHFRYHULQJDOOWKHWDOXNVLQWKHVWDWH
External Migration
It is estimated that the number of Kerala emigrants living abroad in 2011 is 2.28 mil lion, up
from 2.19 million in 2008, 1.84 million in 2003 and 1.36 million in 1998.
The number of Kerala emigrants who returned and living in Kerala in 2011 is estimated to be
1.15 million. It was 1.16 million in 2008, 0.89 million in 2003 and 0.74 in 1998.
on-Resident Keralites (EMI+REM) numbered 3.43 million in 2011, 3.35 million in 2008, 2.73 mil-
lion in 2003 and 2.10 million in 1998.
Economic Review 2011
116
2QO\[Link]\SHU
cent had an NRK. The vast majority of the households nearly 82 per cent did not have an
emigrant member. Nearly three-fourths had neither an emigrant nor a return emigrant.
The vast majority of the emigrants from Kerala in 2011 were Muslims (about 45 per cent), al-
though their share in the total population was only about 26 per cent. They retained their lead
WKURXJKDOOWKHVH\HDUV2QWKHRWKHUKDQGWKH+LQGXHPLJUDQWVZHUHRQO\SHUFHQWRIWKH
total, although their share in the total population is about 56 per cent. However, over the years,
the Hindus have improved their share, from 29.5 per cent in 1998 to 37.5 per cent in 2011. The
gain among the Hindus was mostly at the expense of the Christians whose share shrank from
25.1 in 2003 to 17.9 by 2011.
The largest number of emigrants originated from Malappuram district, a position it retained from
the beginning. However, its share has shrunk somewhat in recent years, from 21.8 per cent in
1998 to 17.9 per cent in 2011.
The principal countries of destination of Kerala emigrants have remained more or less un-
changed over these years, with 90 per cent of the Kerala emigrants going to one or other of the
Gulf countries. Within the Gulf region, the UAE retained its number one rank, with Saudi Arabia
coming in the second position. Nearly 40 per cent of Keralas emigrants live in the UAE and
25 per cent in Saudi Arabia. In the last 3 years, especially, after global crisis, Saudi Arabia has
gained about 2 percentage points and UAE has lost out by the same proportion.
Internal Migration
[Link],QGLD20,LQLVHVWLPDWHGWREH
ODNKXSIURPODNKLQ,QWKHQXPEHURI20,ZDVKLJKHULHODNK
though in 1998, however, it was only 6.91 lakh. There was no substantial increase in out-migra-
tion from Kerala since 2008. More and more Keralites are opting for external migration in place
of internal migration.
The number of Kerala out-migrants who returned and are now living in Kerala (return out-mi-
grants) in 2011 is estimated to be 5.11 lakh. The corresponding number was 6.86 lakh in 2008,
9.94 lakh in 2003 and 9.59 lakh in 1998. There was a consistent decline in the number of return
out-migrants. More and more Kerala migrants in the other states in India tend to stay back in
their host state or move abroad instead of returning to their native state.
,QWHUVWDWHPLJUDQWV,602PL5RPQXPEHUHGPLOOLRQLQPLOOLRQLQ
million in 2003 and 1.65 million in 1998.
The vast majority of the out-migrants from Kerala (59.7 percent in 2011) were Hindus, a little
PRUHWKDQWKHLUVKDUHLQWKHSRSXODWLRQSHUFHQW2QWKHRWKHUKDQGWKH&KULVWLDQVZHUH
about 26.7 per cent of the total, much higher than their share in the total population which was
about 19 per cent. Muslims were only 13.7 per cent of the out-migrants, much lower than their
share in the total population, which stood at about 26 per cent. Between 2008 and 2011, the
share of the Hindu out-migrants declined from 61.7 per cent to 59.7 per cent, the share of the
Christian out-migrants also declined from 30.9 per cent to 26.7 per cent, but the share of the
Muslim out-migrants increased from 7.4 per cent to 13.7 per cent.
Palakkad district accounted for the largest number of out-migrants from Kerala, a position it re-
tained from the beginning. Thus the Palakkad-Malappuram corridor is the most migration-prone
DUHDLQWKHVWDWHZLWK3DODNNDGWRSSLQJLQWKHHOGRIRXWPLJUDWLRQDQG0DODSSXUDPLQWKHFDVH
of emigration. Kottayam district comes second in the order of out-migration followed by Kannur
district. Pathanamthitta district, which led all districts in 1998 in the matter of out-migration, is
almost at the bottom of the list in 2011.
What Pathanamthitta has gone through in the last 10-15 years in the matter of migration transi-
tions can be expected to be replicated in many of the other districts in the state in coming years.
The principal states of destination of Kerala out-migrants remained more or less unchanged
over these years. Karnataka was number one in 2008; it is number one in 2011 also, with 29 per
Kerala State Planning Board
117
cent of Keralas out-migrants. Tamil Nadu and Maharashtra are the other two major states where
Kerala out-migrants have made a living.
Remittances
The total remittances in Kerala in 2011 were estimated to be approximately Rs. 50,000 (Rs.
49,695) crores compared with Rs. 43,288 crores in 2008. Remittances were Rs. 63,315 per
household in 2011 and Rs. 57,227 per household in 2008.
Among the 14 districts in the state, Malappuram received the largest amount of remittances, i.e.,
Rs 9,040 crores which works out to Rs. 114,313 per household. In general, the southern dis-
tricts experienced a decline in their share of remittances and the northern districts experienced
an increase.
Muslim households received Rs. 23,089 crores or 46.5 per cent of the total remittances in 2011.
Hindus received Rs 18,089 crores or 36.4 per cent of the total. The Christian community re-
ceived Rs. 8,508 crores or 17.1 per cent. The shares of the Hindus and the Christians were
EHORZ WKHLU UHVSHFWLYH VKDUHV RI WKH WRWDO SRSXODWLRQ RI WKH VWDWH 2Q DQ DYHUDJH D 0XVOLP
household received Rs. 135,111 as remittances in a 12-month period. A Christian household,
on the other hand, received not even half of what a Muslim household received (Rs. 59,175). In
the case of the Hindus, the average remittance a household received is only about one-fourth of
what a Muslim household received (Rs. 38,489).
Economic Review 2011
Agriculture and Allied Sectors
C
H
A
P
T
E
R
120
Kerala State Planning Board
121
The global economic conditions are fragile and there remains great uncertainty as to how
markets will evolve over the medium term. Growth in high income countries is projected to be
ZHDNDVWKH\VWUXJJOHWRUHSDLUGDPDJHGQDQFLDOVHFWRUVDQGEDGO\VWUHWFKHGVFDOEDODQFH
sheets. Developing countries will have to search increasingly for growth within the developing
ZRUOG ZKLFK LV H[SHFWHG WR DOWHU WUDGH RZV RI FDVK FURSV H[SRUWLQJ GHYHORSLQJ FRXQWULHV$
serious, renewed global downturn is looming because of persistent weakness in the major de-
veloped economies related to problem left unresolved in the aftermath of recession of 2008-09
(UNCTAD, 2012). Since 1990, the volatility of prices of major commodities in the international
PDUNHWKDVLQFUHDVHGVLJQLFDQWO\DQGWKHSHULRGVLQFHKDVEHHQRQHRIH[WUDRUGLQDU\
YRODWLOLW\2(&')LQDQFLDOIDFWRUVKDYHKDGDYLVLEOHLPSDFWRQUHFHQWFRPPRGLW\SULFH
trends and volatility. The longer term trend towards a depreciating US dollar has exacerbated
the upward trend in commodity prices since most commodity trade is in dollars (UNCTAD,
%HVLGHVVHDVRQDOXFWXDWLRQVZHDWKHUXQSUHGLFWDELOLW\DQGVKRFNVDIIHFWVPDOOKROGHU
supply and result in more volatile prices. Weak market information system also contributes to
inter annual volatility. Instability in farm production is causing serious shocks to supply in farm
income and there is growing concern about the increased volatility in farm production, prices
DQGIDUPLQFRPH,QFUHDVHGLQWHQVLW\DQGIUHTXHQF\RIGURXJKWVDQGRRGVDQGSUHFLSLWDWLRQ
variance reported in recent years will further increase instability in the perennial crop based
agrarian economy of the state which further add to agrarian crisis.
Agriculture Income
6.2 The provisional estimate of agricultural income of the state recorded a negative growth
of 1.79% per cent during 2009-10. The trend in agricultural income in Kerala during the last
seven years is shown in Table 6.1. The quick estimate for 2010-11 also indicated a decline of
0.78 per cent in growth over 2009-10. The share of agriculture and allied sectors in GSDP in-
dicated a continuous decline in the state. The share was 17.48% during 2004-05 and declined
to 10.59% in 2010-11.
Agriculture and Allied Sectors
Economic Review 2011
122
TabIe6.1
Trends in AgricuIturaI Income in KeraIa
(Base 2004-05)
[Link] Year Agricultural
Income
(` in crores)
Rate of
change over
previous year
Agriculture and
Allied Sectors
(` in crores)
Percentage
1 2 3 4 5 6
1 2004-05 16980.51 20843.75 17.48
2 2005-06 18041.97 6.25 21882.16 16.67
3 2006-07 16567.85 -8.17 20507.67 14.48
4 2007-08 16196.60 -2.24 20255.14 13.15
5 2008-09 16533.94 2.08 20656.57 12.70
6 2009-10* 16236.47 -1.79 20534.52 11.59
7 2010-11** 16110.59 -0.78 20486.12 10.59
* Provisional ** Quick
Source: Directorate of Economics and Statistics
6.3 Real GDP growth at factor cost increased to 8.5 percent in 2010-11 from 8.0 percent in 2009-10 in
WKHFRXQWU\$IWHUWZRFRQVHFXWLYH\HDUVRIVXEGXHGSHUIRUPDQFHDJULFXOWXUHWXUQHGLQWRDVLJQLFDQW
drives of growth in 2010-11. The simultaneous occurrence of a normal and well distributed South West
PRQVRRQDQGH[FHVV1(PRQVRRQWKHUVWRFFDVLRQLQWKHODVWRQHGHFDGHHQDEOHGERWKNKDULIDQG
rabi sowing to be above normal and consequently there was record food grain production in 2010-11.
Monsoon 2011
6.4 Advance of South West monsoon over the Andaman Sea was delayed by about 10 days. The
monsoon set in over Kerala on 29th May, three days before its normal date of 1st June and covered the
entire country by 9th July, 6 days earlier than its normal date of 15th July. The withdrawal of monsoon
IURPZHVW5DMDVWKDQZDVGHOD\HGDQGLWFRPPHQFHGRQO\RQUG6HSWHPEHU2XWRIPHWHRUR-
logical districts for which data are available, 453 districts (76%) received excess/normal rainfall and
WKHUHPDLQLQJGLVWULFWVUHFHLYHGGHFLHQWVFDQW\UDLQIDOOGXULQJWKHVHDVRQ7KHIRUHFDVWIRU
monsoon onset over Kerala for this year was correct, which is the seventh consecutive correct forecast
for this event. For the country as a whole, the rainfall for the season (June-September) was 101% of its
Long Period Average (LPA). The actual rainfall received in Kerala during the season (Ist June 2011 to
30th September 2011) was 2215.8 mm as against the normal rainfall of 2039.6 mm which was normal.
$OOWKHGLVWULFWVLQWKHVWDWHUHFHLYHGQRUPDOUDLQIDOO.R]KLNNRGHDQG(UQDNXODPKDGH[FHVVUDLQIDOO
DQGZKLOHWZRGLVWULFWV7KLUXYDQDQWKDSXUDPDQG:D\DQDGUHFHLYHGGHFLHQWUDLQIDOORIDQG
-25% respectively.
6.5 During the North East Monsoon season 2011, the state received 450.8 mm of rainfall as against
480.7 mm of normal rainfall which was normal with a percentage departure of -6 % from the normal. All
the 12 districts in Kerala received normal rainfall during this season and Ernakulam and Pathanamthit-
WDGLVWULFWVUHFRUGHGGHFLHQWUDLQIDOO3HUFHQWDJHGHSDUWXUHIURPWKHQRUPDOZDVKLJKHVWLQ(UQDNXODP
district(-35) followed by the Pathanamthitta district (-24).
6.6 Kerala received 313.3 mm pre monsoon rainfall (from Ist March to 31st May 2011) which was
QRUPDO6HYHQGLVWULFWVLQWKHVWDWH$ODSSX]KD(UQDNXODP,[Link]\DP3DWKDQD-
mthitta, and Wayanad) received normal rainfall while seven districts (Thirunananthapuram, Thrissur,
Kerala State Planning Board
123
0DODSSXUDP3DODNNDG.R][Link]-
WULFWUHFHLYHGGHFLHQWUDLQIDOOGXULQJWKHVHDVRQZLWKDSHUFHQWDJHGHSDUWXUHRIIURPWKHQRUPDO
District wise rainfall distribution in the state during 2011 is given in Appendix-6.4
Land Use
'[Link]\HDULVJLYHQLQ7DEOH2XWRIDWRWDO
geographical area of 38.86 lakh ha. net sown area is about 53 per cent. Forest occupies around 28
per cent. The net sown area has declined slightly by 0.35 percent. The share of total cropped area
in the total geographical area is 68 percent. But it marked a decline of 21217 ha during 2010-11 over
the previous year. The share of land under non-agricultural uses out of total geographical area was 9
percent in 2009-10 and has increased to 10 per cent in 2010-11. There was a decline in the area under
current fallow (917 ha) and increase in the area under fallow other than current fallow (6569 ha) during
2010-11 over 2009-10. The area under cultivable waste declined 6349 ha and barren and uncultivated
land declined by 2473 ha. The land use pattern in Kerala during 2010-11 is shown in Fig 6.1.
TabIe6.2
Land use Pattern in KeraIa
[Link]. &ODVVLFDWLRQRI
Land
2009-10 2010-11* Percent of
Geographi-
cal Area
Change
in Area
between
2009-10 and
2010-11
Actual Percentage
1 Total Geographical
Area
3886287 3886287 100 0 0
2 Forest 1081509 1081509 28 0 0
3 Land put to non
agricultural uses
371906 384174 10 12268 3.29
4 Barren and uncul-
tivated land
22046 19573 0.5 - 2473 -11.22
5 Permanent Pas-
WXUHVDQG*UD]LQJ
land
228 153 0.0 -75 -32.89
6 Land under mis-
cellaneous tree
crops
4423 3690 0.1 -733 -16.57
7 Cultivable waste 98014 91665 2 -6349 -6.48
8 Fallow other than
current fallow
45374 51943 1 6569 14.48
9 Current fallow 76945 76028 2 -917 -1.19
10 Net area sown 2078715 2071507 53 -7208 -0.35
11 Area sown more
than once
589963 575954 15 -14009 -2.37
12 Total Cropped
area
2668678 2647461 68 -21217 -0.79
13 Cropping intensity 128 128
Source : Directorate of Economics and Statistics
Economic Review 2011
124
Trend in Area, Production and Productivity of Crops
6.8 Food grain production in country has reached a record value of 244.8 million tons in 2010-11.
Production of rice alone was to the tune of 96.0 million tons in [Link] estimated production of
rice for the country is 102.8 million tons in [Link] regarding the area, production and produc-
WLYLW\RILPSRUWDQWFURSVJURZQLQ.HUDODDUHVKRZQLQ7DEOHDQG$SSHQGL[2XWRIDJURVV
cropped area of 26.69 lakh ha. in 2009-10, food crops comprising rice, pulses and tapioca
occupy only 11.74 per cent. But in 2010-11, it reduced to 8.13%. Kerala state which had a low base
in food production is facing serious challenges in retaining even this meager area. Kerala agricultural
economy is undergoing structural transformation from the mid seventies by switching over a large
proportion of its traditional crop area which was devoted to subsistence crops like rice and tapioca to
more remunerative crops like banana and other plantations.
TabIe6.3
Area, Production and Productivity of PrincipaI crops
Sl.
No.
Crops Area (ha) Production (MT) Productivity (kg./
Ha.)
2009-10 2010-11 2009-10 2010-11 2009-10 2010-
11
1 Rice 234013 213185 598337 522739 2557 2452
2 Pulses 4449 3823 3390 2908 762 760
3 Pepper 171489 172182 28497 45267 166 263
Kerala State Planning Board
125
Sl.
No.
Crops Area (ha) Production (MT) Productivity (kg./
Ha.)
2009-10 2010-11 2009-10 2010-11 2009-10 2010-
11
4 Ginger 5408 6088 28603 33197 5289 5453
5 Turmeric 2438 2391 6066 6216 2488 2600
6 Cardamom 41593 41242 7800 7935 188 192
7 Arecanut 99188 99834 116763 99909 1177 1001
8 Banana 51275 58671 406242 483667 7923 8244
9 2WKHU3ODQ-
tains
47802 49129 338546 353772 7082 7201
10 Cashew nut 48972 43848 35818 34752 731 793
11 Tapioca 74856 72284 2525384 2360081 33737 32650
12 Coconut 778618 770473 5667 5287 7278 6862
13 Coffee 84796 84931 59250 65650 699 773
14 Tea 36845 36965 57810 57107 1569 1545
15 Rubber 525408 534230 745510 770580 1419 1442
* Production of coconut in million nuts , Productivity in numbers
#Area and production for the year 2010-11 are provisional.
Source: Directorate of Economics and Statistics
6.9 The area under rice has been declining consistently over the last several years. After a long pe-
riod of continuous decline, area under paddy increased from 2.29 lakh ha in 2007-08 to 2.34 lakh ha
in 2008-09 and slightly declined by 252 ha only in 2009-10. But a sharp fall of area by 20828 ha was
marked during 2010-11. In the case of tapioca, the area declined from 0.75 lakh ha in 2009-10 to 0.72
lakh ha. in 2010-11. Area under cashew nut was 0.49 lakh ha in 2009-10. But it declined to 0.44 lakh
ha during 2010-11.
6.10 In the case of coconut, area was at its peak during 2000-01. During the year 2010-11, the
area declined by 8145 ha. Major commercial crops which had recorded reduction of area during 2010-
11 are coconut (8145 ha), cardamom (351 ha), turmeric(47 ha), cashew nut (5124 ha) and tapioca
(2572 ha). The major crops with considerable gain in area include pepper (693 ha), ginger (680 ha),
banana (7396 ha), arecanut (646 ha), other plantains (1327 ha), coffee (135 ha), tea (120 ha) and rub-
ber (8822 ha). The crops which have failed to sustain the production level from 2009-10 are cashew,
tapioca and coconut. In 2010-11 some of the crops indicated increase in production over 2009-10.
These crops are pepper (16770 MT), ginger (4594 MT), turmeric (150 MT), cardamom (135 MT),
banana (77425 MT) and other plantains (15226 MT). The crops which have marked decline in the
production level during 2010-11 are rice (75598 MT), pulses (482 MT), arecanut (16854 MT), cashew
nut (1066MT), tapioca (165303 MT), coconut (388 million nuts) and tea (703 MT).
Crop wise analysis
Rice
6.11 In order to increase food production in the state, a major food security project was launched in
2008-09 covering rice, milk and egg. As part of the project, regional subprojects were launched with
additional incentives, interest free loans, project based support for fallow land cultivation and a pack-
age of support measures. The procurement price was also enhanced to `13 per kg and further to `15
SHUNJ$PRGHUQL]DWLRQSURJUDPPHIRUOLIWLUULJDWLRQZDVDOVRLQLWLDWHGDVSDUWRIWKHIRRGVHFXULW\SURM-
Economic Review 2011
126
ect and Malabar Package. A rehabilitation project on ponds was also initiated recently, as part of state
food security project. From 2008-09 to 2009-10, area under paddy remain constant as 2.34 lakh ha.
During 2010-11, the area under rice declined to 2.13 lakh ha and the production of rice also declined
to 5.22 lakh MT from 5.98 lakh MT in 2009-10.
Table 6.4
Area, Production and Productivity of Rice in Kerala and IndiaTable 6.4 d
Year Area (000' ha.) WDd W
< India < India < India
1 2002-03 311 40410 689 75720 2218 1874
2 2003-04 287 42496 570 88280 1984 2077
3 2004-05 290 41665 667 85310 2301 2047
4 2005-06 276 44258 630 91790 2285 2074
5 2006-07 264 43810 642 93360 2435 2131
6 2007-08 229 43900 528 96700 2308 2202
7 2008-09 234 45600 590 99400 2520 2177
8 2009-10 234 41920 598 89090 2557 2125
9 2010-11 213 42560 522 95330 2452 2239
Source: Directorate of Economics and Statistics, CMIE
6.12 The average productivity which was stagnant at around 2.2 tons/ha for four years till 2005-06
has improved to 2.4 tons/ha in 2006-07 and slightly declined to 2.31 tons in 2007-08 and further im-
proved to 2.56 tons in 2009-10. Again it declined to 2.45 tons in 2010-11 (Table 6.4). Increase in area
XQGHUSDGG\KDVEHHQUHFRUGHGLQ$ODSSX]KDKDDQG0DODSSXUDPKD$FRUUHVSRQGLQJ
LQFUHDVHRIULFHSURGXFWLRQLVQRWYLVLEOHLQWKHFDVHRI$ODSSX]KD,WGHFOLQHGWR07%XWLQ0DODS-
puram the corresponding increase in production is 1177MT during 2010-11(fg 6.2). Even though the
area under rice in Kasaragod declined by 238 ha, the rice production has increased by 574 MT during
the year.
Fig. 6.2
6.13 Though there were notable area enhancement till the beginning of 1980s the area is un-
10.82
-6.79
-4.52
3.95
-16.42
-15.23
-20.35
-16.87
-12.00
-18.06
1.26
5.91
-14.94
-15.82
-21.86
-22.68
-25
-20
-15
-10
-5
0
5
10
15
P
e
r
c
e
n
t
Deviation in Area and Production of Rice in the major districts of
Kerala during 2010-11 over 2009-10 (%)
Alappuzha Kottayam Ernakulam Thrissur
Palakkad Malappuram Wayanad Idukki
Area Production
Kerala State Planning Board
127
der constant decline since then. A slight area enhancement was noticed during 2008-09 com-
pared to 2007-08 and thereafter it declined to 2.13 lakh ha during 2010-11, around 9 percent de-
crease in area over the previous year. The maximum area under rice of 8.81 lakh ha was in
1974-75 with a production of 13.34 lakh tonnes. In the production scenario, early periods in-
dicated production enhancement. However production showed declining trends since 1983
and the lowest production was recorded during 2010-11. The year 2008-09 and 2009-10 pres-
ent a solace by showing a slight production enhancement of rice in the state. But during 2010-11,
it declined to 5.22 lakh MT, which marked 13 percent decline in production over 2009-10 period.
6.14 Additional support was also provided for upland rice cultivation in potential areas for the
UVW WLPH LQ $ VSHFLDO VFKHPH DV SDUW RI IRRG VHFXULW\ SURMHFW IRU `36 crores was also
launched in 2009-10 and consolidated in 2010-11 for the development of rice in the state. The
outputs in terms of area as well as production are discouraging even after enacting paddy land
and wetland conservation act as well as after enhancing the procurement price to Rs. 15 per kg.
Cost of Production of Rice
6.15 A study was conducted using cost of cultivation data by the Ministry of Agriculture. The study pe-
ULRGKDVEHHQGLYLGHGLQWRWZRSHULRGVV\QFKURQL]LQJZLWKWKHSUHOLEHUDOLVDWLRQDQGOLEHUDOL]DWLRQHUDV
7KHUVWSHULRGVWDUWVZLWKDQGHQGVZLWKDQGWKHVHFRQGSHULRGFRYHUWKH\HDUVIURP
WR7KHPDMRUQGLQJVRIWKHVWXG\DUHVKRZQLQ%R[
Box No 1
Cost of Production of Rice
7KHJURZWKUDWHVLQ\LHOGVFDPHGRZQIURPWRLQWKHUVWDQGVHFRQGSHULRGUHVSHFWLYHO\
at the all India level. The growth rates in the real costs of production declined in the background of a
UREXVWJDLQLQSHUKHFWDUH\LHOGVLQWKHUVWSHULRGZKLOHWKHUHFRVWVZHQWXSLQUHDOWHUPVLQ
the second period (1.41%). The farmers of AP and Punjab could produce a quintal of rice at 27% and
ORZHUWKDQWKDWRIDOO,QGLDDYHUDJHLQGLFDWLQJLPSURYHGHIFLHQF\[Link]
it is 19% higher while in Tamilnadu 28% higher in the TE ending 2006-07.
The returns over variable costs (Ratio) are much higher for HP (3.84), Punjab (2.49), and Haryana
(2.26) than other states. For Kerala it is only 1.44 for the TE ending 2006-07, and for Tamilnadu it is
1.47 and for Karnataka it is1.90.
Rice recorded positive and high growth rates in net income, farm business income and farm invest-
PHQWLQFRPHLQWKHUVWSHULRGDQGVKRZHGQHJDWLYHJURZWKUDWHLQDOOWKHVHUDWLRVLQWKHVHFRQG
period, at the all India level.
The rising costs necessitate higher support prices to sustain the long run margin of 20% over total
costs. The minimum support price (MSP) in real terms declined in the eighties and still reforms to
IDUPLQJGLDFRQWLQXHWREHVXIFLHQWIRUWKHIDUPLQJFRPPXQLW\7KLVLVEHFDXVHFRVWVRISURGXFWLRQ
of rice fall during that period as productivity improved at more than 2.5% per annum and outstripped
JURZWKLQFRVWRIFXOWLYDWLRQ2QWKHRWKHUKDQGWKHFRVWVRISURGXFWLRQURVHDWWKHUDWHRIQHDUO\
per annum during nineties and beyond making growth of higher MSPs needed to help the farmers
maintain the same incomes. The farm business income (return over paid out costs) in real terms of
ULFHIDUPHUVGHFOLQHGE\IURPWRDWWKH$OO,QGLDOHYHO7KHGHFOLQLQJSURW-
ability seems to have discouraged farmers in spending on yield augmenting technology.
Season wise performance
6.16 Season wise data on the performance of rice during the last three years is shown in Appendix
6.7. Data shows a sharp decline in area in season from the period of 2008-09 to 2010-11. During
Mundakan season, 2.25 percent increase in area under rice was recorded in 2009-10 period and then
Economic Review 2011
128
it declined by 14.82 per cent in 2010-11. There was a continuous increase in area in Puncha season
for the last three years. Mundakan season accounts for highest share in production of 41.13 per cent
GXULQJIROORZHGE\SHUFHQWLQ9LULSSXDQGSHUFHQWLQ3XQFKDVHDVRQ%XWWKH
productivity recorded in puncha season is the highest with 2688 kg per ha. during 2010-11 which is
1.14 per cent lower than that in 2009-10 and also 9.86 per cent less than that of 2008-09.
Coconut
6.17 In India, coconut is grown in an area of 1.90 million ha. producing 10824 million nuts with a per
hectare productivity of 8300 nuts in 2009-10. (Table 6.5) Keralas share in area as well as production
of coconut in the country is declining over time. Area, production and productivity of coconut in major
states are given below (Fig. 6.3).
Fig. 6.3
0
1000
2000
3000
4000
5000
6000
7000
8000
9000
10000
Kerala Karnataka Tamil Nadu Andra
Pradesh
7
8
8
4
1
9
3
9
0
1
0
4
3
9
9
2
1
4
9
7
3
6
9
2
6
6
7
5
0
6
6
3
5
7
3
9
4
6
7
6
4
1
3
Area, Production and Productivity of Coconut in major
states of India (2009-10)
Area ('000 ha) Production (million nuts)
Productivity (nuts/ha)
Source: Agricultural statistics 2010, GOI
6.18 With a coverage of 7.7 lakh ha, coconut occupies 37 per cent of the net cropped area. The pro
duction improved by 2.17 percent in 2008-09 over the previous year in the state after a decline for
three years consecutively. But a reduction of 6.7 percent was marked in the production of Coconut
in Kerala during 2010-11 over the previous year. The productivity levels of coconut in Kerala also de-
clined sharply. It is lower than other major producing states. The productivity in Kerala is 12.3 percent
lower than the national average in 2010-11.
Kerala State Planning Board
129
TabIe6.5
Area, Production and Productivity of Coconut in KeraIa and India
Area (000Ha.) Production
(Million Nuts)
Productivity
(Nuts/ha.)
[Link] Year Kerala India Kerala India Kerala India
1 2004-05 899 1935 6001 12830 6673 6632
2 2005-06 898 1950 6326 14811 7046 7608
3 2006-07 873 1940 6054 15840 6935 8165
4 2007-08 819 1903 5641 14744 6889 7747
5 2008-09 788 1895 5802 10148 7384 7749
6 2009-10 779 1900 5667 10824 7278 8300
7 2010-11* 770 NA 5287 NA 6862 NA
Source: DES, CMIE and CDB
* Area and production for the year 2010-11 are provisional
6.19 The implementation of massive replanting of root wilt affected palms with seedlings of elite palms
could be improved immediately as approved by Government of India on a campaign mode. However the
HIIHFWLYHXWLOL]DWLRQRIZRRGKDVWREHHQVXUHGE\WKH&RFRQXW'HYHORSPHQW%RDUG7KHSUHVHQWOHYHORI
adoption suggests the need for further intervention to enhance technology adoption. Generation of tech-
nologies for different agro ecological situations may improve the level of adoption. Integrated farming
system with due emphasis on multi-tier cropping systems needs to be promoted in different agro eco-
logical situations for improving income of the farmers. A major plan support for integrated farming has
been provided during 2010-11 onwards. Effective harvesting machines also need to be developed for
promotion. Restructuring of the cluster development programme is also essential for more effective-
ness. The initiatives of the Coconut Development Board for the skill development and formation of
groups of labourers for coconut hereby is expected to address a basic issue in coconut development.
Pepper
6.20 World pepper production during 2010-11 was estimated at 316.4 thousand tons compared to
318.7 thousand tons in 2009-10 period which shows a decline of 2.3 thousand tons.
6.21 Pepper production in India during 2010-11 is estimated at 48 thousand tons. This stagnant nature
of pepper production in recent years is mainly due to low productivity and diseased affected pepper
plantation. India contribute 15.8% share in world pepper production.
6.22 World pepper export declined in 2010, and the quantum export declined by 30.74 thousand tons
and placed at 237.7 thousand tons. All the major exporting countries reported lower quantum of ex-
ports in the same period. India could export 42806 MT of pepper in 1999-00, which declined to 25250
MT in 2008-09 which further declined to 19750 MT in 2009-10. During 2010-11, India exported 18,850
tons of pepper as against 19,750 tons registering a decline in quantity exported by 0.90 thousand tons.
7KLVLVGXHWRIDOOLQH[SRUWVWR86(8GXULQJWKH\HDU7KHYDOXHUHDOL]DWLRQZDVDW`313.92 crores
in 2009-10 and it increased to `FURUHVLQDQGXQLWYDOXHUHDOL]DWLRQKDVDOVRLQFUHDVHG
from 158.95 Rs/Kg to 203.28 Rs./Kg respectively in the corresponding period.
6.23 Price of pepper moved consistently upwards from early nineties and reached a peak level in
1999-00 with ` 215 per kg. Since then declined to `174 per kg. in 2000-01, further down to ` 80 per
kg. in 2001-02 and increased slightly to ` 114.76/kg. in 2008-09 and further increased to `134.82/ kg
in 2009-10. The recent upsurges in prices indicate the revival of pepper prices to the 1999-00 levels.
The domestic price of pepper shows an upward trend from the mid of twenties and reached a peak
level in 2010-11 with`174.21 per kg. In Kerala, pepper replanting scheme up to 2 hectors is available
Economic Review 2011
130
in Idukki and Wayanad districts. The scheme is implemented by the Spices Board and the Department
of Agriculture.
Cashew
6.24 Area under the crop in Kerala, has been declining steadily from 1.25 lakh ha. in 1988-89 to
0.44 lakh ha. in 2010-11 and the production declined from 1.08 lakh MT to 0.35 lakh MT during the
period (Table 6.6). The share of Kerala in the area under cashew in the country has come down from
23 per cent in 1987-88 to 4.64 percent in 2010-11 and the corresponding decline in share of produc-
tion from 31 per cent to 5.32 per cent. Area and production are increasing steadily in other producing
states in the country. Maharashtra is the leading producer with 31.85 percent share in production dur-
ing 2010-11, whose share was only 10 per cent in 1990-91
TabIe6.6
Area, Production and Productivity of Cashew in KeraIa and India
^E Year Area (000Ha.) WDd W
< India < India < India
1 200 0 0 2
2 200 0 1 20 0
200 0 0 1 0
200 0 0 1 20 2
200 0 2 0
200 0 01 2
200 10 2 2 1 1
2010 11 1
*Area and production for the year 2010-11 are provisional.
Source :DES, Cashew Export Promotion Council of India
6.25 In spite of operating special schemes for expansion of area under cashew, the coverage has
been steadily declining during the last two decades. Productivity of the crop, which was around 900
kg. per ha. during late eighties has also started declining from 1995-96 onwards, reaching 562 kg. per
ha. during 1998-99 and thereafter hovering around 800 kg. In 2010-11, it further declined to 792 kg/ha.
6.26 The share of agriculture products in the total export earnings of the country was 5.47 dur-
LQJ 2XW RI LW SHUFHQW LV IURP FDVKHZ H[SRUWV 7KLV DFFRXQWHG WR SHUFHQW
of the total foreign exchange earnings of the country. India exported cashew kernels worth
` 2598.15 crore during 2010-11 and imported raw nuts worth ` 2479.75 crore resulting in a net
foreign exchange gain of `118.4 crore. During 2010-11, there was a sharp decline of 15.32 per-
cent in quantity exported while 33.04 percent decline in quantity of raw nuts imported compared
to previous year. U.S.A. is the major export market with 32.02 per cent export share followed by
UAE (14.29 per cent). The total raw nut imported into India during 2010-11 was 5.04 lakh MT.
Kerala State Planning Board
131
Fig. 6.4
Plantation crops
6.27 Plantation crops in general are either export oriented or import substituting and therefore as-
VXPHVSHFLDOVLJQLFDQFHIURPWKHQDWLRQDOSRLQWRIYLHZ,WLVHVWLPDWHGWKDWQHDUO\ODNKIDPLOLHV
are dependent on the plantation sector for livelihood. Each of the four plantation crops of South India
has its distinct characteristics and economic problems. Consequent to the removal of quantitative
restrictions on import, plantation crops in general are facing the threat of low quality imports.
6.28 Kerala has a substantial share in the four plantation crops of rubber, tea, coffee and carda-
mom. These four crops together occupy 6.81 lakh ha, accounting for 32.88 per cent of the net cropped
area in the state and 39.6 per cent of the area under these crops in the country. Keralas share in the
national production of rubber is 90 per cent, cardamom 76 per cent, coffee 22 per cent during the year
2010-11. Keralas share in the production of tea is 7 percent during 2010-11.
Rubber
6.29 The production of natural rubber in the country was 8.31 lakh MT in 2009-10, registering a 3.8
per cent decline compared to the previous year, while in 2010-11 periods, rubber production of In-
dia increased to 8.62 lakh MT which marked an increase of 0.31 lakh MT over the previous period.
Production of natural rubber for the year 2011-12 is projected at 9.02 lakh tons with a growth rate of
4.6%. Among the major Natural Rubber consuming countries, India has second position after China,
relegating USA & Japan to third and fourth position. The Natural Rubber consumption in the country
has increased from 9.31 lakh MT in 2009-10 to 9.49 lakh MT in 2010-11.
6.30 Kerala accounts for 78.2 percent of the area under rubber in the country. The coverage under
the crop in 2010-11 was 5.34 lakh ha, higher by 8822 ha. over the previous year. The production of
natural rubber in Kerala during the year was 7.71 lakh tonnes indicating a 3.36 percent increase over
the previous year. In 2010-11, the productivity increased slightly to 1442 Kg/ha from 1419 Kg/ha in
the previous year.
6.31 Steady increase in demand from the domestic manufacturing sector necessitates massive
LPSRUWVRI15DQGLPSRUWVGXULQJVHHPWRKDYHVWDELOL]HGDWODNKWRQVDQLQFUHDVHRI
0.11 lakh tons over the previous year. This higher level of import during the year was supported by
the concessional import duty at 7.5 percent till 31st March 2011 for import of 40 thousand tons. The
Economic Review 2011
132
records shows the facts that the domestic production is incapable to meet increasing demand as the
consumption level is growing year by year. The projected consumption for the year 2011-12 is 9.77
lakh tons with a growth of 3.0%. At the same time, the export of NR during 2010-11 has shown only
a marginal increase of 0.05 lakh tones over the previous year. In 2010-11, NR export was 0.30 lakh
tons and it was 0.25 lakh tons in the previous year. This is due to the unfavorable price situations in
the international market.
7KHKLJKHUSULFHVLQWKHLQWHUQDWLRQDOPDUNHWDUHUHHFWHGLQWKHGRPHVWLFPDUNHWDOVR7KH
average price of RSS4 in the domestic market at Kottayam was increased to `190.03 per Kg from
`114.98 per Kg. The international price of RSS3, equivalent of RSS4 of India, was `195.55 in the
corresponding period and it also increased to `221.85 per kg during January to June 2011 and then
declined to `LQ2FWREHU7KHFXUUHQWXSWUHQGLQSULFHVZDVWKHUHVXOWRIWLJKWQHVVLQWKHVXSSO\
of NR due to adverse condition, relatively high oil prices, low level of inventories and steady increase
in demand from the domestic manufacturing sector. The outlook for NR prices is not very positive as
the global economy continues to be clouded by many uncertainties. However, the low supply levels
and the anticipations of the increase in NR demand from Japan later will boost the price stability.
Coffee
6.33 The area under coffee in Kerala was 0.85 lakh ha out of 4.04 lakh ha in the country during
2010-11, which works out to 21 per cent. The share of Kerala in production is 22 per cent during 2010-
11. Major variety grown in Kerala is Robusta with a share of 95 per cent in planted area. Production of
coffee during the year was only 0.66 lakh MT against 3.02 lakh MT for the country. Productivity of the
crop in terms of bearing area in Kerala (773 kg/ha) is higher than the national level of 746 kg/ha. Area
under coffee registered substantial increase during the last two decades. The increase in production
recorded during the period was much higher and registered an annual average growth rate of nearly
eleven per cent. Coffee provides opportunities for livelihood to nearly one lakh families including agri-
cultural labourers.
Kerala State Planning Board
133
6.34 Domestic coffee production for the year 2010-11 is 299 thousand tons which is more than 9.4
thousand tons compared to the previous year. Major varieties of coffee grown in India are Arabica
and Robusta. Arabica production is estimated at 95 thousand tones and Robusta at 204.0 thousand
tonnes. This would be the highest coffee crop to be reported after 2001-02. The sporadic rains re-
ceived in the blossom period of March and April is anticipated to have a bearing on Indias 2011-12
crop.
6.35 There was an increase in coffee exports by the Indian coffee sector during 2010-11. The export
SHUIRUPDQFHZDVRXWVWDQGLQJRQDOOFRXQWULHVLQTXDQWLW\H[SRUWHGYDOXHUHDOL]DWLRQRUXQLWYDOXH,Q
quantity terms it increased to 320.98 thousand tones from 196.06 thousand tones in 2009-10. The
YDOXHUHDOL]DWLRQLQZDVHVWLPDWHGDW5VFURUHDQLQFUHDVHRI5VFURUHRYHU
the previous year, while unit value increased to Rs.116.39 per kg in 2010-11 from Rs. 105.66 per kg
in 2009-10.
Tea
6.36 Against the total area of 5.8 lakh ha under tea in the country Kerala accounts for only 0.37 lakh ha.
,QUHVSHFWRISURGXFWLRQWKHVKDUHRI.HUDODLVSHUFHQWLQ7KHUHLVDXFWXDWLRQLQSURGXF-
tion and it ranged from 64.8 [Link] in 1995-96, reaching to 69.1 [Link]. in 2000-01 which declined to 52
M kgs. in 2007 and improved to 65.87 M Kg in 2010-11.
6.37 During 2010-11 world tea production was 4066.6 [Link]. compared to 3,3932 [Link] in the previ-
ous year, that is an increase of 134.6 [Link]. This increase was recorded from the two major export-
LQJFRXQWULHVYL].HQ\D0.JVDQG6UL/DQND0NJV,Q,QGLDWHDSURGXFWLRQGXULQJ
2010-11 was placed at [Link]. In the previous year it was 979 MKgs. The share of Kerala in the
production of tea is 6.9 per cent.
6.38 Among the major tea producing countries, India has second position by producing 23.8 per cent
share in the world tea production after China which has 33.7 per cent share in it. Followed by India,
Kenya and Sri Lanka has 9.8 per cent and 8.1 per cent share in the total production respectively.
6.39 The export performance in tea was depressed by all parameters during 2010. It was declined
from 197.9 [Link] in 2009-10 to 193.3 [Link] in 2010-11, a decline of 4.6 [Link]. In India, after the
UHPRYDORITXDQWLWDWLYHUHVWULFWLRQLQWKHUHZDVDKXJHRZRIWHDZDVZLWQHVVHG%XWLQ
11, the import was declined to [Link]. compared to 25.5 [Link]. in the previous year. The price of
plantation crops for the last seven years is shown in Fig. 6.5.
Economic Review 2011
134
Fig. 6.5
Cardamom
6.40 The trade estimates shows that India produced 10.35 thousand tones to 11.00 thousand tones of
Cardamom during 2010-11 period. All time high cardamom exports was recorded in 2009-10 at 1975
tonnes, while the exports have declined to 1175 tonnes in 2010-11. There was a corresponding de-
FOLQHLQYDOXHUHDOL]DWLRQE\5VFURUHVDQGZDVSODFHGDW5VFURUHV:KLOHWKHXQLWYDOXH
surged to Rs. 1,124.79 in 2010-11, an increase of Rs. 285.79 per kg over the previous year. Major
importers of Indian cardamom were, Saudi Arabia followed by UAE, Kuwait & Egypt.
6.41 Productivity which was more or less stagnant around 50 kg./ha. in the 1980s has improved to the
level of around 203 kg. per ha by 2001 and increased slightly to 206 kg/ha in 2008-09 and declined
Kerala State Planning Board
135
to 192 Kg/ha in 2010-11. The share of Kerala in production at the All India level increased from 28 per
cent in 1992-93 to 76 per cent in 2010-11. While area under cardamom in the country has declined
from 0.97 lakh ha to 0.71 lakh ha. in the period, in Kerala it has come down from 65,000 ha to 41588
KD2QWKHH[SRUWIURQWFDUGDPRPKDVEHHQIDFLQJFRPSHWLWLRQIURP*XDWHPDODDOWKRXJKWKHTXDOLW\
of Guatemala cardamom is inferior.
High value agriculture
6.42 High value agriculture is a major contributor to the economy of many states. The share of fruits
and vegetables and livestock products in value of output from agriculture is given in Table 6.7. Fruits
and vegetables contribute more than 30 percent to value and output from agriculture in states like Him-
DFKDO3UDGHVK2ULVVD:HVW%[Link]%LKDUDQG1RUWK(DVWHUQ6WDWHV%HWZHHQ
TE 1995-96 and 2005-06, share of fruits and vegetables increased in all states except Assam and
Rajasthan which witnessed marginal decline in share
TabIe6.7
Share of fruits and vegetabIes and Iivestock sector (%) in totaI vaIue of output from crop and
Iivestock sector
State )UXLWVDQG9HJHWDEOHV Livestock
TE 95-96 TE 2005-
06
TE 95-96 TE 2005-
06
Himachal Pradesh 29.9 41.1 31.7 31.3
Karnataka 19.3 23.2 18.9 20.5
Kerala 14.8 22.1 28.2 22.3
Tamilnadu 20.6 22.6 22.2 31
All India 14.6 18.2 24.7 27.2
6RXUFH&62
6.43 The share of fruits and vegetables in total value of output in Kerala increased from 14.8 per cent
in 1995-96 to 22.1 percent in 2005-06.
6.44 There is good potential in the state to promote fruits and vegetables. Focused area based projects
are required for the development of these crops. Cluster based development is ideal for vegetables.
9HJHWDEOHVFRXOGEHDPDMRUFRPSRQHQWLQXUEDQDJULFXOWXUH&RQYHUJHQFHRIYDULRXVLVRODWHGSURMHFWV
LPSOHPHQWHG E\ GLIIHUHQW RUJDQL]DWLRQV D VHHG DQG PDUNHWLQJ SODQ DUH HVVHQWLDO EHIRUH ODXQFKLQJ
large scale projects. The database on fruits and vegetables is also quite weak. Strengthening of this
GDWDEDVHLVDOVRDSUHUHTXLVLWHIRUGHYHORSLQJYLDEOHORFDWLRQVSHFLFSURMHFWV
Collective farming through Kudumbashree
6.45 Harithashree, the lease land farming promoted by the State Poverty Eradication Mission,
Kerala, through Kudumbasree, has helped women farmers to stay on in agriculture for their livelihood.
The major crop cultivated by the Kudumbashree group is paddy (33.4 per cent of area) followed by
plantain and vegetables during 2010-11 under the lease land farming.
'XULQJ WKH QDQFLDO \HDU YDULRXV FURSV LQFOXGLQJ SDGG\ YHJHWDEOHV ELWWHU JRXUG
snake gourd, cowpea, bottle gourd, ridge gourd, little gourd, bhindi, amaranthus brinjal, chilli, cucum-
ber, water melon etc.) and other crops were cultivated in a total area of 39033.64 ha. Area brought
under cultivation of paddy was 13017.94 ha, vegetables contributed to 4501.55 ha and 21514.16
ha of area was covered by other crops (banana, tapioca, pineapple, ginger, medicinal plants, betel
vine). Details of area covered are depicted in Table 6.8. Collective farming is an important area ku-
Economic Review 2011
136
GXPEDVKUHHKDVLGHQWLHGIRUVHFXULQJOLYHOLKRRGRSSRUWXQLWLHVWRWKHSRRUIDPLOLHV,WSURYLGHVTXDOLW\
seeds, seedlings and saplings to the groups under the samagra project. It also provides training to
women in good agriculture practices and to use modern equipments such as combined harvester, tiller
HWF$SDUWIURPWKHFRQYHQWLRQDODJULFXOWXUHFURSVRULFXOWXUHVFHQWHGULFHPHGLFLQDODQGDURPDWLF
plants, mushroom cultivation etc are promoted. At present only 20% of neighbourhood groups are
involved in this programme and out of which only 5% are supported under special samagra projects.
TabIe6.8
Area covered under coIIective farming during 2010-11
^E
NHGs
W s K d
1 Trivandrum 72.428 45.22 1667.404 1785.052 24376
2 Kollam 192.744 144.508 772.5 1109.752 17124
3 Pathanamthitta 259.32 142.476 1560.404 1962.2 7754
4 $ODSSX]KD 1002.664 262.02 446.524 1711.208 17463
5 Kottayam 2241.428 85.336 631.408 2958.172 12390
6 Idukki 368.144 682.66 4085.084 5135.888 10641
7 Ernakulam 1047.908 402.856 2195.472 3646.236 17599
8 Thrissur 999.124 319.956 547.392 1866.472 18985
9 Palakkad 1084.548 292.264 1557.136 2933.948 18491
10 Malappuram 1520.24 734.524 1984.548 4239.312 17721
11 .R]KLNRGH 375.644 216.504 1945.332 2537.48 20851
12 Wayanad 937.408 221.14 1308.72 2467.268 7826
13 Kannur 1789.548 528.132 1912.392 4230.072 15466
14 Kasargode 1126.792 423.952 899.84 2450.584 8457
TotaI 13017.94 4501.548 21514.156 39033.644 215144
Source: Kudumbashree
Crop Development Programme - Review of Annual Plan 2010-11
6.47 During the Annual plan 2010-11 an amount of ` 184.4 crores was provided to crop husbandry
which include partially aided schemes and 100 per cent Centrally sponsored including Macro man-
agement schemes. (Table 6.9). Expenditure incurred under crop husbandry and agriculture research
amount to 139.34 crore, which constitute 86.5% of the outlay.
TabIe6.9
FinanciaI Performance of Crop Husbandry during 2010-11 (In Crore)
^E Items K -
1 Crop Husbandry 110.00 103.085 93.7
2 Agricultural Research 51.00 36.25 71.1
3 Partially Aided Schemes 16.50 12.30 74.5
4 100% CSS 6.9 6.38 92.5
TotaI 184.4 158.015 85.7
0DMRUVFKHPHZLVHQDQFLDODFKLHYHPHQWVPDGHGXULQJWKHSHULRGLVIXUQLVKHGEHORZ7DEOH
$QDPRXQWRI5VFURUHZDVXWLOL]HGIRUWKHGHYHORSPHQWRIULFHLQWKH6WDWH
Kerala State Planning Board
137
TabIe6.10
Major scheme wise Expenditure during 2010-11 (` in Iakhs)
^E ^ K
1 Sustainable development of Rice based
farming system
2900.00 2897.93
2 National Biogas development programme 120.00 115.03
3 Coconut based farming system 3000.00 2855.9
4 Integrated farming in coconut holdings 400.00 482.02
5 Food security 2800.00 2605.58
Rice
6.49 Rice is the staple food of the people in Kerala. Even so it produces only a less than 15 per cent
of the requirement. The ultimate objective of rice development programme is to improve the produc-
tion of rice and to attain the productivity of a minimum of 3 tonnes per ha by the end of the twelfth plan
period. Paddy cultivation is mainly undertaken by the Group Farming Samithies. It is estimated that
DERXWDQDUHDRIODNKKDLVXQGHUDERXWJURXSIDUPLQJVDPLWKLHV'XULQJWKHODVWYH\HDUV
the cost of cultivation has doubled due to increased labour cost, cost of seeds and other inputs. This
affected paddy cultivation in Kerala adversely.
Coconut Development
6.50 Coconut is cultivated in an area of 7.70 lakh ha in our state with an annual production of 5287
million nuts and a productivity of 6862 nuts/ha in 2010-11. The Department of Agriculture is implement-
ing coconut development schemes with the intention of increasing productivity of coconut and gener-
ates more income from coconut gardens. As per the centrally sponsored scheme the Coconut Devel-
opment Board provides assistance for production and distribution of quality hybrid coconut seedlings.
Programmes under State Horticulture Mission
State Horticulture Mission
6.51 The National Horticulture Mission was launched in 2005-06 in order to give new momentum
to the development of horticulture to generate employment and enhance farm income. The mission
aims at addressing problems related to generation of technology, production, post harvest manage-
ment, processing and marketing under one umbrella in the horticulture sector. The expenditure under
the scheme in the state is shown in Table 6.11.
TabIe6.11
Expenditure under SHM in KeraIa (` in Iakhs)
Year ^ '< dZ
2007-08 19212.76 6147.73 300 6447.73 8008.92
2008-09 17420.15 7517.29 1326.60 8843.89 5686.67
2009-10 6921.44 0 200 200 9482.15
2010-11 8388.38 7130.12 200 7330.12 785
2011-12* 7700 7514.81 1326.14 8840.95 -
Total 59642.73 28309.95 3352.74 31662.69 23962.74
* as on 30/06/11.
6.52 There was no release from GoI during 2009-10. There was an accumulated balance of 98.74
crores in 2009-10. Hence no funds were released in 2009-10. An amount of Rs.200 lakh is provided
Economic Review 2011
138
as state share during 2010-11 in the original budget and increased further through SDG. The total
expenditure under state share during 2010-11 was `785 lakh.
$SURMHFWRULHQWHGPRQLWRULQJV\VWHPKDVWREHHYROYHGIRUUHDOL]LQJWKHHQYLVDJHGRXWSXWV$
QXPEHURI1*2VDVZHOODVSULYDWHVHFWRUDUHDOVRSDUWRIWKHSURMHFWZKLFKQHHGVIXUWKHUPRQLWRULQJ
Establishment of new gardens, planting material production, rejuvenation of pepper, cashew, cocoa,
creation of water resources, promotion of IPM and post harvest management are part of the project
activities.
Vegetable and Fruit Promotion Councils Programme
9HJHWDEOH DQG )UXLW 3URPRWLRQ &RXQFLO .HUDOD ZDV LQYROYHG LQ WKH LPSOHPHQWDWLRQ RI YHJ-
etable and Fruit Promotion Programme. The programme covers production, formation of SHGs, credit
management and marketing.
6.55 During the year 2010-11, 10317 farmers were inducted and 532 new SHGs were formed.
Initiated 20 new farmer markets and 31 collection centres during 2010-11. Thus 260 farmer markets
and 84 collection centres were initiated so far by the council. During the year, 15188 farmers were
enrolled under the health insurance scheme and an amount of Rs. 42 lakh was disbursed to the farm-
ers as claim. During 2010-11, farmers have cultivated vegetables in 24894 ha. of area and banana in
26858 ha. The total production from the cultivated area was 353295 MT of vegetables and 510302 MT
RIEDQDQD2XWRIWKHWRWDODPRXQWRI5VODNKDYDLODEOHXQGHU*[Link]
5VODNKZDVXWLOL]HGIRULPSOHPHQWLQJWKHVFKHPHVLHDURXQGRIWKHDOORWWHGIXQGVZHUH
XWLOL]HGGXULQJWKHODVWQDQFLDO\HDU$QDPRXQWRIFURUHZDVPDGHDYDLODEOHDVDJULFXOWXUDO
loan to 9067 farmers. The credit recovery was 70 per cent.
Food Security Project
6.56 A state food security project has been launched in the state during 2008-09 through a conver-
JHQFHDSSURDFKDQGYDULRXVRQJRLQJVFKHPHVZHUHGRYHWDLOHGWRUHDOL]HWKHWDUJHWV5LFHPLONHJJ
and vegetables were included in the project. An amount of `FURUHZDVXWLOL]HGGXULQJXQGHU
various components of food security for focusing on rice alone.
6.57 The National Food Security Mission (NFSM) was also launched in 2007-08 to enhance the
production of rice, wheat and pulses. It will target those districts which have lower productivity than
state average, but have the potential to augment the production of the three crops. From Kerala, Pal-
akkad district alone is included in the project.
Rashtriya Krishi Vikas Yojana (RKVY)
5.9< ZDV ODXQFKHG LQ LQ SXUVXDQFH RI WKH GHFLVLRQ WDNHQ LQ WKH UG PHHWLQJ RI
WKH 1'& KHOG RQ WK 0D\ WR LQFHQWLYL]H WKH VWDWHV WR HQKDQFH SXEOLF LQYHVWPHQW WR DFKLHYH
the envisaged 4 percent growth rate in agriculture and allied sectors during 11th plan with an outlay
of `FURUHV7KHVFKHPHDLPVWRDVVLVWVWDWHVWRDFKLHYHDTXDQWLDEOHLQFUHDVHLQSURGXFWLRQ
productivity and farm income and to reduce the yield gaps in the agriculture and allied sectors. The
allocation for Kerala during 2008-09 to 2010-11 is shown in Table 6.12.
Kerala State Planning Board
139
TabIe6.12
AIIocation under RKVY
(`in crore)
Year Kerala India % for Kerala
2008-09 60.11 3165.67 1.90
2009-10 110.92 4067.07 2.73
2010-11 192.35 6055.04 3.18
2011-12 225 - -
6.59 During 2008-09, an amount of `57.73 crores was released and the total expenditure was
`29.60 crores. During 2009-10,an amount of `110.92 crores was sanctioned ,out of which `30 crore
was meant for the implementation of projects sanctioned during 2008-09. The expenditure was only
Rs. 47 crores and the unspent balance is `63.92 crores. During 2010-11, an amount of `120.22 crore
was released and total expenditure was `100.86 crores. The share of allocation for Kerala is very low
compared to the budget provision for the country. A number of very small schemes are included for
DVVLVWDQFHXQGHU5.9<LQWKHVWDWH0RUHIRFXVHGDUHDVZLWKODUJHUSURMHFWVKDYHWREHLGHQWLHGIRU
VXSSRUWXQGHU5.9<7KHSUHSDUDWLRQRIGLVWULFWDQGVWDWHDJULFXOWXUHSODQVDUHDSUHUHTXLVLWHIRUJHW-
ting assistance for which concrete steps are required. Most of the documents prepared are a compila-
WLRQRISURSRVDOVIRUDVVLVWDQFHXQGHU5.9<7KHVWDWH$JULFXOWXUDOSODQDOVRKDVWREHSUHSDUHGIRU
DYDLOLQJDVVLVWDQFHXQGHU5.9<
$ZRUNLQJJURXSRQGHFHQWUDOL]HGSODQQLQJLQ$JULFXOWXUHZDVFRQVWLWXWHGE\WKH3ODQQLQJ&RP-
PLVVLRQIRUWKHSUHSDUDWLRQRIVWDWXVDQGZD\IRUZDUGIRUWKHLPSOHPHQWDWLRQRI5.9<LQWK)LYH<HDU
Plan. The major recommendations of the working group are shown in Box 2.
Economic Review 2011
140
Box 2
Major recommendations of the working group on decentraIized pIanning focus-
ing on RKVY
$QQXDO$JULFXOWXUDOSODQDORQJZLWKVWDWHSODQPD\EHSUHSDUHGDQGQDO\VHGLQWKH
6WDWH SODQ GLVFXVVLRQ KHOG LQ 3ODQQLQJ &RPPLVVLRQ$IWHU QDOL]DWLRQ RI WKH SODQ
projects to be approved by the SLSC.
5HDOLVWLFUHVRXUFHHQYHORSHWREHVSHFLHGIRUWKHSUHSDUDWLRQRIGLVWULFW$JULFXOWXUDO
plan.
6WUHQJWKHQLQJRIGDWDEDVHDWGLVWULFWDQGVXEGLVWULFWOHYHO
6WUHQJWKHQLQJRIFDSDFLW\EXLOGLQJIRU35,VDQGIRU&'$3SUHSDUDWLRQ
)RFXVRQDJURFOLPDWLFDSSURDFKLQDGHFHQWUDOLVHGSODQQLQJIUDPHZRUNWRRSWLPL]H
outputs and to reduce yield gaps.
5HYLVH&'$3VDIWHURUJDQL]LQJFRQVXOWDWLRQLQUHJLRQVRIWKHGLVWULFWVWRVSHHG
up the process.
)RUWKHRSHUDWLRQDOLVDWLRQRI&'$3VWKHSURFHVVRIRSHUDWLRQODLVDWLRQRIYH\HDU
plan of the state could be adopted.
&RQYHUJHQFHRIH[LVWLQJ&66DQGVWDWHVFKHPHVKDVWREHHQVXUHG
35,VVKRXOGEHLQYROYHGLQWKHLPSOHPHQWDWLRQRIWKH&'$3V
,Q RUGHU WR SURYLGH PRUH IRFXV 5.9< PD\ EH UHVWULFWHG WR ]LOOD SDULVKDG'LVWULFW
Panchayat.
)ODJVKLSSURMHFWVPD\EHSUHSDUHGLQRUGHUWRDYRLGWKLQVSUHDGLQJRIUHVRXUFHV
'LVWULFWSURMHFWFRRUGLQDWLRQDQGPRQLWRULQJFHOOPD\EHHVWDEOLVKHGDORQJZLWKVWDWH
project coordination and monitoring cell.
,QFHQWLYHV IRU VXFFHVVIXO LPSOHPHQWDWLRQ RI &'$3V PD\ EH SURYLGHG WR WKH EHVW
SHUIRUPLQJYHGLVWULFWV
Source: Planning Commission, 12th plan working group, 2011
Support to State Extension Programme
6.61 A CSS on support to State Extension Programme for extension reforms was launched in
March 2005 with the objective of making extension system farmer driven by way of promoting new
LQVWLWXWLRQDODUUDQJHPHQWVYL]$70$IRUWHFKQRORJ\GLVVHPLQDWLRQDWGLVWULFWOHYHODQGEHORZ'XULQJ
2010-11, an amount of `60 lakh was provided for SAMETI and the expenditure was `60 lakh. During
2010-11, an amount of `442 lakh was earmarked for programmes as a part of strengthening agricul-
tural extension. Even though a convergence approach is envisaged in the scheme, more needs to be
GRQHWRUHDOL]HWKHREMHFWLYHV$ORQJZLWK$70$DHOGYLVLWRULHQWHGH[WHQVLRQV\VWHPDOVRKDVWREH
implemented to develop the agriculture sector of the state. The extension system needs a thorough
UHVWUXFWXULQJ$70$FRXOGEHXWLOLVHGDVDQLQVWLWXWLRQWRFKDQQHOL]HIXQGLQJIURPYDULRXVVRXUFHV7KH
newly introduced lead farmer centered extension advisory and delivery service (LEADS) to be imple-
PHQWHGXQGHUWKH$70$IUDPHZRUNZLWKHOGYLVLWRQDUHJXODUEDVLVLQPRUHGLVWULFWV
6.62 The department of Agriculture has entrusted IRMA for the evaluation of present status of ATMA.
The major recommendations of the study are shown in Box 3.
Kerala State Planning Board
141
Box 3
Major ndings and recommendations of the study on ATMA
The study showed that there is lot of scope for improvement in creating the knowIedge
pooI to heIp farmers in accepting agricuIturaI technoIogy, providing information on mar-
ket, price, demand, infrastructure and opportunities outside agriculture sector, creating aware-
ness on policies and use of information technology. There is a need for inter district learn-
ing and collaboration to strengthen the competencies. Access to information on technologies,
SULFHVPDUNHWQHHGVLPPHGLDWHDWWHQWLRQ$70$QHHGVWRLQWHUQDOL]HWKHEHQHWVRILQWHUQHW
based information infrastructure and organic farmer centric services.
6WUHQJWKHQLQJRI$70$DQG6$0(7,ZLWKDGHTXDWHVWDIILQWKHHVVHQWLDOHOHPHQWLQUHYLWDO-
L]LQJWKHVHRUJDQL]DWLRQV
7KHIDUPHUVDGYLVRU\FRXQFLOVDWVWDWHDQGGLVWULFWOHYHOWREHFRQVWLWXWHG
7KH IXQFWLRQLQJ RI IDUPHUV DGYLVRU\ FRXQFLOV DW EORFN OHYHO QHHGV VWUHDPOLQLQJ LQRUGHU WR
encourage participation of the nominated farmers. They need training inorder to appreciate
their role in preparation of block level extension plans and annual work plan.
6$0(7,WREHKHDGHGE\TXDOLHGSHUVRQZLWKVXLWDEOHUHVHDUFKH[SHULHQFHDQGDFDGHPLF
orientation.
1HLWKHUWKHVHOHFWLRQRIIDUPVFKRROVQRUWKHGHPRQVWUDWLRQIDUPVDUHGRQHLQFRQVXOWDWLRQ
ZLWKRULQUHVSRQVHWRGHPDQGVIURPIDUPHUV,WLVYHU\GLIFXOWWRXQGHUVWDQGZKDWEHVWSUDF-
tices a particular farm school is propagating or new technologies or production techniques
a demonstration farm is demonstrating. While some of the farm schools and demonstration
farms especially the ones operated by best farmer awardees do display best practices and
GHPRQVWUDWHQHZPHWKRGVWKH\DUHSRRUO\LQWHJUDWHGZLWKWKHSRWHQWLDOEHQHFLDULHVZKR
could learn from them.
7KHQXPEHURIJURXSVRUJDQL]HGIDUPHUVFRYHUHGDQGWKHDUHDXQGHUVSHFLFFURSVQHHG
congruence.
3DUWLFLSDWLQJDQGERWWRPXSDSSURDFKHVDUHQRWIROORZHGLQWKHSUHSDUDWLRQRI65(3DQG
Annual work plan. While ATMA programme focus on extension, the requirements of farm-
ers for inputs, irrigation, credit, storage, transport and market access also needs to be ad-
GUHVVHG&RPSUHKHQVLYHHIIRUWLQFROODERUDWLQJZLWKDJHQFLHVHVSHFLDOO\[Link]
co-operatives are not observed.
7KHUH LV D QHHG IRU V\VWHPDWLF HIIRUW WR LPSURYH VXSSO\ FKDLQ IRU WKH IDUPHUV DQG IDUPHU
groups.
$70$LVLOOHTXLSSHGWRSURYLGHIDUPHURULHQWHGDFWLYLWLHV
7KHUHLVDQHHGWRFRQFHSWXDOLVHGHVLJQDQGGHYHORS0,6SODQIRU$70$
6XLWDEOHFRQYHUJHQFHSODQWREHIRUPXODWHGDW6WDWHOHYHOWRFRRUGLQDWHVHUYLFHVUHQGHUHG
WKURXJK1H*[Link]$JPDUNQHW
Source: IRMA 2011
Supplies and Services
6.63 The State has a strong network for supplies and services. This includes Krishi Bhavans in all
the Grama panchayats for transfer of technology and organising agricultural services. Planting ma-
terial delivery system has been developed which includes 33 state seed farms, 10 district farms, 10
special farms and 8 coconut nurseries. The paddy seed farms and the District Agricultural Farms are
under the control of the District Panchayats for facilitating appropriate seed planning at the grass root
level. Inspite of such elaborate progeny support, supply of quality seeds of paddy and other seasonal
crops remain as a weak link in the production front
Economic Review 2011
142
Agricultural Research and Education
6.64 The research support for sustainable development of agriculture sector in the state is ren-
dered by Kerala Agricultural University in a participatory mode in close association with research
institutions managed by Indian Council of Agricultural Research, Commodity Boards and Departments
RIWKH6WDWHDQG&HQWUDO*RYHUQPHQWV2YHUUHVHDUFKSURMHFWVDUHFXUUHQWO\LQRSHUDWLRQLQFOXG-
ing 67 All India Coordinated Projects/Network Projects, 110 other externally aided projects and 174
projects funded by Govt. of Kerala (Source : KAU 2012).
Livestock Development
Livestock has been an integral component of Indias agricultural and rural economy since time im-
memorial supplying energy for crop production in terms of draught power and organic manure and
in turn deriving their own energy requirements from crop byproducts and residues. The advances in
bio-chemical and mechanical technologies along with structural changes in agriculture and food con-
sumption patterns, however have weakened the synergy between livestock and crops and livestock
are now more valued as source of food.
6.66 Demand for animal food products is responsive to income changes and is expected to increase
in future. The growth in livestock sector is demand driven, inclusive and pro-poor. Incidence of rural
SRYHUW\LVOHVVLQVWDWHVZKHUHOLYHVWRFNDFFRXQWVIRUDVL]HDEOHVKDUHRIDJULFXOWXUDOLQFRPHDVZHOODV
employment. More over livestock production activities are largely in the hands of women. The rapidly
increasing demand for livestock products creates opportunities for their empowerment.
6.67 Indias livestock sector is one of the largest in the world. It has 56.7% of worlds buffaloes 12.5%
cattle, 20.4% small ruminants, 1.5% pigs and 3.1 % poultry. In 2010-11, livestock generated output
comprised 4% of the GDP and 26% of the agricultural GDP.
Kerala State Planning Board
143
6.68 In Kerala also livestock production has been traditionally practiced mainly as an extensive, low
input subsistence system integrated with crop production. It is livelihood intensive and also a major
contributor to Gross State Domestic Product (GSDP), it could be as high as 40 percent of the agricul-
tural GSDP in Kerala. Livestock sub sector is expected to emerge as an engine of agricultural growth
in the 12th plan and beyond in view of rapid growth in demand for animal food products.
Trend in Livestock Population
6.69 Cattle population in Kerala which was 33.96 lakh in 1996 declined to 21.22 lakh in 2003 and
further to 17.40 lakh by 2007. The crossbred cattle population which stood at 22.87 lakhs (67%) as
per 1996 Census decreased to 17.35 lakh numbers and in percentage terms increased to 82% by
2003. It further declined to 16.21 lakh numbers and in percentage terms increased to 93% in 2007.
This increase in proportion of crossbred population was made possible by expanded health care facili-
WLHVDQGDUWLFLDOLQVHPLQDWLRQVHUYLFHVDYDLODEOHLQWKH6WDWH
6.70 Total number of goats as per 18th LSC is 17.29 lakh as against 12.13 lakh in the 17th LSC re-
cording an increase of 42.5%. The poultry population is recorded as 130.94 lakh in the 18th census
as against 122.16 lakh in the 17th LSC.
Fig. 6.6
Fig. 6.7
Economic Review 2011
144
Trend in Production of Major Livestock Products
6.71 Total milk production in the state which was 24.20 lakh tonnes in 2003 declined to 21.11 lakh
tonnes in 2004 and then began to increase in the subsequent years. It increased to reach to 25.37
lakh tonnes in 2009-10 and to26.43 lakh tonnes in 2010-11. Even then the gap between require-
ment and production continues to remain unfavourable. At the same time, over the period, at national
level the milk production has been continuously increasing. Contribution of Kerala to national milk
production which was 2.4 percent during 2003-04 showed a declining trend and reached 2.25 percent
by 2009-10 and then to 2.16 percent during 2010-11. The gap between the production and require-
ment of egg is also increasing at an alarming rate. Concerted efforts of the State to increase the egg
production have begun to show signs of improvement. Egg production which was 1379 Million Nos in
2007-08 increased to 1633 M. Nos in 2009-10 and to 1685.6 [Link] in 2010-11; an increase of 3.22
percent over the previous year. Though meat production is increasing over the years, it cannot cater
to the demand fully. Poultry meat production increased from 15482 tonnes in 2009-10 to 16153 tonnes
in 2010-11 and meat other than poultry meat from 102026 tonnes in 2009-10 to 108398 tonnes in
2010-11 registering an increase of 4.33 percent and 6.24 percent respectively over the previous year.
The average annual growth rates of milk and egg production in Kerala and India for the period from
1950-51 to 2010-11 are given in Table 6.13.
TabIe6.13
Average AnnuaI Growth Rate of MiIk and Egg Production
[Link]. Year
Milk
Egg
Kerala India Kerala India
1 1950-51 to 1960-61 2.50 1.64 NA 4.63
2 1960-61 to 1970-71 2.52 1.15 NA 7.91
3 1970-71 to 1980-81 12.52 4.51 NA 3.79
4 1980-81 to 1990-91 6.41 5.50 4.89 7.70
5 1990-91 to 2000-01 4.24 4.16 2.75 4.59
6 1997-98 to 2001-02(IX
Plan period)
3.78 4.32 (-) 0.22 7.09
7 2001-02 to 2006-07(X
Plan period)
- 1.86 3.64 -9.75 5.52
8 2006-07 to 2010-11 6.12 4.78 8.03 6.39
Source: Based on Sample Survey reports of Animal Husbandry Department
6.72 The dairy sector in Kerala could maintain a higher growth rate of 4.24 per cent in the 1990s,
compared to the national level of 4.16 per cent, in spite of a weak fodder base. In the Ninth Plan period
the growth rate of milk in Kerala declined to 3.78 per cent but that of India increased to 4.32 per cent.
During the period 2001-02 to 2006-07, a negative growth rate was recorded in the milk production of
Kerala (- 1.86%) and at all India level the growth rate declined to 3.64 per cent. For the period 2006-07
to end of 2010-11 a recovery has been marked in milk production of Kerala with a growth rate of 6.12
percent, a highest rate in recent years. This is also reasonably high rate compared to 4.78 at all India
level.
6.73 Egg production in Kerala, which recorded a growth rate of 4.89 per cent during 1980 81
to 1990-91, declined gradually and by the period 1997-98 to 2001-02 (IX Plan Period) it reached a
negative growth rate of 0.22 % and further declined to -9.75% during 10th plan period. Contrary to this
Kerala State Planning Board
145
adverse trend, our state achieved a growth rate of 8.03 per cent in egg production during 2006-07 -
2010-11 period. At all India level, though the growth rate during 9th plan was 7.09 per cent, it declined
to 5.52 per cent in 10th plan period and recorded a slight increase to 6.39 percent during 2006-07
2010-11 period.
Dairy development
India continues to be the largest producer of milk in the world with a total production of 122.5 million
tons (provisional) in 2010-11 and the per capita availability of milk stood at 273 gm/day.
6.75 Though the per capita availability of milk is low compared to world average a substantial increase
in this regard was attained over a period of 10years, from 213gm/day to 273 gm/day. This increase
WRJHWKHUZLWKDWWDLQPHQWRIQHDUVHOIVXIFLHQF\LQPLONDQGPLONSURGXFWVKDVEHHQDFKLHYHGPDLQO\
on account of the tremendous amount of marketing support and technical inputs provided and the
infrastructure developed in the country through the network of cooperatives. More than 50 per cent of
the milk in the country is produced by small and marginal farmers and landless labourers, producing
about one to three litres of milk per day. The year wise estimate of production is shown in Table 6.14.
6.76 In spite of Indias position as highest producer of milk, productivity per animal is very poor. At
the national level it is only 987 Kg/lactation as compared to the world average of 2038 Kg/lactation.
This is mainly due to poor level of nutrition as well as low genetic potential for milk production and
KHDOWKFDUH$PRQJWKHPDMRUVWDWHVLQ,QGLDWKHUHDUHVLJQLFDQWLQWHUVWDWHGLIIHUHQFHVLQWKHSURGXF-
tivity of cows and buffaloes. As per the available estimates milk yield/day of exotic cows were highest
in Punjab(8.431 Kg), followed by Gujarat (8.057kg) Kerala(7.508 kg) and Andhra Pradesh (7.385kg).
At the same time the yield/day of exotic breeds in Karnataka is 6.312kg and Tamil Nadu is only
5.890kg. Among these states highest yield of non descript cow is of Gujarat (3.401kg) followed by
Tamil Nadu(2.762kg), Kerala (2.629 kg), Punjab (2.505kg), Karnataka (2.240kg) and Andhrapradesh
(1.813kg). The average yield/day of buffaloes is highest in Punjab (7.425 kg) followed by Kerala
(6.242 kg), Tamil Nadu (4.222 kg) and Karnataka (2.481 kg). In general the milk yield of both cows
and buffaloes were lowest in Assam.
TabIe6.14
Year-wise Estimate of MiIk production
SI.
No.
Year Milk Production ( lakh tonnes ) % contribution
of Kerala
India % change over
previous year
Kerala % change over
previous year
1 2003-04 881 1.6 21.11 -12.8 2.4
2 2004-05 925 4.9 20.25 -4.1 2.2
3 2005-06 971 5.0 20.63 1.9 2.1
4 2006-07 1009 3.91 21.19 2.7 2.1
5 2007-08 1048 3.86 22.47 6.04 2.2
6 2008-09 1086 3.57 24.51 9.08 2.38
7 2009-10 1125 3.59 25.37 3.57 2.26
Economic Review 2011
146
SI.
No.
Year Milk Production ( lakh tonnes ) % contribution
of Kerala
8 2010-11 1225* 8.89 26.43* 4.18 2.16
Source: Economic Survey and Department of Animal Husbandry *provisional
6.77 Trend in year-wise milk production of Kerala from 2000-02 to 2010-11 is given in Fig.6.8.
Fig. 6.8
0
5
10
15
20
25
30
2001-02 2002-03 2003-04 2004-05 2005-06 2006-07 2007-08 2008-09 2009-10 2010-11
27.18
27.18
21.11
20.25
20.63
21.19
22.47
24.51
25.37
26.43
(
L
a
k
h
t
o
n
n
e
s
)
Milk Production of Kerala (2001-02 to 2010-11)
5HJDUGLQJWKHSHUFDSLWDDYDLODELOLW\RIPLONEDVHGRQJXUHVIRUWKHVRXWKHUQVWDWHV
YL]$[Link]$QGKUD3UDGHVKUDQNVUVWZLWKDQDYDLODELO-
ity of 342gm/day and Tamil Nadu ranks second with 237gm/day. Among the four states, Kerala has
WKHORZHVWJXUHRIJPGD\6HH$SSHQGL[$PRQJWKHPDMRUVWDWHVDWDOO,QGLDOHYHO3XQMDE
UDQNVUVWZLWKJPGD\DQGWKHORZHVWLQWKHFDVHRI$VVDPZLWKJPGD\)LJXUH
Fig. 6.9
Kerala State Planning Board
147
Better Management of Young Calves
6.79 The calf rearing programme by subsidising cattle feed for rearing cattle up to 32 months along
with health cover and insurance has been under implementation from Eighth Plan onwards. During
2006-07 the scheme was extended to buffalo calves also as a measure to curtail the drastic reduction
in the buffalo population. During 2010-11 37223 calves were enrolled of which 423 are buffalo calves.
Year wise details from 2003-04 onwards are furnished in Table 6.15.
TabIe6.15
Year-wise DetaiIs of CaIves EnroIIed under SpeciaI Livestock
Breeding Programme (2003-04 to 2010-11)
SI. No Year No. of caIves enroIIed
Total Cow Buffalo
1 2003-04 23683 23683
2 2004-05 17941 17941
3 2005-06 21819 21819
4 2006-07 21350 21000 350
5 2007-08 23604 21604 2000
6 2008-09 23690 21690 2000
7 2009-10 23000 21000 2000
8 2010-11 37223 36800 423
Source: Animal Husbandry Department
Milk Marketing
6.80 In Kerala as on 31/3/2011 there are 3512 registered primary dairy co-operatives, three Re-
gional Milk Unions and one apex Milk Marketing Federation functioning under KCMMF. The number
RI'DLU\&RRSHUDWLYHVRFLHWLHVLQFUHDVHGWR$3&26DQG1RQ$3&26DWWKHHQGRI
December 2011. During 2010-11 a total of 4280.06 lakh litres of milk was procured by the DCS in the
state of which 2645.91 lakh litres were sent to the dairies and 1634.15 litres were marketed locally
by the societies. The procurement by the DCS is only about 14-16% of the total estimated production
during 2010-11.
2I WKH GDLULHV UHJLVWHUHG LQ WKH 6WDWH DUH LQ WKH &RRSHUDWLYH 6HFWRU 0LOPD DQG WKH
remaining 9 are run by private/charitable societies. There are also about 25 small dairies which are not
registered.
6.82 MILMA represents more than 8.50 lakh dairy farmers through more than 3000 Anand Pattern
Co-operative Societies by March 2011. Under KCMMF there are 13 milk processing plants with a
combined processing capacity of 11.40 lakh litres per day and 7 milk chilling plants support the pro-
curement of milk. Apart from this there are two cattle feed plants, one milk powder plant and a training
FHQWHU2IWKHWRWDO$3&2VUHJLVWHUHGRQO\DUHIXQFWLRQDO7KHDYHUDJHPLONSURFXUHG
SHUGD\E\$3&26GXULQJWKH\HDUZDV07DJDLQVWWKHSUHYLRXV\HDUDYHUDJHRI07
6.83 The procurement /day/society during 2010-11 is 309 litres/day and during 2009-10 it was 325
litres /day.
6.84 In Kerala, where the production of milk is concentrated in the small farm sector and ultimate
supply is dependent on seasonal factors, maintaining uninterrupted supply particularly during lean
SHULRGLVYHU\GLIFXOW7KH)HGHUDWLRQLVWKXVIRUFHGWRLPSRUWPLONIURPWKHQHLJKERXULQJVWDWHVGXULQJ
Economic Review 2011
148
lean periods when the internal supplies used to shrink. The procurement of milk by KCMMF stood
at 2350.87 lakh litres against the sale of 3975.61 lakh litres during 2011 showing a wide gap between
procurement and supply. Data on procurement and sale of milk by different dairies of KCMMF during
2008 to 2011 is given in Appendix 6.41.
6.85 Apart from collecting milk from societies round the year MILMA provides other sup-
port systems like supply of compounded cattle feed, veterinary care, support for fod-
GHU GHYHORSPHQW DFWLYLWLHV DQG RUJDQL]H WUDLQLQJ LQ DOO DVSHFWV RI FDWWOH PDQDJHPHQW DQG
society management. Besides milk, a variety of milk products are manufactured by KC-
MMF. Performance of KCMMF from 2007-08 to 2010-11 are furnished in Appendix 6.40.
6.86 The procurement and selling price of milk has been revised in Kerala wef 5-9-2011. The average
quality of milk procured in the state is 4.1% fat and 8.3% SNF and the procurement price paid for the
same is Rs. 23.69 per litre. Price revision details of milk and price spread of milk from 2008 onwards
is given in Appendix 6.43 and 6.44 respectively
Kerala Dairy Farmers Welfare Fund Board
6.87 The dream pension to dairy farmers was realised through promulgation of an ordinance to
IRUP'DLU\)DUPHUV:HOIDUH)XQG%RDUGRQ$XJXVWWKWKLVEHLQJWKHUVWRQHLQ,QGLDLWVHOI
As per the KDFWF Act 2007, the Board has formulated a comprehensive social welfare scheme for
the members called Ksheera Deepam. Total number of members enrolled in KDEWF till 31/3/2011 is
1.94 lakh. The number of farmers enrolled during 2010-11 is 4854. Now 28171 eligible dairy farmers
are receiving regular pension @ of Rs. 300/month. Also 1508 nominees of deceased pensioners are
receiving family pension @ of Rs.150/month.
.
Weak Feed and Fodder Base
6.88 With the shift in cropping pattern of Kerala, the area under rice has come down by more than
50 per cent over the last two decades leading to drastic reduction in the availability of straw for feeding
cattle. It is estimated that the state produces only 60 per cent of the roughage requirement for cattle
in Kerala. Special focus has been given to fodder and feed production in Kerala to over come the situ-
ation during Eleventh plan period.
6.89 Perennial fodder varieties like Hybrid Napier and Guinea are widely acceptable to farmers,
and the department is supplying the planting material free of cost to the farmers. Fodder and feed de-
velopment is of prime importance in reducing cost of production and optimising economic return from
the dairy activity and KLD Board and Dairy Development Department have taken up fodder develop-
ment as an important activity right from the beginning. The quantity of seeds supplied by KLD Board
during the period was 79.31MT against 94.13 MT during 2009-10. Production and sale of fodder seeds
by KLD Board for the period from 2004-05 to 2010-11 are given in table 6.16
TabIe6.16
Production and SaIe of fodder seeds by KLD Board
[Link]. Year Quantity of Seeds Produced
(MT)
Quantity of
Seeds Supplied* (MT)
1 2004-05 13.89 10.88
2 2005-06 6.53 24.36
3 2006-07 14.80 15.52
Kerala State Planning Board
149
4 2007-08 46.80 44.41
5 2008-09 52.40 45.43
6 2009-10 74.75 94.13
7 2010-11 177.3 79.31
Source: KLD Board Annual Reports
6.90 During 2010-11, under department programmes 4.72 lakh MT fodder was produced using fod-
der slips/stem cuttings and the area covered is 3109 ha. An increasing trend is prevailing over the last
three years in the total area brought under fodder cultivation through department programmes (see
7DEOH7KHDUHDFXOWLYDWHGZLWKPDL]HDQGVRUJKXPZDVKD$OVRODNKIRGGHUWUHH
VHHGOLQJVDQGD]RODNLWVZHUHVXSSOLHGGXULQJWKHSHULRG
TabIe6.17
Procurement & SuppIy of Fodder seeds / Root SIips and Area Covered under
Fodder CuItivation
[Link]. Year Procure-
ment of
seeds
Total
quantity
of seeds
supplied
to farmers
Area covered Fodder root
slips/stem
cuttings sup-
plied (No)
Area
covered
Total area
covered
under fod-
der cultiva-
tion
( in MT ) ( in MT ) ( in Ha ) ( in lakh ) ( in Ha ) ( in Ha )
1 2003-04 4.80 4.48 1798 282.5 1412.5 3210.5
2 2004-05 Nil Nil Nil 375 1840 2230
3 2005-06 Nil Nil Nil 240 1600 1600
4 2006-07 22.5 22.5 250 246 1640 1890
5 2007-08 NA NA 621 NA 1770 2391
6 2008-09 15.24 15.24 381 270.75 2235 2625
7 2009-10 N.A 9.32
(Short
duration
crops)
233 318 2650 2883
8 2010-11 NA 41.2
0DL]H
Sorghum)
1134 186.54 3109 4243
Source: Dairy Development Department
6.91 Kerala farmers have adjusted to the situation by restricting the number of cattle and that too
by preferring to maintain high yielding cross breeds. This is evident from the steady increase in the
proportion of crossbred animals, which Kerala achieved during the last three decades. (see Appendix
6.23).
Breeding Support
6.92 Regarding breeding infrastructure, India is among the countries having the largest breeding
LQIUDVWUXFWXUHLQWKHZRUOGZLWKEXOOVHPHQVWDWLRQVIUR]HQVHPHQEDQNVDQGPRUHWKDQ
AI Centres. Due to poor quality semen produced by most of the semen stations in the country, the
Economic Review 2011
150
conception rate ranges from 20 per cent to 45 per cent only where as in the developed countries the
rate is more than 50 per cent.
6.93 Kerala Livestock Development Board (KLDB) is involved in the production and distribution of
IUR]HQVHPHQ&RPSDUHGWRVHPHQSURGXFWLRQGHFUHDVHGWRODNKGRVHVIURP
lakh doses during 2010-11. The distribution inside and outside the State increased from 17.17 lakh
doses to 17.44 lakh doses and from 2.65 doses to 3.00 lakh doses respectively during this period.
Details are furnished in Appendix 6. 35.
6.94 The number of AI centres in the state as on 31-03-2011 was 2977. Department/Institution wise
details are furnished in Appendix 6.36
6.95 The number of inseminations done during 2010-11 was 13.87 lakh and calving recorded was
3.69 lakh. This is against 3.27 lakh calvings recorded out of 12.99 lakh AI during 2009-10. The aver-
age number of inseminations needed for producing one calf is 3.76. The quality of AI is not improving
DQGVRPHDVXUHVWRLPSURYHWKHTXDOLW\RIVHPHQVXSSOLHGRUWRQGRXWUHDVRQVIRUWKLVSKHQRPHQRQ
is to be initiated in future.(Table 6.18)
TabIe6.18
Number of ArticiaI Inseminations Conducted and recorded CaIving
[Link]. Year 1RRIDUWLFLDO
Insemination
Centres
No. of
$UWLFLDO
Insemina-
tions done
No of AI
Done
Per centre
Recorded
Calving
No of
insemina-
tions
per calving
1 2 3 4 5 6 7
1 2003-04 2538 1231407 485 353764 3
2 2004-05 2445 1176318 481 357718 3
3 2005-06 2445 1179801 483 355011 3
4 2006-07 2541 1204000 474 383000 3
5 2007-08 2550 1075000 443 358457 3
6 2008-09 2562 1216932 475 405644 3
7 2009-10 2577 1298550 503.9 326700 4
8 2010-11 2561 1387457 541.76 368925 3.76
Source: Animal Husbandry Department
$SDUWIURPWKHIUR]HQVHPHQWHFKQRORJ\./'%RDUGLVDOVRHQJDJHGLQUHVHDUFKDQGGHYHO-
opment activities like progeny testing, embryo transfer, production of liquid nitrogen, fodder seed and
training programmes. During the year, the Board has produced 182 Malabari kids, 45 boer goats,
Kerala State Planning Board
151
collected 32 embryos and trained 949 personnel. During the year under review, they distributed 454
SLJOHWVDQGVROG07RIJUHHQJUDVV2WKHUDFWLYLWLHVRIWKH%RDUGDUHJLYHQLQ$SSHQGL[
6.97 Herd Book Scheme is operated complementary to the Progeny Testing Programme. This
ZRXOGKHOSWRDVVHVVWKHLPSURYHPHQWVKDSSHQLQJLQWKHHOGZLWKUHVSHFWWRWUDLWVWRVXSSRUWWKHHOG
progeny testing programme. So far against the target of 80000 animals, 1,32,456 animals have been
LGHQWLHGDQGUHJLVWHUHGXQGHUWKHSURJUDPPH'XULQJFDOYHVZHUHUHJLVWHUHGXQGHU
the programme. The Scheme covers a breedable population of about 60000 cross bred females
spread around 83 AI Centres. Under the programme farmers are provided with deworming medicines
DQGDGYLFHRQVFLHQWLFDVSHFWVRIFDOIUHDULQJ
Cattle Feed
6.98 At present the State has three cattle feed plants functioning at Pattanakkad and Malampu-
]KDZLWKDFRPELQHGSURGXFWLRQFDSDFLW\RI07GD\[Link])HHGV/[Link]
D SURGXFWLRQ FDSDFLW\ RI 07GD\ 7KH SURGXFWLRQ RI WKH WKUHH SODQWV LV LQVXIFLHQW WR PHHW WKH
demand of cattle feed in the state. The new projects of Kerala Feeds Ltd are nearing completion. The
proposed 300 MT/day cattle feed plant at Karunagappally is expected to ensure better availability of
cattle feed to dairy farmers in southern Kerala. The erection of plant & machinery and civil construc-
tion for the plant have been completed and production at the plant is expected to commence shortly.
The mineral mixture plant project at Athavanad, Malappuram District was completed during the last
QDQFLDO\HDUDQGSURGXFWLRQKDVFRPPHQFHGDWWKHSODQW7KHZRUNRIGHQVLHGIRGGHUEORFNSODQW
project at Muthalamada, Palakkad district is progressing rapidly. Apart from cattle feeds Kerala Feeds
produce other animal feeds like calf starter, rabbit feed etc also to cater to different sectors of the
market.
6.99 During 2010-11, the two plants under KCMMF produced 1.17 lakh MT of cattle feed and sold
ODNK077KHPDMRUFXVWRPHULV$3&26
6.100 The production of cattle feed by Kerala Feeds Ltd., decreased to 2.00 lakh MT in 2010-11
from 2.14 lakh MT in 2009-10. The Company has a good marketing network which includes 400 deal-
ers and 450 Co-operatives. During the review period the production of mineral mixture stood at 137.5
MT against 295.065 MT during 2009-10. Production details of the above cattle feed plants are given
in Table 6.19.
TabIe6.19
Production of CattIe Feed
(in Iakh MT
Factory Production
2006-07 2007-08 2008-09 2009-10 2010-11
Pattanacaud (KCMMF) 0.66
0.52
0.58 0.53 0.56 0.55
0DODPSX]KD.&-
MMF)
0.56 0.47 0.57 0.62
Erode CPA - - - - 0.22
Kerala Feeds Ltd. 1.41 1.81* 1.89* 2.14 1.78
Total 2.59 2 . 95 2.89 3.27 3.17
*including production at Erode
Source :Annual Reports of KCMMF/ Kerala Feeds Ltd.
Economic Review 2011
152
Egg and Meat
6.101 As per estimates available, the per capita availability of egg is very low at 47 eggs/year and
poultry meat is 0.9 kg/year against the world average of 147 eggs and 11 kg poultry meat /year. Gov-
ernment of India has set a target for achieving production of over 52 billion eggs by 2011-12, at a
growth rate of 4.3 per cent.
6.102 Poultry farming for egg production relaying on purchased feed are uneconomic in Kerala.
3RXOWU\UHDULQJRQFRPPHUFLDOOLQHVLVWKHUHIRUHODUJHO\FRQQHGWREURLOHUSURGXFWLRQ7KHHJJSURGXF-
tion which was 2054 million in 1999-2000 continuously declined till 2005-06, but began to increase in
2006-07 and that trend maintained in succeeding years and reached 1686 million nos in 2010-11.
6.103 A factor to be noted in this regard is that over the previous years domestic production of egg
is declining to a lower level than that of 1984 - 85 (See Appendix 6.33). The decline in poultry popula-
tion and hike in cost of feed were the major reason for the decline in production. During 2006-07,
egg production increased by 0.25% to 1199 million nos, in 2007-08, by 15% to 1379 million nos and
in 2008-09 increased by 9.5% to 1510 million nos (See Table 6.20). It again increased by 8% to 1633
PLOOLRQQRVLQDQGE\WRPLOOLRQQRVLQUHHFWLQJWKHIUXLWVRIGHYHORS-
ment support extended to the poultry sector during the Eleventh Five Year Plan period. Trend in Egg
production during the period from 2000-2001 to 2010-11 is given in Fig. 6.10.
Fig. 6.10
0
500
1000
1500
2000
2500
2001-02 2002-03 2003-04 2004-05 2005-06 2006-07 2007-08 2008-09 2009-10 2010-11
2002
1347
1277
1197
1196
1199
1379
1510
1633
1686
(
M
i
l
l
i
o
n
n
o
'
s
)
Egg production of Kerala (2001-2002 to 2010-11)
TabIe6.20
Year-wise Estimate of Egg production
[Link]. Year Egg Production
( million numbers )
% contri-
bution of
Kerala
India % change
over previ-
ous year
Kerala % change
over previ-
ous year
1 2 3 4 5 6 7
1 2003-04 40403 1.46 1277 - 5.20 3.2
Kerala State Planning Board
153
2 2004-05 45201 1.87 1197 - 6.26 2.9
3 2005-06 46166 2.13 1196 - 0.08 2.6
4 2006-07 50663 9.74 1199 0.25 2.4
5 2007-08 53532 5.66 1379 15.01 2.58
6 2008-09 55395 3.48 1510 9.50 2.73
7 2009-10 59844 8.03 1633 8.15 2.73
8 2010-11 62976 5.23 1685.6 3.22 2.67
Source: Economic Survey and Department of Animal Husbandry
Backyard poultry
6.104 Backyard poultry system has good potential in the state. Around 8-10 lakh chicks are being
LQWURGXFHGHYHU\\HDULQWKHVWDWH$SDUWIURP$QLPDO+XVEDQGU\GHSDUWPHQWDQG.63'&DIHZ1*2V
and private farms are also involved. But the system is yet to develop to the required extent.
Poultry Rearing and Kerala State Poultry Development Corporation
6.105 Kerala State Poultry Development Corporation was established in 1989 to give special atten-
tion for the revival of poultry farming. The Corporation had built up a high-tech broiler breeding farm
and hatchery at Kudappanakunnu in Thiruvananthapuram. They also had a feed mill with a capacity
of 20 T/day and now they are producing on an average 6-10 T/day and are supplying feed for all the
farms of Animal Husbandry Dept. Due to the innovative schemes launched during the last four years,
the internal poultry meat production and egg production went up considerably. KSPDC has its own
production, processing and marketing system.
Animal Health Care
6.106 In order to reduce morbidity and mortality, efforts are being made by the State/UT Govern-
ments to provide better health care. For it, a network of 9527 polyclinics/hospitals and 20897 dispen-
VDULHVYHWHULQDU\DLGFHQWUHVDQGDUWLFLDOLQVHPLQDWLRQFHQWUHVVXSSRUWHGE\DERXW
disease diagnostic laboratories are functioning in the country. For the production of vaccines, there are
26 veterinary vaccine production units. The primary emphasis is on clinical services and as a result,
endemic diseases such as Foot and Mouth Diseases (FMD) are still prevalent in India. With increased
trade activity and extensive cross-breeding programmes, the chances of ingress of exotic diseases
into the country have increased. To ensure disease free status and be compatible with the standards
ODLGGRZQE\WKH:RUOG$QLPDO+HDOWK2UJDQLVDWLRQVPDQ\DQLPDOKHDOWKVFKHPHVKDYHEHHQLQLWLDWHG
ZKLFKSURYLGHQDQFLDODVVLVWDQFHWRVWDWHVWRFRQWUROPDMRUOLYHVWRFNDQGSRXOWU\GLVHDVHVLQFOXGLQJ
the new scheme reporting of animal diseases.
Economic Review 2011
154
7KHUHLVDVWURQJQHWZRUNIRUYHWHULQDU\KHDOWKFDUHQRZLQWKH6WDWHFRPSULVLQJ9HWHUL-
QDU\KRVSLWDOVYHWHULQDU\GLVSHQVDULHVYHWHULQDU\SRO\FOLQLFV'LVWULFW9HWHULQDU\&HQWUHV
10 mobile hospitals/dispensaries at district level, 13 district level clinical labs, four diagnostic labs and
other related health care institutions.
6.108 The state is implementing a programme for Foot and Mouth disease control with the as-
sistance of Government of India. Also Brucellosis has now emerged as a new threat to the livestock
wealth of the State. Helminthiasis control also needs attention. Worms and other internal parasites
cause considerable economic loss to the farmers. Data regarding outbreaks, attacks and deaths of
major contagious diseases of animals in Kerala for the period from 2004 to 2011 are given in Appen-
dix. 6.46 .
6.109 Even though vaccinations were carried out, frequent outbreaks were reported which lead to
production loss to farmers. Compared to previous years FM outbreaks and attacks are less in 2010-
11 and no death is reported.
6.110 The reports of minor attacks of major diseases like Anthrax, and Hemorrhagic Septicemia are
also reported. The State has already eradicated the dreadful disease of rinderpest and no outbreak
ZDVUHSRUWHGDIWHU2XWEUHDNRIEODFNTXDUWHUDOVRQRWUHSRUWHGGXULQJ
3URGXFWLRQRI9DFFLQHLQ9HWHULQDU\%LRORJLFDO,QVWLWXWH3DORGH
7KH9HWHULQDU\%LRORJLFDOV3DORGHLVWKHVROHDJHQF\HQJDJHGLQWKHSURGXFWLRQDQGGLVWULEX-
tion of animal vaccine in the state. The production details of vaccines manufactured here are shown
in Table 6.21. Apart from the production of vaccines, the institute is engaged in the manufacture of
diagnostic reagents and other animal health products.
TabIe6.21
Production of Vaccine by Veterinary BioIogicaI Institute (2006-07 to 2010-11)
(Lakh doses)
Sl.
No.
1DPHRI9DFFLQH 2006-07 2007-
08
2008-
09
2009-
10
2010-11
1 2 3 4 5 6 7
1 5'9. 159.50 80.86 118.23 117.22 0
2 5'9) 16.98 3.18 11.60 21.26 23.14
3 )39 5.87 0 0 2.47 3.28
4 '39 23.36 20.33 42.54 39.34 49.65
5 +62LODGMXYDQW 2.04 3.80 1.95 0.35 1.04
6 HS Broth 1.34 1.26 0.62 0.65 0.83
Kerala State Planning Board
155
7 BQ 0.28 0 0.31 0.31 0.41
8 Anthrax 1.02 1.72 2.04 1.01 0.98
9 Duck Pasteuurella
RLODGMXYDQW9DF-
cine
3.21 6.66 20.47 18.84 17.71
Source: Animal Husbandry Department
6.112 Compared to previous year poultry vaccine production during 2010-11 was 169.26 lakh doses
as against138.49 lakh doses during 2009-10 and production of livestock vaccine increased by 43.44%
from 2.27 lakh doses during 2009-10 to 3.26 lakh doses. Number of vaccinations done during 2010-
11 was 16.36 lakh Nos for livestock and 89.03 lakh Nos for poultry. Compared to previous year, vac-
cination to cattle decreased by 45 per cent and vaccination to poultry increased by 0.84 per cent. Anti
5DELHV9DFFLQDWLRQVGRQHLQGRJVGHFUHDVHGIURPODNKWRODNKGXULQJWKH\HDUXQGHUUHSRUW
Details are given in Appendix 6.34
6.113 Compared to 2009-10 production of all vaccins except Anthrax recorded an increase during
DQGWKHUHZDVQRSURGXFWLRQRI5'[Link]
Prices
$YHUDJHSULFHRILPSRUWDQWLQSXWVDQGSURGXFWVRIOLYHVWRFNVHFWRUIRUWKHODVWYH\HDUVLV
presented in Appendix 6.38 and almost all the products are recording increase in prices during the
last two years. Compared to 2007-08 there was increase in the price of all categories of meat dur-
ing 2009-10 and 2010-11. During 2010-11, the highest increase is in the case of Mutton (22.47%),
followed by Beef (15.41%). Compared to 2009-10, the price of fowl-white egg increased by 8.3 per
cent, brown egg by 14.79 per cent and duck egg by 13.95 per cent during 2010-11. Corresponding
increase during the previous year was 19.91%, 13.42% and 11.32% respectively.
2QWKHLQSXWVLGHWKHSULFHRIJUDVVUHFRUGHGGHFUHDVHGXULQJ&RPSDUHG
to previous year, the price of gingili oil cake increased by 7.38%, coconut oil cake by 10.64% and
ground nut cake by 12.63% during 2010-11 and the increase in the price of inputs is a serious threat
to dairy farming. The trend in average prices of livestock products from 2007-08 to 2010-11 are shown
in Fig. 6.11.
Economic Review 2011
156
Fig. 6.11
Financial Performance of Annual Plan 2010-11
6.116 The budgeted outlay for the livestock sector during 2010-11 is `140.50 crore. This includes
`74.15 crore provided for Animal Husbandry and `22.50crore for Dairy Development, against this the
total expenditure is `132.06 crore, ie., 94% of the budgeted outlay of which `117.5 Cr. is the expendi-
ture in Animal Husbandry Sector and `14.55 Cr. in Dairy Development Sector.
6.117 Substantial outlays have been earmarked for livestock development. The activities, by and
large, are centered around health care, breeding support, assistance to dairy co-operative societies for
infrastructure development and purchase of equipment, fodder cultivation and food security schemes.
2XWOD\DQGH[SHQGLWXUHRIVRPHRIWKHPDMRUVFKHPHVDUHJLYHQLQ7DEOH
TabIe6.22
OutIays and Expenditure for Major Schemes under AnnuaI PIan 2010-11 (` lakh)
Sl. No. Name of Scheme Approved outlay Actual ex-
penditure
Expd. as
% to Total
1 2 3 4 5
1 6WUHQJWKHQLQJRI9HWHULQDU\6HUYLFHV 2300 1292.35 56.19
2 Expansion of Cross Breeding facilities 576 566.12 98.28
3 Special Livestock Breeding Programme 1200 1195.24 99.60
4 Commercial Fodder Production Pro-
gramme
300 299.25 99.75
Kerala State Planning Board
157
5 Poultry Farms and Expansion of
Poultry Production Incl. Farms under
KSPDC and Poultry Development
through KSPDC
295 352.32 119.43
6 Commercial Dairy and Milk Shed De-
velopment
600 600.04 100
7 Food Security Project 3300 3247.10 98.4
8 Cattle feed subsidy 450 449.99 100
Food Security Scheme
6.118 For the food security scheme an amount of `3300 lakh was set apart for the animal husbandry
sector and an out lay of `600 lakh was provided for the dairy sector during 2010-11. During 2011-12
also the food security scheme is continuing with a provision of `2450 lakh for the animal husbandry
sector and ` 640 for the dairy sector. Following are the main achievements of the scheme during
2010-11:
1. Introduction of 2700 cattle and 1800 buffaloes in the state under ksheera ganga project.
7RERRVWLQWHUQDOHJJSURGXFWLRQLQWKHVWDWHCFURUHXWLOL]HGIRUSURYLGLQJWZROD\HU3XOOHWVDW
IUHHRIFRVWWREHQHWODNK%3/IDPLOLHV
2UJDQLVHGVFKRROSRXOWU\FOXEVWKURXJKZKLFKFKLOGUHQEHQHWHG
EHQHFLDULHVZHUHJLYHQRQHJRDWDQGRQHPLOFKFRZ
5. Through KSPDC 70000 (4 bird) units established by supplying 4 birds to BPL/APL families.
6.119 Another scheme included under State Food Security Project is for the promotion of Commer-
cial dairy under Dairy Development sector. Through the programme, a transition from subsistence
dairy farming to viable commercial dairy farming, with technology support which is imperative for en-
hancing production and productivity. However a reorientation of the scheme is required considering
the inadequate availability of good quality cattle for purchase from other states, disease invide and
low productivity of some of the breeds, issues in implementation as well as lack of low cost credit. The
National Dairy Plan (NDP) a World Bank funded project with an estimated outlay of Rs.17371 crore
due to start in 2012 envisages increasing productivity of milch animals through provision of good qual-
LW\VHPHQGRRUVWHS$,VHUYLFHVDQGVFLHQWLFIHHGLQJ,PSURYLQJSURGXFWLYLW\LQDKXJHSRSXODWLRQRI
low producing animals is one of the major challenges in livestock sector.
Fisheries Development
6.120 India endowed with a long coast line of 8129 kms, 2.02 million [Link] of exclusive economic
]RQHDQGPLOOLRQKHFWDUHVRIEUDFNLVKZDWHUERGLHVRIIHUVYDVWSRWHQWLDOIRUGHYHORSPHQWRIVKHU-
LHV7KHGHPDQGIRUVKDQGVKHU\SURGXFWVDUHLQFUHDVLQJERWKLQGRPHVWLFDQGH[SRUWIURQWV$ERXW
PLOOLRQWRQQVVKHU\SRWHQWLDODUHHVWLPDWHGIURPPDULQHVHFWRURQO\PLOOLRQWRQQHVDUHWDSSHG
RIWKHVKSURGXFWLRQFRQWULEXWHGE\DUWLVDQDOPHFKDQLVHGDQGPRWRULVHGVHFWRUUHPDLQLQJ
LVFRQWULEXWHGE\GHHSVHDVKLQJ,QGLDKDVEHHQDPDMRUFRQWULEXWRUWRWKHZRUOGPDULQHVKSURGXF-
WLRQDQGVHFRQGODUJHVWSURGXFHURILQODQGVK7KHVRXWKZHVWFRPSULVLQJNHUDODNDUQDWDNDDQGJRD
were the highest contributor among regions and tamilnadu among states (21%) followed by kerala
(20%). The anticipated natural growth rate of the XI plan period is 8.5% against the current growth
UDWHRI3UHVHQWO\VKHULHVDQGDTXDFXOWXUHFRQWULEXWHWRWKHQDWLRQDO*'3DQGWRDJ-
riculture and allied activities.
Economic Review 2011
158
,QNHUDODVKLQJ,QGXVWU\RFFXSLHVDQLPSRUWDQWSRVLWLRQLQLWVHFRQRP\.HUDODVVKDUHLQ
WKHQDWLRQDOPDULQHVKSURGXFWLRQLVDERXW7KHZDWHUUHVRXUFHVRIWKLVVWDWHFRPSULVHRI
a coastline of 590 km length having a continental shelf area of the sea adjoining the Kerala state is
39139 [Link]. Fisheries sector contribute 3% of the GSDP of the state.
6.122 The Inland water bodies of kerala have a prominent role in the socio economic development
RIWKHVWDWH7KHVWDWHLVHQGRZHGZLWKDVLJQLFDQWZHDOWKRILQODQGVKHU\UHVRXUFHV7KHPDMRU
LQODQGZDWHUUHVRXUFHVRIWKHVWDWHKDYLQJPXFKVKHU\LPSRUWDQFHDUHWKHULYHUVKD
reservoirs (44289 ha) and 53 back waters and other brakish water bodies (65213 ha). The polders
of kuttanadu having a water spread of 35000 ha and 17000 ha of kole lands of Thrissur are also very
ideal for various aquaculture development activities.
7KHHVWLPDWHGVKHUIRONSRSXODWLRQRINHUDODGXULQJLVDERXWODNK7KHWRWDO
QXPEHURIVKHUIRONGZHOOLQJLQWKHFRDVWDODUHDLVHVWLPDWHGDWODNK7KHHVWLPDWHGQXPEHURI
VKHUIRONLQDFWLYHVKLQJLQWKHLQODQGVHFWRULVDERXWODNK,WLVDOVRHVWLPDWHGWKDWDERXW
SHRSOHDUHHQJDJHGLQVKHU\DOOLHGDFWLYLWLHV7KLVVKHUPHQRIWKHVWDWHFRQWULEXWHDERXWRI
WKH*6'3IURPWKHDJULFXOWXUHVHFWRUZKLFKVKRZVWKHVLJQLFDQFHRIWKHVHFWRUWRWKHVWDWHHFRQRP\
7KHWRWDOVKHUPHQSRSXODWLRQLQ$ODSSX]KDGLVWULFWLVODNKZKLFKLVWKHKLJKHVWVKHUPHQSRSX-
lated district, followed by Thiruvananthapuram (1.90 lakh) and Ernakulam (1.53 lakh). In the case of
PDULQHVHFWRURQO\WKHKLJKHVWSRSXODWHGGLVWULFWLV7KLUXYDQDQWKDSXUDPIROORZHGE\$ODSSX]KDDQG
.R]KLNNRGH,Q,QODQGVHFWRUWKHKLJKHVWSRSXODWHGGLVWULFWLV(UQDNXODPIROORZHGE\$ODSSX]KDGLV-
WULFW7KHGLVWULFWZLVHGHWDLOVRIVKHUIRONSRSXODWLRQDUHJLYHQLQ$SSHQGL[
Kerala State Planning Board
159
,QFRPHIURPVKHULHVVXEVHFWRU
6.124 The Gross State Domestic Product of the State has increased by about 97% during the period
IURPWRDQGWKHVKDUHRIVKHULHVVHFWRULQWKH6WDWH'RPHVWLF3URGXFWKDVGHFOLQHG
from 1.81 to 1.29 percent in the same period. The share of Primary Sector in GSDP has also declined
IURPWRSHUFHQW7KHFRQWULEXWLRQRIVKHULHVVHFWRULQ*6'3LVJLYHQLQWDEOH
TabIe6.23
Contribution of Fisheries sector to Gross State Domestic Product
(2004-05 Prices)
Current Price Period
1 2 3 4 5 6 7
Category 2005-06 2006-07 2007-08 2008-09 2009-10
Gross State Domes-
tic Product
(` Crore )
136841.76 153784.88 175141.08 202782.79 232381.05 270118.91
Fishing
(` Crore )
2481.96 2644.09 2634.31 2684.13 3120.96 3476.70
6KDUHRIVKHULHV
sector in GSDP
1.81 1.72 1.50 1.32 1.34 1.29
Share of Primary
sector in GSDP
18.05 17.15 16.46 15.99 14.84 14.07
Source: Directorate of Economics and Statistics
6SHFLHVZLVHFRPSRVLWLRQRIVKODQGLQJ
.HUDODLVDFRDVWDOVWDWHDQGLVERUGHUHGRQWKHZHVWE\WKHPDULQHRUDDQGIDXQDULFKDUDELDQ
sea. The Kerala Marine Fisheries Regulation Act was enacted with a view to enforce strict regulatory
measures following the induction of more number of crafts and consequent increase in the level of
XQUHVWULFWHGVKLQJ$FFRUGLQJWRWKLV$FWWKHLQVKRUHDUHDFRPLQJZLWKLQWKHGHSWKUDQJHRIPHWHUV
KDVEHHQGHPDUFDWHGIRUVKLQJE\WKHWUDGLWLRQDOVKHUPHQXVLQJFRXQWU\FUDIWVDQGWKHDUHDEH\RQG
WKHOLPLWLQWKHHFRQRPLF]RQHVFDQEHXWLOLVHGE\PRWRUL]HGERDWVDQGODUJHYHVVHOV$VWKLVUHVWULFWLRQ
is not being strictly followed, monsoon trawling has been banned as a preventive measure. The ban
on monsoon trawling has been in force from 1980 onwards.
0DULQHVKODQGLQJVRI,QGLDLQZDVPLOOLRQWRQHVZKLFKUHFRUGHGDGHFOLQHRIDERXW
1.31 lakh tones compared to the estimate for 2009. Among the states, tamilnadu was the highest con-
WULEXWRURIPDULQHVKIROORZHGE\NHUDOD'XULQJODNKWRQQHVRIPDULQHVKZHUHODQGHG
LQNHUDODVKRZLQJDGHFUHDVHRIODNKWRQQHVRYHUWKHSUHYLRXV\HDU7KHVKFDWFKHV
from the kerala coast include more than 300 different species, the commercially important number is
DERXWRQO\7KHKLJKYDOXHVSHFLHVDPRQJWKHVKFDWFKHVDUHVWLOOIHZSURPLQHQWDPRQJWKHP
DUH6HHUVK3UDZQ5LEERQVKDQG0DFNHUHO'XULQJWKHFDWFKRI5LEERQVKZDV
metric tones and penaeid prawn was 47620 metric tones. The quality of these high value species in the
WRWDOFDWFKXOWLPDWHO\GHFLGHVWKHLQFRPHRIWKHVKHUPHQ2LOVDUGLQHDFFRXQWHGIRUWKHPDMRUVKDUH
of landings (27%), heavy landing of juvenile oil sardine in ring seine was also recorded. The catch
of oil sardine was 151839 metric tonnes during 2010-11, shows a decreasing trend over the previous
years,which is the most important variety consumed mainly by the poorer sections of the society. The
VSHFLHVZLVHPDULQHVKODQGLQJVLQNHUDODIURPWRDUHVKRZQLQ$SSHQGL[
Economic Review 2011
160
Trend in Production
0DULQHVKHULHVWKURXJKRXWWKHZRUOGDUHSDVVLQJWKURXJKDFULWLFDOSKDVHGXHWRWKHSUHVHQW
UDWHRIELRGLYHUVLW\ORVVDQGVKLQJSUDFWLFHV,QGLDQPDULQHVKHULHVLVDOVRSDVVLQJWKURXJKDFULVLV
GXHWRLWVRYHUFDSDFLW\DQGRSHQDFFHVVQDWXUH0DULQHVKSURGXFWLRQLQ,QGLDKDVVKRZHGDGHFOLQ-
LQJWUHQGRYHUWKHSUHYLRXV\HDU(VWLPDWHVRIWKHVKHU\UHVRXUFHVDVVHVVPHQWVKRZVWKDWDPRQJ
WKHPDULWLPHVWDWHVLQ,QGLDNHUDODRFFXSLHVWKHQGSRVLWLRQLQPDULQHVKSURGXFWLRQ7KHVKSUR-
GXFWLRQLQNHUDODGXULQJZDVODNKWRQQHV7KHPDULQHVKHU\UHVRXUFHVRIWKHVWDWHKDV
DOPRVWDWWDLQHGWKHRSWLPXPOHYHORISURGXFWLRQ'XULQJWKHLQODQGVKSURGXFWLRQUHDFKHG
SHDNVKDUHRIRIWKHWRWDOVKSURGXFWLRQRIWKHVWDWHDQGWKHUHDIWHUGHFOLQHGVOLJKWO\$WQDWLRQDO
OHYHOPRUHWKDQRIWKHWRWDOVKSURGXFWLRQLVFRQWULEXWHGE\WKHLQODQGVHFWRU*RYHUQPHQWKDYH
DSSURYHGDPDVWHUSODQIRULQFUHDVLQJWKHLQODQGVKSURGXFWLRQRIWKHVWDWHIURPWKHFXUUHQWOHYHORI
75000 tonnes to 2 lakh tonnes over a period of 10 years. It also aims at enhancing and developing the
aquaculture for the economic and development of the state and ensuring food and livelihood security
RIWKHSHRSOHLQNHUDOD7KHFXUUHQWOHYHORI,QODQGVKSURGXFWLRQLVWRWKHTXDQWXPRIDERXWODNK
tonnes.
6.128 The National Agriculture Policy, which aims to attain a growth rate in excess of four per cent
annum in the agriculture sector, stresses the importance of food and nutritional security issues and the
LPSRUWDQFHRIDQLPDOKXVEDQGU\DQGVKHULHVVHFWRUVLQJHQHUDWLQJZHDOWKDQGHPSOR\PHQW
,QGLDLVRQHRIWKHPDMRUVKSURGXFLQJFRXQWULHVLQWKHZRUOGZLWKWKLUGSRVLWLRQLQVKHULHVDQG
VHFRQGLQLQODQGVKSURGXFWLRQ'XULQJ,QGLDVWRWDOVKSURGXFWLRQZDVPLOOLRQWRQQHV
of which 3.07 million tonnes was from marine sector and 3.75 million tonnes was from Inland sector
)LJ7KHVKHULHVVHFWRUKDVFRQWULEXWHGRIWKH1DWLRQDO*'3DQGRIWKH*'3IURP
Agriculture sector.
Fig.6.12
:KLOHPDULQHVKSURGXFWLRQLQNHUDODWHQGHGWRXFWXDWHWKHLQODQGVKSURGXFWLRQVKRZHGD
VLJQRILPSURYHPHQWIURP'XULQJWKHPDULQHVKSURGXFWLRQKDVGHFUHDVHGWR
5.6 lakh tonnes from 5.70 lakh tonnes of 2009-10. Inland production sustained on increasing trend.
'LVWULFWZLVHPDULQHVKSURGXFWLRQVKRZHGWKDW$ODSSX]KDFRQWULEXWHGWKHKLJKHVWIROORZHG
E\.ROODPDQG.R]KLNRGH'XULQJWKHVKDUHRILQODQGVKSURGXFWLRQWR
WKHWRWDOVKSURGXFWLRQRIWKHVWDWHZDV7KHGHWDLOVRIVKSURGXFWLRQIRUWKHODVW\HDUVDUH
given in table 6.24 and Fig 6.13.
Kerala State Planning Board
161
TabIe6.24
Fish Production in KeraIa during the Iast Five years
(Iakh tonnes)
Year Marine Inland Total
2006-07 5.98 0.80 6.78
2007-08
5.86 0.91 6.77
2008-09
5.83 1.03 6.86
2009-10
5.70 1.17 6.87
2010-11
5.60 1.21 6.81
Source: Fisheries department
Fig.6.13
0.00
1.00
2.00
3.00
4.00
5.00
6.00
5.98
5.86
5.83
5.70
5.60
0.80
0.91
1.03
1.17
1.
P
r
o
d
u
c
t
i
o
n
(
l
a
k
h
t
o
n
n
e
)
Fish production in Kerala (2006-07 to 2010-11)
Export
7KHPDULQHVKHULHVVHFWRULQWKHFRXQWU\FRQWULEXWHVDERXWRIWKHWRWDOVKSURGXFWLRQ
and is one of the major contributors to foreign exchange earnings through sea food export. It con-
VWLWXWH DERXW RI WKH WRWDO DJULFXOWXUH SURGXFWV H[SRUW 2YHU YDULHWLHV RI PDULQH SURGXFWV DUH
exported to different countries in South East Asia, Europe China, Japan and USA.
6.132 The total value of marine products export from the country was 12901.47 crore in 2010-11
which accounts for approximately 1.1% of the total export from India. The quantity of marine exports
from India during 2010-11 was 8.13 lakh tones. When compared to the previous year, it recorded a
growth of 28.39% in rupee terms, 19.85% in volume and 33.95% growth in US$. During 2010-11, the
export earnings have crossed 2.8 billion US dollars and `FURUHPDUN)UR]HQVKULPSLVFRQ-
tinued to be the single largest item of export in terms of value. It accounts 44.32% of the total export
HDUQLQJV7KHRWKHUPDMRULWHPVRIH[SRUWDUH)UR]HQ)LQVKIUR]HQFXWWOHVKHWF
6.133 During 2002-03 and 2003-04 USA emerged as the single largest market for Indias marine
products and during 2004-05, the European union has collectively became the largest importer of
Indian marine products and retained its position since 2005-06. During 2010-11, European union con-
tinued as the largest market with a share of 26.78% in value followed by South East Asia (16.43%),
China (15.41%), USA (15.35%) and Japan (13.06%). The major ports of India to handle the export
cargo during the year in the order of value were Pipavav (16.94%), Kochi (15.61%), JNP (15.54%) and
&KHQQDL([[Link]\DVZHOODVLQUXSHHUHDOL]D-
tion where as there was a decline in US$ terms by 0.69%.
Economic Review 2011
162
6.134 The marine products export from the State during 2010-11 was 1.25 lakh tonnes, an increase
of 16.14% over previous year. It valued at `2002.10 crore constituting 15.33% in terms of volume and
LQWHUPVRIYDOXHWR,QGLDQPDULQHSURGXFWH[SRUW7KHPDMRUH[SRUWLWHPLVIUR]HQVKULPSGXU-
ing 2010-11.
6.135 The states share in all India exports has been declining in recent years. The share declined
from 20% in quantity terms in 2000-01 to 15.33% in 2010-11 and the share in value decreased to
15.52% from 16%. Export of marine products from kerala and India during 2010-11 are given in table
6.25.
TabIe6.25
Export of Marine Products from India and KeraIa
( Q: Quantity in Metric Tonnes V: VaIue in ` Crore)
Year India Kerala Share of Kerala (%)
2006-07 Q
9
612641
8363.53
108617
1524.12
17.73
18.22
2007-08 Q
9
541701
7620.92
100318
1430.94
18.52 18.78
2008-09 Q
9
602835
8607.94
100780
1572.18
16.72 18.26
2009-10 Q
9
678436
10048.53
107293
1670.02
15.81 16.62
2010-11 Q
9
813091
12901.47
124615
2002.10
15.33 15.52
Source : MPEDA
Debt Relief to Fishermen
6.136 Fishing community is one of the most vulnerable sections of our society. A vast majority of
WKHPZKRPDNHRXWWKHLUOLYLQJE\VKLQJLQLQODQGVHFWRURULQWKHVHDKDYHEHHQLQDGHEWWUDS$VD
substantial effort to relieve them from their sufferings Government have constituted The Kerala State
Fishermen Debt Relief Commission with 5 members.
6.137 The Kerala Debt Relief Commission Act, 2008 is expedient to provide for urgent relief to the
VKHUPHQZKRDUHLQGLVWUHVVGXHWRLQGHEWHGQHVVE\FRQVWLWXWLQJDFRPPLVVLRQIRUUHFRPPHQGLQJDS-
SUR[LPDWHUHOLHIPHDVXUHVWRVXFKVKHUPHQDQGIRUVROYLQJWKHLUSUREOHPV)RUH[HUFLVLQJWKHSRZHU
DQGGLVFKDUJLQJWKHGXWLHVXQGHUWKLVDFW7KH.HUDOD6WDWH)LVKHUPHQ'HEW5HOLHI&RPPLVVLRQZLWK
PHPEHUV7KHVFKHPHHQYLVDJHGWRLQWURGXFHGHEWUHOLHIPHDVXUHVIRUWKHHQWLUHHOLJLEOHVKHUIRON
LQWKHVWDWHLQDSKDVHGPDQQHU,WKDVEHHQHVWLPDWHGWKDWVKHUPDQKDYHDGHEWOLDELOLW\RI`524
crore. During the period 2008-09 to 2011-12, an amount of Rs. 36 crore was provided with budget for
GHEWUHOLHIPHDVXUHVWRVKHUPHQDQGDVRQ5VFURUHKDVEHHQUHOHDVHGIRU
this programme.
Major Developmental Programmes
6.138 The major developmental programmes implemented during the Plan period in the state include
LQODQGVKHULHVGHYHORSPHQWGHYHORSPHQWRIVKLQJKDUERXUVDQGODQGLQJFHQWUHVDQGSURJUDPPHV
HQVXULQJVRFLDODQGOLYHOLKRRGVHFXULW\RIVKHUPHQ7KHGHYHORSPHQWDOSURJUDPPHVXQGHUWDNHQLQ
Kerala State Planning Board
163
the marine sector include modernisation of country crafts, popularisation of new generation crafts and
GLVWULEXWLRQRIVXLWDEOHFRPSRQHQWVRIVKLQJJHDUGHYHORSPHQWRIVKLQJPDUNHWVGHYHORSPHQWRI
GHHSVHDVKLQJHWF
Matsyakeralam
6.139 Aqua culture is currently one of the fastest growing food production enterprises in this coun-
WU\,QYLHZRILQFUHDVLQJWKHLQODQGVKSURGXFWLRQRQDVXVWDLQDEOHEDVLVE\VFLHQWLFDOO\XVLQJWKH
9DVW,QODQGVSUHDGDYDLODEOHLQWKHVWDWH*RYHUQPHQWKDYHLQLWLDWHGWKHQHZSURJUDPPH0DWV\D-
keralam during 2008-09. From 2009-10 to 2011-12, the total amount budgeted for this scheme is
Rs.5.50 crore and the expenditure incurred so far is Rs.6.80 crore.
6.140 The backwaters of kerala is most prominent with more than 70 edible species which include
shrimp, mullets, pearl spots, crabs, scampi etc. Matsyakeralam project envisages to diversify aqua-
FXOWXUH IRU HQKDQFLQJ VK SURGXFWLRQ IURP ,QODQG IUHVKZDWHUEUDFNZDWHU7KH PDLQ REMHFWLYH RI WKH
SURMHFWLVWRLQFUHDVHWKHVKSURGXFWLRQIURP07WRODNKPHWULFWRQHRYHUDSHULRGRIWKUHH
years. The total project cost estimated as Rs. 71.16 crore. Through this project it is also aimed to cre-
DWHQHZHPSOR\PHQWRSSRUWXQLWLHVLQUXUDODUHDVWRLQFUHDVHWKHH[SRUWRIVKDQGVKSURGXFWVDQG
to develop a well designed marketing system for aquaculture products.
7KHDFKLHYHPHQWRIWKHSURMHFWGXULQJWKHUVWSKDVHVKRZVDQDPD]LQJUHVXOWHVSHFLDOO\LQ
shrimp and mussel farming. About 2200 tonnes of Shrimp, 2395 tones of mussels and 8 tonnes of
.DULPHHQZHUHSURGXFHGKDYLQJDQDYHUDJHHDUQLQJVRIFURUHDQGEHQHFLDULHVDUHSDUWLFL-
pated in this phase.
,QWKHVHFRQGSKDVHERWKIUHVKZDWHUDQGEUDFNLVKZDWHUVKFXOWXUHWDNHQSODFH,QWKHIUHVK
ZDWHUFXOWXUHWRQHVKVFDPSLZHUHSURGXFHGEHQHFLDULHVDUHSDUWLFLSDWHGLQWKLVFXO-
ture. In the brackish water 2662 tones shrimp were produced. Now 728 local bodies are actively par-
WLFLSDWHGLQWKLVSURMHFWDORQJWKH6WDWHDQGVKIDUPHUFOXEVDUHIRUPXODWHG$WWKHVHFRQGSKDVH
Economic Review 2011
164
of the project about 2795.6 tonnes of shrimp, 3067.36 tonnes mussel and 9.5 tonnes of Karimeen were
harvested having an average earning of `60.08 crore with the support of LSGIs and matsya karshaka
clubs. At the 3rd phase of the project, about 2794 tonnes of shrimp, 3100 tonnes of mussel and 250
tonnes of Karimeen were harvested. The harvest details are shown in table 6.26.
TabIe6.26
Harvest detaiIs of MatsyakeraIam Project
[Link]. Item Quantity obtained in tonnes
I Phase II Phase III Phase
1 Shrimp 2200 2795 2794.1
2 Mussel 2395 3067 3100
3 Karimeen 8 11.6 250
Total 4603 5873.6 6144.1
Source: Fisheries Department
Outlay and Expenditure for 2010-11
7KHRXWOD\DQGH[SHQGLWXUHIRUYDULRXVVFKHPHVLPSOHPHQWHGLQWKHVKHULHVVXEVHFWRUDUH
given in table 6.27. The total expenditure under state plan schemes upto March 2011 is `5682.70 lakh
which accounts 95.57% of the state plan outlay. There are 10 partially aided central sector schemes
having an outlay of `3516 lakh and the expenditure upto March 2011 is `3637 lakh. Additional alloca-
WLRQZDVSURYLGHGIRUVKLQJKDUERXUVDQGVKDUHFDSLWDOFRQWULEXWLRQWR1&'&DVVLVWHGVFKHPHVDQG
thus the expenditure exceeds the outlay provided under Central Sector Schemes.
TabIe6.27
OutIay and Expenditure during 2009-10 and 2010-11 (` in Iakh)
2009-10 2010-11
Name of Sector/Scheme Budget Esti-
mate
Expendi-
ture
Budget
Estimate
Expendi-
ture
1
2
State Plan schemes 6436.01 6798.04 5946.00 5682.70
Centrally Sponsored Schemes 3972.65 3845.73 3516.00 3637.00
NCDC assisted Integrated Fisheries Develop-
ment Project (NCDC loan)
1023.00 1023.00 2000.00 819.00
Integrated Coastal Area Development Project
under Special Area Development Programme
(State Plan)
400.00 0.00 400.00 400.00
TotaI 11831.66 11666.77 11862.00 10538.70
Kerala State Planning Board
165
8QGHU 6SHFLDO $UHD 'HYHORSPHQW 3URJUDPPH D QHZ SURMHFW YL] ,QWHJUDWHG &RDVWDO $UHD
Development project was started during 2007-08. During the period 2007-10 the project was imple-
PHQWHG LQ .DQQXU .DVDUJRGH DQG7KULVVXU GLVWULFWV 7KH SURMHFW LQFOXGH ZDWHU VXSSO\ VK ODQGLQJ
centres, public health center and dispensaries, biogas plant, anganawadies etc. Another agency
namely Coastal Area Development Agency was constituted in 2004, with the aim to accelerate the
SDFHRIGHYHORSPHQWRIWKHFRDVWDODUHDVDQGWRLPSURYHWKHVRFLRHFRQRPLFFRQGLWLRQRIWKHVKHU-
folk in the state. During 2008-09 the Coastal Area Development Corporation Ltd. was reconstituted.
An amount of `9 lakh was allotted as share capital contribution for the corporation. The corporation
DLPVWRIXQFWLRQDVDQDSH[ERG\LQWKHSUHSDUDWLRQRISURMHFWVPRQLWRULQJHYDOXDWLQJDQGQDQFLQJ
infrastructure development in the coastal sector.
1. Integrated Development of Aquaculture
6.145 Kerala is endowed with immense potential of 25000 ha of fresh water and 10,000 ha of brack-
ish water suitable for aquaculture. Germplasm resources of Kerala is rich, suitable for aquaculture.
7KHVFKHPHLQWHJUDWHGGHYHORSPHQWRIVFDPSLVKFXOWXUHLQURWDWLRQZLWKSDGG\LQNXWWDQDGXDQGNROH
lands was started in 2003-04 with the target area of 3500 ha. During 2010-11 an amount of `40 lakh
ZHUHH[SHQGHGIRUWKHLPSOHPHQWDWLRQRIRQHSDGG\RQHVKLQNXWWDQDGDQGNROHODQGV7KHVFKHPH
FRYHUHGDQDUHDRIKDLQNXWWDQDGXDQGNROHODQGV$ERXWWRQVRIVFDPSLDQGWRQVRIVK
were produced during 2010-11 and a revenue collection of `542.5 lakh was achieved. The details of
achievement in oru nellum oru meenum in kuttanad and kole lands from 2004-05 to 2010-11 are given
in table 6.28.
TabIe6.28
Oru NeIIum Oru Meenum in Kuttanad & KoIe Iands
(Achievement)
Year Area covered (ha) 1RRI%HQH-
ciaries
Production Revenue ([Link]
lakh)
2004-05 359.80 547 Scampi - 67.78 ton
Fish - 41.37 ton
186
2005-06 480.65 596 Scampi - 140.46 ton
Fish - 132.61 ton
404
2006-07 505.93 536 Scampi - 136.19 ton
Fish - 181.39 ton
413
2007-08 149.33 408 Scampi - 28.49 ton
Fish - 28.53 ton
60.33
2008-09 178.68 458 Scampi - 51.41 ton
Fish - 77.78 ton
103
2009-10 341.62 418 Scampi - 85.46 ton
Fish - 92.48 ton
142
2010-11 684 2092 Scampi - 182 ton
Fish - 385 ton
542.5
Economic Review 2011
166
,QWHJUDWHG'HYHORSPHQWRI3RNNDOLHOGV
6.146 The project sustainable development of shrimp aquaculture aims at the development of 2500
KDRI3RNNDOLHOGVRI(UQDNXODP7KULVVXUDQG$ODSSX]KDGLVWULFWVGXULQJWKH;WKSODQSHULRG7KH
Shrimp production anticipated was 3000 tons. During 2010-11 an area of 342 ha was brought under
culture and an amount of `20 lakh was provided for the scheme. 336 tons of Shrimp worth `7.69 crore
was produced during the period. The details of shrimp aquaculture production in Pokkali lands from
2005-06 to 2010-11 is given in table 6.29.
TabIe6.29
SustainabIe Shrimp aquacuIture deveIopment in PokkaIi eIds (Achievements)
Year Area covered 1RRIEHQHFLDULHV Production
(ton)
Revenue
achieved by
farmers
(` In lakh)
1 2 3 4 5
2005-06 1488.95 458 444.66 911.45
2006-07 1631.46 425 836.93 1756.07
2007-08 2000 125 198.40 489.66
2008-09 357.17 94 210.9 449
2009-10 152.43 51 149.94 415
2010-11 342 103 336 769
3. RKVY Projects
'XULQJDQDPRXQWRI5VODNKZDVVDQFWLRQHGIRUSURMHFWVXQGHU5.9<
as follows.
1. Renovation of Farms & Hatcheries - 14 Nos.
2. Aquaculture project - 4 Nos.
3. Construction of Aquarium complex - 4 Nos
4. Establishment of Glucosamine complex - 1 No
5. Construction of Harbour - 1 No
4. Fishing Harbour and Fish landing Centres
7KH*[Link]
KDUERXUVDUHLQSURJUHVVLQJ7KHVHDUH&HQWUDOO\6SRQVRUHG6FKHPHV7KHFRPSOHWHGVKLQJ
harbours are Thangassery, Neendakara, Kayamkulam, Munambam, Beypore, Puthiyappa, Chombal,
0RSODED\DQG$]KHHNDO7KHSURJUHVVRIZRUNLQUHVSHFWRIWKHRQJRLQJKDUERXUVDQGVKODQGLQJ
centres are given in Table 6.30.
7KHZRUNVRI3RQQDQL7KRWWDSSDOO\DQG7KDODLVKLQJKDUERXUVZHUHFRPSOHWHGVRRQ)LUVW
SKDVH RI PLQL VKLQJ KDUERXU DW &KHWKL LQ$ODSSX]KD DQG VKLQJ KDUERXU DW .DVDUJRG DUH VWDUWHG
During 2010-11, `ODNKZHUHDOORWWHGIRUWKHFRQVWUXFWLRQRIVKLQJKDUERXUVIRUZKLFK`636.14 lakh
was expended. A budget allocation of `600 lakh were provided for NABARD assisted schemes and
an amount of `130.93 lakh was expended during the year. Modernisation of Neendakara harbour and
construction of Koyilandi and Thalai harbours with NABARD assistance is in progressing.
Kerala State Planning Board
167
TabIe6.30
Ongoing Fishing Harbours in KeraIa
Sl.
No.
Name of
Fishing
Harbour
Total Estimated Cost
(` In Lakhs)
Year
of
Start-
ing
Year of
Com-
pletion
/ target
Cumu-
lative
Expen-
diture up
to March
2011
(including
RIDF)
Amount
sanctioned
by GoI
Amount
released
by GoI as
on Sep-
tember
2011
2ULJLQDO Revised
1 2 3 4 5 6 7 8 9
1 9L]KLQMDP
(50% CSS)
704.00 1831.88 1987 2004
stage
II
1704.76 704.00 690.50
2 Muth-
DODSR]KL
(50% CSS)
1366.00 .. 2000 2007 1350.85 1366.00 683.00
3 Ponnani
(50% CSS)
2759.40 .. 2001 2011 3213.79 2759.00 1355.00
4 Thalai
(Including
NABARD
Assistance)
1926.00 2458.00 2008 2011 1476.84 1926.00 850.00
5 Thottap-
pally (50%
CSS)
1458.30 1802.23 2004 2010 1729.35 1802.00 800.00
6 Koyilandi
(Including
NABARD
Assistance)
3545.00 .. 2006 2011 3279.03 3545.00 1500.00
7 Chethi
(2nd phase)
(State
Scheme)
500.00 .. 2008 .. 585.96 - -
8 Kasaragod
5.9<
Scheme as
100% CSS)
2975.00 .. 2009 2012 600.00 2975.00 -
9 Chettuvai
(75% CSS)
3024 - 2010 2013 18.73 3024 300
10 Cheru-
vathur(75%
CSS)
2906 - 2010 2013 92.81 2906 300
Source : Harbour Engineering Department
6.150 Total revenue collected during 2009-10 and 2010-11 were `359.87 lakh and `410.58 lakh
UHVSHFWLYHO\5HYHQXHFROOHFWLRQIURP3XWKL\DSSDVKLQJKDUERXUGXULQJDQGZHUH
`142.41 lakh and `225.85 lakh, which accounts 58.59% increase over the previous year. During 2010-
Economic Review 2011
168
11 the highest revenue collection was from Puthiyappa harbour which accounts 55% of the total rev-
HQXHFROOHFWLRQ1HHQGDNDUDVKLQJKDUERXUFRQWULEXWHGRIWKHWRWDOUHYHQXHFROOHFWLRQGXULQJ
2010-11 which accounts 11.45% increase in the revenue collection for the previous year. Revenue
FROOHFWLRQIURP7KDQNDVVHU\VKHU\KDUERXULVDOVRLQFUHDVHGRYHUWKHSUHYLRXV\HDUDQGWKHUHYHQXH
IURP9L]KLQMDPKDUERXULVGHFUHDVHGIURPODNKLQWRODNKLQ7KHGHWDLOV
are given in Appendix 6.51.
8QGHU5,');,1$%$5'KDVDSSURYHGWZRSURMHFWVYL]EDODQFHZRUNRI.D\DPNXODPVKLQJ
KDUERXUDQGPRGHUQLVDWLRQRI1HHQGDNDUDVKLQJKDUERXUDQGVDQFWLRQHGDORDQDPRXQWRI`1062.54
lakh and `ODNKUHVSHFWLYHO\,Q.D\DPNXODPVKLQJKDUERXUFRQVWUXFWLRQRIPDMRUFRPSRQHQWV
were completed and an amount of `2527.34 lakh has been spent. An amount of `886.12 lakh was
H[SHQGHGIRUPRGHUQL]DWLRQRI1HHQGDNDUDKDUERXU8QGHU5,');,,1$%$5'KDVVDQFWLRQHGDORDQ
of `ODNKIRUWKHFRQVWUXFWLRQRI.R\LODQGLVKLQJKDUERXU7KHFRQVWUXFWLRQRIEUHDNZDWHULVLQ
progressing. The upto date expenditure is `1772.48 lakh. Under RIDF XIII, NABARD has sanctioned
a loan of `ODNKIRUWKHFRQVWUXFWLRQRIVKLQJKDUERXUDW7KDODL7KHPDMRUFRPSRQHQWVRI
the project is progressing. The expenditure upto March 2010 is `717.06 lakh. Details of NABARD
assisted scheme through Harbour Engineering Department is given in table 6.31.
TabIe6.31
NABARD Assisted Schemes
Sl
No.
Scheme AS amount NABARD
share
State
share
Expenditure
upto March
10
1 2 3 4 5 6
1 .D\DPNXODPVKLQJKDU-
bour RIDF XI
1062.54 312.00 - 2527.34
2 Neendakara RIDF XI 895 - - 886.12
3 .R\LODQGLVKLQJKDUERXU
RIDF XII
4146.72 1772.50 601.72 1772.48
4 Thalai RIDF XIII 2116 1026.43 - 717.06
5 Chellanam Fishing harbour
5,');9
2990 2769.07 220.93 386.90
Source : Harbour Engineering Department
7KHUH DUH VK ODQGLQJ FHQWUHV ZHUH RSHUDWHG LQ WKH FRDVWDO ]RQH RI NHUDOD 2XW RI WKLV
ODQGLQJFHQWUHVDUHIRUWUDGLWLRQDOVKHULHV7KHZRUNRIVKODQGLQJFHQWUHDWNDGDSUDLVDOPRVW
FRPSOHWHG &RQVWUXFWLRQ RI LQODQG VK ODQGLQJ FHQWUHV DW VDQEUDQLNRGL PXKDPPD DQG EHNNDO DUH
FRPSOHWHG7KHLQYHVWLJDWLRQVWXGLHVIRUWKHFRQVWUXFWLRQRIVKHULHVKDUERXUVDUHJRLQJRQDQGDQ
amount of `10.84 lakh was expended for studies during 2010-11.
7KH FRPSOHWLRQ RI VKLQJ KDUERXU DQG VK ODQGLQJ FHQWUH KDV WR EH GRQH LQ D WLPH ERXQG
manner. Prioritised action plan has to be prepared for the completion of all ongoing and pending infra-
structure projects. Expansion of more harbours to be based on need and technical studies.
6RFLDO6HFXULW\DQGOLYHOLKRRGVXSSRUWWRVKHUPHQ&RPPXQLW\
,QRUGHUWRSURYLGHVRFLDOVHFXULW\DQGOLYHOLKRRGVXSSRUWWRWKHVKHUPHQFRPPXQLW\WKHSUR-
JUDPPHV OLNH 6DYLQJ FXP UHOLHI VFKHPH 1):) KRXVLQJ *URXS LQVXUDQFH WR VKHUPHQ LQVXUDQFH
FRYHUDJH IRU VKLQJ LPSOHPHQWV HWF ZHUH XQGHU LPSOHPHQWDWLRQ 7KH PDMRU KLJKOLJKWV DUH JLYHQ LQ
Appendix 6.52.
Kerala State Planning Board
169
1):) DVVLVWHG KRXVLQJ VFKHPH LV PHDQW IRU SURYLGLQJ KRXVLQJ WR WKH VKHUPHQ XQGHU WKH
PRGHO YLOODJH GHYHORSPHQW SURJUDPPH 'XULQJ ;WK YH \HDU SODQ KRXVHV ZHUH FRQVWUXFWHG
spending `2577.87 lakh. During 2010-11, 1479 number of houses were allotted of which 525 houses
were completed and the remaining are in different stages. An amount of `349.97 lakh were spend for
WKLVSURJUDPPHGXULQJWKHSHULRG$OODFWLYHVKHUPHQDUHFRYHUHGXQGHUJURXSDFFLGHQWLQVXUDQFH
VFKHPH$ERXWODNKVKHUPHQZHUHLQVXUHGXQGHUWKHVFKHPH$VVLVWDQFHLVSURYLGHGWRDFFL-
GHQWDOGHDWKPLVVLQJRIVKHUPHQZKLOHVKLQJSHUPDQHQWWRWDOGLVDELOLW\SHUPDQHQWSDUWLDOGLVDELOLW\
KHDUWDWWDFNZKLOHVKLQJ'XULQJFRPSHQVDWLRQZDVSDLGIRUFDVHVDWDQDPRXQWRI
` 217.05 lakh.
6.156 The Kerala Fishermen Welfare Fund Board is the implementing agency for welfare and relief
VFKHPHVWRWKHVKHUPHQLQWKHVWDWH7KH%RDUGKDVUHJLVWHUHGPHPEHUVDVVKHUPHQDQG
65907 members as allied workers. There are 33,744 old age pensioners and 6323 widow pension-
ers. Under allied workers welfare schemes, there are 3659 old age pensioners. Details are given in
Appendix 6.53.
7KHVDYLQJFXPUHOLHIVFKHPHVLVIRUSURYLGLQJDVVLVWDQFHWRVKHUPHQGXULQJOHDQVHDVRQ
E\PRELOL]LQJWKHLUVDYLQJVGXULQJWKHSHDNVHDVRQ7KLVLVD&66VFKHPHDQGGXULQJ
DERXWEHQHFLDULHVZHUHDVVLVWHGWKURXJKWKHVHVFKHPHV
5. Society for assistance to Fisher women
6RFLHWLHVIRUDVVLVWDQFHWRVKHUZRPHQLVDUHJLVWHUHGVRFLHW\IRUHQFRXUDJLQJDQGVWUHQJWK-
HQLQJWKHORFDOO\RUJDQLVHGVRFLDORUJDQLVDWLRQDPRQJVKHUZRPHQLQFRDVWDODUHDV0RUHWKDQ
women SHGs were organised in the coastal districts of kerala with SAF. Under the micro enterprises
scheme upto March 2011, training on capacity building were given for 850 units through SAF. Interest
IUHHQDQFLDOFUHGLWVZHUHJLYHQWRVKHUZRPHQLQWKHIRUPRIUHYROYLQJIXQGIRUVKYHQGLQJ$ERXW
VKHUZRPHQZHUHJLYHQDVVLVWDQFHLQWKHIRUPRIUHYROYLQJIXQGIRUVKHUYHQGLQJLQ7($3
TRP schemes and 800 units of micro enterprises were established in each and scheme under SAF.
Economic Review 2011
170
Major achievements of projects implemented through SAF are given in table 6.32.
Table 6.32
Projects implementing through Society for Assistance to Fisherwomen (SAF)
ion and Productivity of ice in Kerala and India
Sl No Name of Project No. of Units
completed
1RRIEHQH-
ciaries
1 (FRQRPLFHPSRZHUPHQWRIVKHUZRPHQ 829 8290
2 &RQVWUXFWLRQPRGHUQL]DWLRQRIVKPDUNHW 29 -
4 Development of micro enterprises 1312 6560
5 'UHVVHGGU\VKXQLW 57 228
6 Hand made toiletry 26 130
7 Rural marketing executive 55 220
8 Sustainability of micro enterprises 550 5500
9 (VWDEOLVKPHQWRIYDOXHDGGHGVKSURGXFWVXQLW 100 500
6. Matsyafed
6.159 Matsyafed is an apex federation of 666 primary level Fishermen Development Welfare Co-
operative Societies, of which 341 numbers are in marine sector, 192 numbers are in inland sector and
133 women co-operative societies. The total membership in these societies is more than 3 lakhs. The
PDULQHVRFLHWLHVDUHFRQGXFWLQJEHDFKOHYHOVKDXFWLRQ'XULQJPHPEHUVSDUWLFLSDW-
HGLQWKHEHDFKOHYHODXFWLRQDQGWRQQHVKZHUHDXFWLRQHG0DWV\DIHGKDYHRUJDQLVHGPRUH
WKDQ6+*VZLWKPHPEHUV7KHJURXSVKDYHPRELOL]HG`4922.94 lakh as thrift. Through
7($3753VFKHPHVWKH)HGHUDWLRQKDVDVVLVWHGQXPEHUVRIVKHUPHQ7KHDFKLHYHPHQWRI
various programmes implemented by Matsyafed is given in table 6.33.
TabIe6.33
Major Programmes of Matsyafed
Sl No Name of Programme Unit Cumulative
Physical
achievement
upto Septem-
ber 2011
Cumulative
QDQFLDO
achievement
upto Septem-
ber 2011
1 Fish Auction 1RRIVKHUPHQ 52031 14208
2 Integrated Fisheries Development
Project
EHQHFLDULHV 62936 22854.77
3 TEAP / TRP scheme EHQHFLDULHV 39216 1885.162
4 Matsyafed input security scheme EHQHFLDULHV 235 48.09
5 6FKHPHZLWKQDQFLDODVVLVWDQFHRI
NBCFDC and NMDFC
EHQHFLDULHV 177301 18346.07
6 SHGs No / Members 13794
162,693
4753.63
Kerala State Planning Board
171
Co- operation
7KH&RRSHUDWLYHVHFWRUKDVEHHQSOD\LQJDGLVWLQFWDQGVLJQLFDQWUROHLQWKHSURFHVVRIVR-
cio-economic development of the state with special focus on rural population and livelihood. Through
sustained efforts, co-operatives have made impressive progress in various segments of Indian econ-
RP\SDUWLFXODUO\LQDJULFXOWXUHFUHGLWGLVEXUVHPHQWIHUWLOL]HUGLVWULEXWLRQSURFXUHPHQWDQGGLVWULEXWLRQ
RIDJULFXOWXUDOFRPPRGLWLHVSURPRWLRQRIFRQVXPHUDFWLYLWLHVKHDOWKGDLU\VKHULHVKDQGORRPFRLU
etc. Attempts were made to develop the movement as a self reliant one by augmenting the resources
WKURXJKPRELOL]DWLRQRIVDYLQJVLQXUEDQDQGUXUDODUHDV
6.161 The co-operative movement in Kerala has a solid foundation and impressive track record
LQWHUPVRIQDQFLDOVWDELOLW\DQGVRXQGLQIUDVWUXFWXUHWRJHQHUDWHDGHTXDWHIXQGV7KHVSUHDGDQG
growth of co-operatives in different sectors were nurtured under development plans with government
[Link]
promotional activities particularly in agricultural credit, public distribution system, distribution of ag-
ricultural commodities, marketing, agro processing, consumer activities, public health, education,
housing, insurance and infrastructure development, SC/ST sector, Women development etc. and have
made an impressive progress and serve the people in various economic activities. There are 13478
co-operatives under the control of Registrar of Co-operative Societies; of which 10241 are functional
in the various promotional activities in the sector. During 2009-10 there were only 10250 functional co-
operative societies. The number of Credit Co-operatives increased from 3257 to 3299 during 2010-11.
Similarly an increase was also noticed in the number of Women Co-operatives from 975 to 1003. The
number of miscellaneous co-operatives is also increased from 2459 to 2491 during 2010-11. The total
QXPEHURIFRRSHUDWLYHVLVFODVVLHGLQWRQLQHFDWHJRULHVDVVKRZQLQ7DEOH
TabIe6.34
Co-operatives under the Administrative controI of Registrar of Co-operatives Societies
</
Sl No YEAR 2011
Type of Societies Number of Societ-
ies
2IZKLFKZRUNLQJ
1 Apex, Federal, Central Societies 28 27
2 Credit Co-operatives 3299 2988
3 Marketing Co-operatives 557 235
4 Consumer Co-operatives 4697 4066
5 Processing Co-operatives 28 12
5 Housing Co-operatives 376 272
6 SC/ST Co-operatives 812 407
7 Health Co-operatives 187 96
8 Women Co-operatives 1003 748
9 2WKHU&RRSHUDWLYHVPLVFHOODQHRXV 2491 1390
Total 13478 10241
Source: Registrar of Co-operative Societies
Economic Review 2011
172
Support by NCDC
1&'&KDVHPHUJHGDVDGHYHORSPHQWDODQGSURPRWLRQDOQDQFLQJLQVWLWXWLRQIRUWKH&RRSHU-
ative sector in the country. The strategy of the Corporation is to strengthen and develop co-operative
institutions to enable them to serve their members and to maintain a sustained growth in their income.
6.163 As on 31.3.2011, the cumulative disbursement of the Corporation was ` 3520.85 crores. Dur-
LQJWKHRZRIIXQGIURP1&'&[Link]`1110 crore against `519.55 crore during 2009-
10. NCDC assistance increased to the tune of 113.65% compared to the previous year. During the
[Link],QGLDQVWDWHVIRUERWKVDQFWLRQVDQGGLVEXUVHPHQWRI1&'&V
QDQFLDODVVLVWDQFH%RWKVDQFWLRQVDQGUHOHDVHRI1&'&[Link]
all time high record of Rs 1101 crore and Rs.1110 crore, respectively during 2010-11, contributing
around 18% of total sanctions and 24% of total releases made by NCDC, country [Link] NCDCs
Direct funding Scheme, during 2010-11, an amount of Rs.1076.00 crore was sanctioned and Rs.
1036.00 crore released to the Kerala State Cooperative Agriculture & Rural Development Bank Ltd
and 7 District Cooperative Banks as short term working capital for meeting their credit requirements in
$JULFXOWXUH$OOLHGVHFWRUV8SWR2FWREHUDQDPRXQWRI5VFURUHKDVEHHQVDQFWLRQHGWR
4 District Cooperative banks and Rs 295 crores disbursed including spillover assistance of previous
year. NCDC sanctioned Rs. 15.31 crore and disbursed Rs.15.28 crore to the Kerala State Cooperative
&RQVXPHU )HGHUDWLRQ /WG &21680(5 )(' IRU VHWWLQJ XS 7ULYHQL VXSHU 0DUNHWV DQG RWKHU FRQ-
sumer Cooperatives for various consumer retailing activities in the State. Activity wise and year wise
sanction and release of assistance from NCDC are shown in Appendix 6.54.
6.164 The Year-Wise amount released by NCDC from 1962-63 to 2010-11 with rate of interest is
given in Table 6.35.
Table 6.35
Year wise release of NCDC loans with interest rates. (`Crores)ndi
Year ReIease of fund Interest rate (%)
1962-63 to 92-93 122.08 --
1993-94 to 98-99 195.47 --
1999-00 56.07 13.75
2000-01 69.04 13.75
2001-02 51.64 13-12.25
2002-03 50.18 11.50-10.5
2003-04 96.58 7-9
2004-05 109.24 8-8.5
2005-06 190.99 8.5
2006-07 310.59 10.25
2007-08 330.73 9.75
2008-09 308.73 9-10.25
2009-10 519.54 7.5-9.75
2010-11 1110 7.50-11.75
Total 3520.88
6.165 As on 31-03-2011, NCDC has disbursed a cumulative assistance of Rs. 3520.88 crore for vari-
ous Co-operative development projects in Kerala, as detailed below.
Kerala State Planning Board
173
abIe6.36
Types of NCDC Assistance
(` in Crores)
SI No Type of Assistance Through State
Government
Direct Fund-
ing
TotaI
1 Long Term Loan 1065.810 0.000 1065.810
2 Subsidy 34.070 0.000 34.070
3 Working Capital 0.000 2421.000 2421.000
Total 1099.880 2421.000 3520.88
Primary Agricultural Credit Societies (PACS)
6.166 The Co-operative Credit structure in Kerala comprise of 1634 Primary Agricultural Credit
6RFLHWLHV3$&6DQGDIOLDWHG3ULPDU\&RRSHUDWLYH$JULFXOWXUDODQG5XUDO'HYHORSPHQW%DQNV
supported by the Central and Apex Co-operative banks. As on 31.3.2011, there were 1634 PACS out
RIZKLFKZHUHUXQQLQJRQSURWDQGLQORVVDQGWKHUHPDLQLQJVRFLHWLHVZHUHGRUPDQW7KH
PACS are functioning with a paid up share capital of `849.97 crores and reserves of ` 2017.21 crores.
6.167 The performance of the co-operatives during the year under report was encouraging. The to-
tal loan disbursed during 2010-11 was `36822.34 crores against that of `26307.35 crores in 2009-10.
Compared to the previous year, there was increase in the disbursement of short term and medium term
loans. During 2009-10 the long term loan was only `810.49 crore and increased to `1102.57 crore dur-
LQJ2XWRIWKHWRWDOORDQGLVEXUVHPHQWPDMRUVKDUHZDVIRUVKRUWWHUPIROORZHGE\
medium term (24.16%) and long term (3%). In the case of loan disbursement, for agricultural purposes
alone, 32% increase in the disbursement compared to the previous year. 103% increase was made
in the long term (Agriculture) credit disbursement. Credit for non-agricultural purposes in all types
has comparatively increased. Though the co-operatives are disbursing loan for non agricultural pur-
poses for making good margin for their business, 724 societies were working on loss during 2010-11.
6.168 The Selected indicators of the credit operations of the Primary Agricultural Credit Societ-
ies show that, during 2010-11, deposits of the societies increased to `32527.61 crores as against
`27312.04 crores during 2009-10 The average deposit per member is increased to `6340.66 from
last years level of `5936.11. Similarly the average working capital position of the societies increased
to `2484.19 lakh against `2108.34 lakh during 2009-10. Selected indicators and credit operations of
PACS are given in Appendix 6.55 and Appendix 6.56.
Self Help Groups linkages and PACS
6.169 In Kerala under Co-operative sector the Self Help Groups scheme was implemented through
PACs. The district wise cumulative progress is given in Table 6.37.
Economic Review 2011
174
TabIe6.37
Progress of SeIf HeIp Groups Scheme as on 31.3.2011
(` in Lakhs)
Sl.
No
Districts No.
of
Soci-
eties
No. of
groups
Share col-
lected by
Groups
Deposit
collected
Total loan
issued to
groups
Total
Refund of
loan
Groups
working
LQSURW
Groups
working
in loss
Total
Mem-
bers
in the
Group
1 2 3 4 5 6 7 8 9 10 11
1 Trivan-
drum
51 3339 13.81 986.94 1147.48 723.51 1082 2257 52780
2 Kollam 87 6349 1.19 808.44 2326.40 582.19 4907 1442 63655
3 Pathana-
mthitta
24 790 6.22 268.66 470.76 222.36 612 178 15745
4 $ODSSX]KD 98 9883 85.62 6560.30 3378.21 5005.86 4902 4981 145944
5 Kottayam 56 2067 1.89 1131.51 864.37 473.69 1665 402 27088
6 Idukki 58 10888 191.91 1687.78 3607.62 2288.44 9064 1824 160669
7 Er-
nakulam
39 653 13.53 152.73 491.99 265.77 182 471 9594
8 Thrissur 117 9905 6436.40 5159.83 4260.57 2580.64 6679 3226 153718
9 Palakkad 25 1141 1.44 130.38 426.68 308.07 1026 115 14756
10 Malap-
puram
38 638 225.88 61.32 187.99 64.89 387 251 5723
11 .R]KLNRGH 44 1760 6.32 677.27 268.56 95.17 964 796 26253
12 Wayanad 28 8094 1010.29 1292.02 1715.20 1322.37 6502 1592 115476
13 Kannur 50 2322 2506.03 553.97 1075.23 287.20 1343 979 43970
14 Kasara-
god
49 4069 0.00 7291.49 638.60 276.42 4069 0 63269
Total 764 61898 10500.53 26762.64 20859.66 14496.58 43384 18514 898640
Source : Registrar of Co operative Societies
6.170 Under the scheme, 61898 Groups were involved in the implementation of SHGs under 764
PACs upto 31.3.2011. Idukki district formed maximum number of Groups (10888), followed by Thris-
VXUDQG$ODSSX]KDGLVWULFW,QWKH6WDWH*URXSVZLWKDGHSRVLWFROOHFWLRQRI`26762.64 lakhs
were formed and issued loan of `2XWRI6+*VZHUHIXQFWLRQLQJRQSURWDQG
18514 on loss.
Deposit Mobilisation Campaign by Co-operative Societies
6.171 Deposit Mobilisation campaigns by co-operative credit institutions continued during the year
under report also. The deposit mobilisation by the Co-peratives have shown an increasing trend over
WKH\HDUV'XULQJWKHSHULRGXQGHUUHYLHZWKHFRRSHUDWLYHVFRXOGPRELOL]H`2627.33 crore as against
the target of `2078.85 crores. Year wise target and achievement is given in Table 6.38.
Kerala State Planning Board
175
TabIe6.38
Targets and Achievements of Deposit MobiIisation Programme of
Co-operatives in KeraIa ( ` in Crores)
Year Target Achievement Achievement (%)
2005 400.00 1305.00 326.00
2006 400.00 1539.55 384.88
2007 600.00 1719.93 286.66
2008-09 1810.98 2664.29 147.12
2009-10 1733.54 2415.07 139.31
2010-11 2078.85 2627.33 126.38
Source : Registrar of Co operative Societies
Eleventh Plan
6.172 The Eleventh Plan outlay envisaged for the sector was `113 crores. The budget outlay for the
UVWIRXU\HDUVZDV`92.60 crores and the expenditure was `86.76crores ie, 93.69% of
WKHEXGJHWHGRXWOD\7KHVXEVHFWRUZLVHQDQFLDODFKLHYHPHQWGXULQJWKHUVWIRXU\HDUVLVJLYHQLQ
Table 6.39.
TabIe6.39
Sub sector wise nanciaI achievement during the rst 4 years of EIeventh PIan
(` Lakhs)
SI.
No
Sub sector XIth PIan
outIay
TotaI Budget
Estimate
Expenditure % of B.E
1 2 3 4 5 6
1 Credit co-operatives 3450 2035 1840.31 90.43
2 Housing co-operatives 600 200 200 100
3 Processing co-operatives 1050 1050 262.13 24.96
4 Consumer co-operatives 1500 450 538.98 119.77
5 Administrative Reforms 900 135 135 100
6 Education, Research & Training 250 215 248.5 115.58
7 Modernisation of Co-operative
Department
100 20 9.17 45.85
8. 2WKHU&RRSHUDWLYHVFKHPHV 3450 5155 5442.19 105.57
TotaI 11300 9260 8676.28 93.69
6.173 An analysis of the expenditure shows that the major share (21.21%) was incurred for the
scheme credit co operatives. About 3.02% of the expenditure was for assisting processing co-opera-
tives, 6.21% for providing assistance to consumer co-operatives and 2.30% for assistance to Housing
co-operatives etc. Besides the plan outlay, NCDC has released `FURUHVGXULQJWKHUVWIRXU\HDUV
of the Eleventh Plan for the development of marketing, credit, consumer and industrial co-operatives in
the State.
6.174 The proactive involvement of co-operatives could be considered in procurement of farm pro-
duce and establishment of more agro-processing units in the state. A major project for setting up rural
godown with the support of RIDF would be considered.
Economic Review 2011
176
Physical Performance
7KHPDMRUSK\VLFDOWDUJHWVDQGDFKLHYHPHQWVLQWKHVHFWRUGXULQJWKHUVW\HDUVRIWKH(OHY-
enth plan, are shown in Table 6.40.
TabIe6.40
PhysicaI Achievements Under Co-Operation during 2007-08 to 2010-11 ( ` in Crores)
Item 2008-11 Achievement
Short Term (Agriculture) 14256.52
Medium Term ( Agriculture) 2568.42
Long Term(Agriculture) 423.51
5HWDLOVDOHRIIHUWLOL]HUV 3025.42
Retail sale of Consumer goods 1041.79
Agricultural produce marketed 24156.82
Storage in Co-operatives (NMT) 284251.56
Miscellaneous types of Co-operatives
6.176 Miscellaneous types of co-operatives has been organised in the state mainly for the pur-
pose of generating employment opportunities to the unemployed youth and the weaker sections.
&RRSHUDWLYH +RVSLWDO DQG 'LVSHQVDULHV (GXFDWLRQ &RRSHUDWLYHV 9DQLWKD &RRSHUDWLYH 6RFLHWLHV
Motor Transport, Autorikshaw and Taxi Drivers Co-operative Societies, Tailors Co-operative Societ-
LHV:DVKHUPHQ&RRSHUDWLYH6RFLHWLHV&KHWKXWKR]KLODOL&RRSHUDWLYH6RFLHWLHVHWFDUHVRPHRIWKH
co-operative societies which are organised for the purpose of employment generation. There are also
Social Welfare Co-operative Societies, Cultural Co-operative Societies, Farming Co-operative Societ-
LHV/HSURV\3DWLHQW&RRSHUDWLYH6RFLHWLHV0DWV\D7KR]KLODOL&RRSHUDWLYH6RFLHWLHV3KRWRJUDSKHUV
&RRSHUDWLYH 6RFLHWLHV HWF *RYHUQPHQW H[WHQG QDQFLDO DVVLVWDQFH WR WKHVH VRFLHWLHV E\ ZD\ RI
share capital contribution, grant, loan and subsidy.
6.177 A programme for the overall development of the co-operative movement in the state namely
[Link]\DPZDVODXQFKHGGXULQJ7KHDFKLHYHPHQWVRIWKHSUR-
gramme during 2010-11 are shown in Table 6.41.
TabIe6.41
Achievement under Sahakarana Navarathnam KeraIeeyam during 2011
(` in Crores)
Sl no. Name of Component Achievement
1 'HSRVLWPRELOL]DWLRQ 8516.39
2 Arrear collection 11674.60
3 Distribution of commodities at reduced prices 1139.01
4 Loans with reduced interest rates distributed to
paddy and vegetable cultivators
490.64
5 Distribution of Royalty to writers 0.05
Source:RCS
Integrated Co-operative Development Project (ICDP)
Kerala State Planning Board
177
6.178 Integrated Co-operative Development Project (ICDP) focuses on over all development of
VHOHFWHGGLVWULFWVWKURXJKFRRSHUDWLYHHIIRUWVLQWKHDUHDRIDJULFXOWXUHDQGDOOLHGVHFWRUVZLWKWKH-
nancial assistance of NCDC. Moreover, Human Resource Development (HRD) initiative to restore the
principles of co-operative movement is another objective of the scheme. ICDP covers all the districts
LQWKHVWDWHE\SURYLGLQJQDQFLDODVVLVWDQFHWR3$&63$066&67FRRSHUDWLYHVIRULQIUDVWUXFWXUDO
facilities such as godown, retail outlet, cash counters, iron safe, strong room, furniture etc.
7KH,&'3ZDVUVWLPSOHPHQWHGLQ:D\DQDGGLVWULFW7KH6FKHPHZDVVXFFHVVIXOO\LPSOH-
mented in all districts and the second phase of ICDP in Wayanad district is under implementation
Economic Review 2011
Industry and Allied Sectors
C
H
A
P
T
E
R
2
Kerala State Planning Board
3
The growth of manufacturing sector in the state has been curbed due to the high cost for skilled
labor, the rapidly propelling land prices and the preference of the local population for white collar jobs.
Also being a traditionally service oriented economy with a high density of population, the state hasnt
been able to fnd a balanced growth strategy for manufacturing sector. The state has been success-
ful to some extend in ensuring private capital in these sectors. Village and traditional industries have
been revived and rejuvenated for healthy growth thereby bringing substantial relief to lakhs of workers
depending on them for their livelihood. Medium and large industry sector have also witnessed substan-
tial hike in public investment and with its help the KSIDC and KINFRA have initiated the setting up of
mega projects. The loss making State PSUs have initiated steps for generating decent profts. For the
manufacturing sector to sustain in Kerala it should aim at bringing about environmentally sustainable
practices, better waste management technology, sensible use of water and forest resources, and fol-
low a stringent quality and environment norms.
Industrial Growth
7.2 It had been a satisfying year for industry and allied sectors in Kerala. While, the manufactur-
ing sector for the country as a whole registered a growth rate of 8.2% during 2010-11, in Kerala it
recorded a wee bit higher at 8.74%. And according to the statistics published by the department of
Economics and Statistics, the growth rate for the period from 2005-06 to 2010-11 averaged 7.9% at
constant prices and 15.66% at current prices. The contribution of the manufacturing sector to GSDP
at constant and current prices during 2010-11, was 8.28 %t and 9 % respectively.
7.3 The income from manufacturing sector to GSDP and is growth rate are given in Table 7.1
Table 7.1
Growth of manufacturing sector in Kerala (GSDP)
(Base Year 2004-05)
Year
Contribution to GSDP
(` Lakhs)
Growth Rate (%)
At constant
Prices
At current
prices
At constant
prices
At current
prices
2004-05 1022058 1022058
2005-06 1043330 1092095 2.08 6.85
Industry and Allied Sectors
Economic Review 2011
4
Year
Contribution to GSDP
(` Lakhs)
Growth Rate (%)
At constant
Prices
At current
prices
At constant
prices
At current
prices
2006-07 1117876 1229466 7.12 12.58
2007-08 1316450 1508223 17.76 22.67
2008-09 1344072 1735690 2.10 15.08
2009-10(P) 1461595 2054317 8.74 18.36
2010-11(Q) 1601496 2433143 9.57 18.44
Source: Dept. of Economics and Statistics
P: Provisional Q: Quick Estimates
Joint Stock Companies
7.4 During 2010-11, 2300 companies were newly registered which included 52 public limited and 2248
private limited Companies. One Public Limited Company and 7 private limited companies were trans-
ferred to other States during 2010-11. Details of J oint Stock Companies working in Kerala are given
in Appendix 7.5
Central Sector Investment
7.5 Kerala has not been a major recipient of Central investment, its share being a measly 2.6%. Ma-
harashtra topped the list of states with the highest central investment. As for Kerala it ranked 17th.
Details of Central Sector Investment in Kerala from 2001 to 2010 are given in Appendix 7.6 and Central
Sector Investment in selected States are given in Appendix 7.7 and that for 2009-10, are detailed in
Appendix 7.8.
State Level Public Sector Enterprises
7.6 During the 11th plan period certain key policy initiatives like budgetary support, Strategic tie-ups,
Induction of professional Management, One Time Settlement of outstanding issues, Sales tax amnesty
scheme etc. were taken by the State Government to improve the performance of State units. Strategic
tie ups with the central public sector undertakings were introduced in order to develop synergy and
better technology and managerial system developments.
7.7 Various strategies were introduced for the revival of SLPEs such as performance management,
capacity building, enhancing productivity, due diligence and asset reconstruction. Performance Man-
agement strategies like online monitoring systems, monthly reviews by the Minister in charge and
institution of rewards were other notable initiatives.
7.8 Capacity Building Strategies that were initiated included professionalization of boards, transpar-
ency in selection of CEOs, Board level Committees for Succession Planning, continuous training at all
levels and trade union participation in evolving operational strategies. No less important was the intro-
duction of better fnancial accountability. As a result, performance of the PSUs underwent tremendous
change. The achievements made by PSUs during the 11th plan period are given in Box 7.1
Kerala State Planning Board
5
Box 7.1
Achievements by PSUs during 11th plan period
PSUs administered by Industries Department of Government of Kerala, have regis-
tered excellent growth and commendable performance during 2007-11
Out of 36 manufacturing and commercial enterprises, 29 companies have made
proft during 2010-11
The accumulated loss as on 31-3-2011 is `.957.29 crore.
PSUs registered a turnover of `. 2304.42 crores and a net proft of `. 295.79
crores
PSUs paid dividend of around `. 30 crores during 2010-11
Comprehensive restructuring packages were implemented in various PSUs
To improve the professional management in PSUs government had constituted a
committee for selection of Chief Executives on the basis of merit
As a part of the steps being initiated by the industries Department for inter PSU
tie-up on marketing of products, KSEB have established synergy with Companies
like KEL, SILK etc to meet its captive demands for power/energy
Training and Capacity Building programmes were initiated in PSUs
Various Capacity Building Strategies were initiated like professional isation of
Boards, Board level Committees for Succession Planning and continuous training
at all levels
Source: RIAB
7.9 There are 63 PSUs under Industries Department, Out of which 17 have remained closed. 5 are
Welfare Corporation and 4 are developmental agencies. Out of the remaining 37 Companies, 34 are
engaged in manufacturing activities and 3 are under Infrastructure Sector. Sector wise number of
Companies are given in Table 7.2.
Table 7.2
Sector wise number of Public Sector Companies as on 31-3-2011
[Link]. Category No. of Units
1 Chemical 6
2 Ceramics & Refractories 2
3 Development and Infrastructure 3
4 Electrical Equipments 4
5 Electronics 3
6 Engineering 6
7 Textiles 7
8 Traditional and Welfare 5
9 Wood and Agro Based 1
Total 37
Source: RIAB
7.10 During 2009-10, the turnover of proft making units was ` 2004.85 crores and they made a proft
of `. 251.41 crore. There is a signifcant increase in turnover and proft of the proft making units in
2010-11 compared to the previous year. The turnover and proft of the proft making units in 2010-11
are ` 2245.41 crore and `. 305.39 crore respectively. During 2010-11, 29 companies have made cash
proft and 5 companies showed loss. The details of proft making units and loss incurring units are
Economic Review 2011
given in Table 7.3. The turnover and proft / loss of PSUs during 2010-11 under Industries Department
are given in Appendix 7.9.
Table 7.3
Performance Trend (` Crore)
Particulars 2006-07 2007-08 2008-09 2009-10 2010-11
Proft Making Units
Number of Units 21 24 24 29 29
Value of Production 1310.65 1305.14 1547.83 1952.82 2047.47
Turnover 1311.65 1379.89 1708.21 2004.85 2245.41
Proft made by the proft
making units
135.20 140.46 187.06 251.41 305.39
Loss Incurring Units
Number of Units 23 18 17 8 6
Value of Production 276.33 255.47 222.13 62.01 60.04
Turnover 267.36 257.64 224.63 60.57 59.00
Loss made by the loss
making units
-40.97 -50.92 -59.59 -26.75 -9.61
Total
Number of Units 44 42 41 37 35
Value of Production 1586.98 1560.61 1769.96 2014.83 2107.51
Turnover 1579.01 1637.53 1932.84 2065.42 2304.42
Net Proft/Loss(-) 94.24 89.54 127.47 224.66 295.79
Source: RIAB
Micro Small and Medium Enterprises (MSMEs)
7.11 The importance and contribution of the micro, small and medium enterprises MSME sector to
the economic growth and prosperity is well established. Their role in terms of employment generation,
upholding the entrepreneurial spirit and innovation has been crucial in fostering competitiveness in the
economy. It can lead the State economy by acquiring exports through quality production techniques
and products. MSME is fast emerging into a major income generating and employment providing sec-
tor in Kerala and India in General. The major advantage of the sector is its employment potential with
less investment. As per recent statistics, MSME sector is employing nearly 45% of Indias total work
force. Hence Government and banks are providing lot of facilities for MSME sector.
7.12 In Kerala, MSME sector which has been provided special support by the Government, contrib-
utes greatly towards domestic needs, export marketing and foreign exchange earnings by producing
varieties of products ranging from traditional to modern. Being the volume of production of MSME
sector is very large, the quality of production, diversifcation of products, energy consumption, and
environmental effects were considered all through.
7.13 The MSME sector almost overcame the Neo-liberal policies of GOI which cause huge infow of
consumer goods from neighboring nations and the post recession era thrust; and improved in terms
of quality infrastructure development and social welfare of the state during the year 2010-11. It was
refected in the growth performance of the MSME sector that the sector was highly contributed in terms
of investment, value of production and high employment potential for the year 2007-08 among the
last 5 years. Year wise details of SSI/MSME units registered in last 6 years is shown in the Table 7.4
and the employment generated through SSI/MSME units in Kerala during the period 2005-06 to 2010-
7
11 is pictured in the Fig 7.1
Table 7. 4
Year wise details of SSI/MSME units registered in Kerala during the period 2005-06 to 2010-11
Sl. No Year Total investment
(` in lakh)
Value of goods and
Services Produced
(` in lakh)
Employment Pro-
vided (Nos)
1 5626 21170 100768 28128
2 1849 24494 71575 13474
3 11186 189760.31 588100.13 116189
4 8421 56594.83 132155.38 48111
5 9322 73046.34 255894.6 60876
6 10882 145365.53 13616293.7 84878
Source: Directorate of Industries & Commerce.
Fig 7.1
7.14 With a view to promote Kerala as a prime destination for industrial investments with environmental
protection, various programmes were implemented during the year 2010-11. As part of developing
quality industrial infrastructure in Kerala, new industrial parks with all facilities are promoted and ex-
isting Parks updated. Also adequate support is given to promote employment intensive industries like
agro based and food processing, textiles and garments and handicrafts to ensure job creation. Besides,
Skill development programmes are promoted. Cluster development programme is one of the key ar-
eas for MSME promotion. Separate fund from State head is provided for the development of clusters.
7.15 The total number of functional Small Scale Industry / MSME units registered in Kerala as on 31st
march 2011 is 194908. Out of this, 7651 are promoted by SCs, 1505 by STs, and 186166 by others.
The total investment is ` 892526.17 lakh, the total number of employment generated is 941981 and
value of goods and services produced is ` 16399560.17 lakh. District wise details of Small Scale In-
dustry / MSME units registered in Kerala as on 31.03.2011 are given in Appendix 7.10
7.16 During 2010-11, there has been a pick up in the growth of MSMEs in the State. This is evident
Economic Review 2011
8
from the statistics regarding the number of new enterprises that fled Memorandum, employment
growth, value of goods produced and investment made compared to the previous year. The number
of new enterprises that fled Memorandum during 2010-11 was 10882 where as it was 9322 in 2009-
10. During the year 2010-11, these enterprises made an investment of `145365.53 lakh providing
employment to 84878 persons. Out of the new enterprises that fled memorandum, 327 are promoted
by SCs, 60 by STs, and 10495 by others. Out of the total, 2629 enterprises are promoted by women
entrepreneurs. With regard to value of goods and services produced, MSME sector recoreded very
modest increase during 2010-11. The value of goods and services produced during the period was
`13616294 lakh where as it was ` 255894.60 lakh in 2009-10. Details of enterprises that fled memo-
randum during 2010-11 under the Act are given in Table 7.5 and Figure 7.2.
Table 7.5
District wise details of enterprises fled memorandum under Part II registered in Kerala during
2010-11
Sl.
No.
District
[Link] SSI/MSME units Promoted by Total Invest-
ments
(in lakhs)
Value of
goods and
services
produced
(in lakhs)
Em-
ploy-
ment
gener-
ated
(Nos)
SC ST General Total Women
1 2 3 4 5 6 7 8 9 10
1 Thiruvanan-
thapuram
64 7 1006 1077 309 5752.27 8522.73 9725
2 Kollam 10 7 523 540 129 8930.01 20869.73 4782
3 Pathana-
mthitta
15 0 399 414 129 4872 47307 3540
4 Alappuzha 4 3 663 670 198 5648.8 35364.3 6604
5 Kottayam 14 1 618 633 170 10407.64 27149.72 3883
6 Idukki 16 1 341 358 98 4932.96 176.57 2295
7 Eranakulam 32 6 2201 2239 377 61730.19 13215847.3 25055
8 Thrissur 56 18 1452 1526 410 9983 43827 7739
9 Palakkad 33 6 773 812 193 13332 150672.14 5495
10 Malappuram 18 1 561 580 102 5928.41 14375.95 3579
11 Kozhikode 28 0 903 931 217 5893.61 34259.6 6990
12 Wayanad 7 7 262 276 82 2131.81 7603.98 1169
13 Kannur 9 0 397 406 101 3787.68 6698.82 2273
14 Kasaragod 21 3 396 420 114 2035.15 3618.79 1749
Total 327 60 10495 10882 2629 145365.53 13616293.7 84878
Source: Directorate of Industries & Commerce
Kerala State Planning Board
9
Fig. 7.2
7.17 While analyzing the performance of the MSMEs, it is evident that number of new enterprises,
investment, production and employment recorded an upward trend during 2010-11 from that of the
previous year. District wise analysis reveals that Ernakulam occupies highest position in terms of
value of goods produced, investment made and employment provided and Kasaragod has the lowest
position. During the current year (as on 30.09.2011) 6132 new enterprises have fled memorandum
with an investment of ` 232109.52 lakh providing employment to 35054 persons. District-wise details
of enterprises fled memorandum in Kerala during 2011-12 (as on 30.09.2011) are given in Appendix
7.11. Summary Results of Fourth All-India Census of MSMEs is displayed in Table 7.6.
Table 7.6
Summary Results of Fourth All-India Census of MSMEs*
[Link]. Parameters India (in lakh nos.) Kerala(in lakh nos.)
1. Total Number of working
Enterprises
100768 28128
2. Employment Male Female 71575 13474
3. Enterprises by type of category
- SC ST
OBC
Others
Society
Not Responded
Total
588100.13 116189
*Reference year:2006-07
Source : Directorate of Industries and Commerce
Economic Review 2011
10
Prime Ministers Employment Generation Programme (PMEGP)
7.18 Government of India have introduced a new credit linked subsidy programme called PMEGP from
2008-09 by merging the two schemes viz., PMRY and REGP, which were in operation till 31.03.2008.
The Khadi and Village Industries Commission (KVIC) was approved as the nodal agency for imple-
mentation of the scheme at National level. In Kerala, State KVIC Directorate, State Khadi and Village
Industries Board (KVIB), District Industries Centres (DICs) and Banks are the agencies for implemen-
tation of the scheme. A target of 768 numbers of units was allocated to District Industries Centers
during 2010-11. The maximum cost of the project/unit admissible under manufacturing sector is ` 25
lakh and in business/service sector is `10 lakh. The benefciary contribution of general category is
10 percent and that of special category is 5 percent. The levels of funding under PMEGP is shown in
Figure 7.3
Fig.7.3
7.19 The eligibility conditions of benefciaries both general and special categories are given in box.7.2.
Box 7.2
Eligibility Conditions of benefciaries under PMEGP.
Any individual above 18 years of age.
There will be no income ceiling.
For setting up of project costing above `10.00 lakh in the manufacturing sector
and above `5.00 lakh in business/service sector, the benefciaries should posses at
least VIII standard pass as educational qualifcation.
Assistance will be available only for new projects.
Self Help Groups, Institutions registered under Societies Registration Act,
Production of co-operative societies, Charitable Trusts are also eligible for getting
assistance under PMEGP.
Existing units and the units already availed Government subsidy are not eligible.
Kerala State Planning Board
11
7.20 Under the Prime Ministers Employment Generation Programme a total of 2810 applications
have been received during 2010-11 of which 1703 have been recommended to banks. A total of 959
projects / applications involving margin money of ` 1183.77 lakh have been sanctioned by the banks.
Banks released ` 971.67 lakh towards frst installment to 709 benefciaries. In addition to this, 763
persons were trained under Entrepreneur Development Programme (EDP) during the above period.
Similarly, during the current year (as on 30.9.2011) a total of 1519 applications involving margin money
of ` 841.94 lakh have been received,of which 312 have been recommended to banks. A total of 259
projects / applications involving margin money of `391.64 lakh have been sanctioned by the banks.
7.21 District wise details of loan sanctioned under PMEGP during 2010-11 and 2011-12 (as on 30.09.11)
are given Appendix 7.12 & 7.13.
Box 7.3
Intellectual Property Facilitation Centre
Realizing the role of Intellectual Property Rights (IPR) in the economic development of the
MSMEs, Kerala State Council for Science, Technology & Environment (KSCSTE) with the
support from Ministry of MSME, Government of India has established an Intellectual Property
Facilitation Centre (IPFC) exclusively for the MSME sectors in the State. IP Facilitation Centre
will cater to various intellectual property needs of the MSME sectors in the [Link]
Property refers to the creations of human mind such as inventions, literary and artistic works
and designs used in commerce. IPR protects the interests of innovators by giving them prop-
erty rights over their innovations.
Industrial Co-operative Societies.
7.22 The total number of Industrial Co-operative Societies registered as on March 2011 is 2275, of
these 882 are of women. The total number of working industrial co-operative societies as on 31.03.2011
was 540. Out of these, 131 societies are promoted by Scheduled Caste entrepreneurs, 33 by Sched-
uled Tribe entrepreneurs and 196 by women and 376 by others. The details of working industrial co-
operative societies in Kerala as on 31.03.2011 are given in Appendix 7.14.
Bank Credit to SSI / MSME Sector.
7.23 The outstanding bank credit to various sectors by the commercial banks in Kerala at the end of
March 2011 was `121982 crore as against `96987 crore in the previous year. The outstanding fow of
credit to MSME sector showed an increase of 44 percent from `11758 crore in 2009-10 to `16894 crore
in 2010-11. The share of SSI sector in the total bank credit showed a slight increase from 12 percent to
14 percent in the same period. The status of fow of credit to various sectors is given in Appendix 7.15.
Food Processing
7.24 Food processing industry has been recognized as a priority sector in Kerala due to its potential
for future growth, diversifcation and possibility of generating substantial employment. Kerala Industri-
al Infrastructure Development Corporation (KINFRA) has been playing a proactive role for the promo-
tion of food processing industry in the State. KINFRA has adopted Theme based parks in the State.
KINFRA has set up industrial parks to suit the specifc needs of the food processing sector. Details of
food processing units in KINFRA Parks during 2010-11 are given in Table 7.7.
7.25 KINFRA Food Processing Park at Kakkancherry, Special Economic Zone (Food Processing) at
Kakkanchery, Food Processing Zone in KINFRA Small Industries Park, Mazhuvannur, KINFRA Food
Processing Park at Adoor and Seafood Park India Private Ltd at Aroor are the fve Food Processing
Industries parks already set up by KINFRA.
Economic Review 2011
12
Table 7.7
Details of Food Processing Units in KINFRA Parks during 2010-11
Sl.
No:
Name of Park Total area
acquired
(acres)
No. of
units
Area allot-
ted (acres)
Investment
(` lakh)
Employ-
ment
(Nos)
1 Kinfra Small Industries
Park, Koratty, Thrissur
30 1 0.20 32 9
2 Kinfra Small industries
Park, Mazhuvannur, Er-
nakulam.
65 1 0.3 38 8
3 Kinfra Small Industries
Park, Kalpetta, Wayanad
4 Kinfra Food Processing
Park, Adoor, Pathanamthitta
50 3 0.8 247.83 67
5 Kinfra Small Industries
Park, Seethangoli, Kasara-
god
40 2 1.2 550 215
6 Kinfra Food Processing
Park, Kakkancherry, Malap-
puram
60 4 4 136.04 67
Total 30 3 1.14 198 117
275 14 7.64 1201.87 483
Source: KINFRA, Thiruvananthapuram
7.26 The details of Food Processing units in KINFRA Parks since inception up to March 2011 are
given in Appendix 7.16
New Initiatives of KINFRA in Food Processing
Marine Park in Beypore for Seafood pre-processing activity.
Kera Park in Thrissur for Coconut based Industries.
Spices Park in Idukki for Spice Processing Industries.
Integrated Food Zone (Mega Food Park) in Wayanad
Mega Food Park in Kinaloor under the new Mega Food Park Scheme of Ministry of Food
Processing Industries, Government of India.
Grand Kerala Shopping Festival (GKSF)
7.27 GKSF aims to make the State of Kerala a prominent International Shopping destination by mak-
ing use of the brand image of Kerala tourism and upgrade the infrastructure of the traditional marketing
centers in the State. The government organized the ffth edition of the event through Department of
Tourism in association with Department of Industries and Commerce and other departments during the
period from 1st December 2011 to 15th J anuary 2012.
7.28 Department of Industries and Commerce also organized other promotional events for strength-
ening the marketing base of the industrial products.
Kerala State Planning Board
13
Participation in National & International events 2011
Participation in Aahar 2011, New Delhi
A Kerala Pavillion was set up by K-BIP and the leading Food Processing Units from the state exhibited
their products and technologies in Aahar 2011, the International Exhibition of Food, Food Processing,
Hotel & Restaurent equipments & Suppliers at Pragathi Maidan, New Delhi from March 10 to 14, 2011.
The event was organized by Indian Trade Promotion Organisation (ITPO) with the support of Ministry
of Food processing Industries, GOI.
Participation in Dubai Shopping Festival
On behalf of DIC, K-BIP & KSCDC participated in the India Pavilion at Global Village in Dubai Shop-
ping Festival held from January 28, 2011 to February 27,2011, by setting up a Kerala State Pavilion.
General Promotional Events
Malappuram Crafts Mela 2010
The ffth edition of the Malappuram Crafts Mela was organized by K-Bip from 16th to 30th Decem-
ber 2010 at Malappuram. This was organized as part of the GKSF. The Mela included 145 stalls in
traditional style with live demo areas, food courts, stage decorations, for display of products and live
demonstration of artisans from Kerala and other states. 100 artisans/ craftsmen from the Kerala, 179
from other states of India and 24 international artisans/craftsmen participated in the event. The major
highlight was the participation of Egypt as the Partner Country for the Mela.
Kerala Agri Food Technology Meet 2011
With a view to promote and encourage the Food Processing industries in the State, Kerala Bureau of
Industrial Promotion (K-BIP) organized the third edition of Kerala Agri Food Technology Meet in Thris-
sur from February 24 to 27, 2011. The very objective of the event is to expose the Food Processing
& Allied sectors to acquire the latest technology and technical know-how used in these sectors. The
meet presented 150 stalls with 100 numbers of exhibitors all over India.
Kerala Bamboo Fest 2010
The 7th edition of Kerala Bamboo Fest was jointly organized by K-BIP and Kerala State Bamboo
Mission from December 9 to 12, 2010. Artisans, craftsmen, cultural troupes from outside the State
especially from the North East regions participated in the Fest. This event aimed at exhibiting the vari-
ous products of the artisans/craftsmen in the Bamboo sector from all over the country.
Beypore Fest 2010
Beypore Fest 2010 was organized by Directorate of Industries and Commerce in association with
Feroke Panchayath and K-BIP during December 2010 at Feroke . Panchayath Stadium, Kozhikode
with food courts and cultural programmes. Products from various sectors like Coir, Handicrafts, Han-
dloom, Processed Food & Spices, Herbal / Ayurveda, Traditional products, Tourism, SME products,
Kudumbasree products etc. were showcased.
Handloom Industry
7.29 The Indian Textile Industry has an overwhelming presence in the economic life of the country.
Apart from providing one of the basic necessities of life, the textiles industry also plays a pivotal role
through its contribution to industrial output, employment generation, and the export earnings of the
Economic Review 2011
14
country. It provides direct employment to over 35 million people, which includes a substantial number
of SC/ST and women. The Textiles sector is the second largest provider of employment after agricul-
ture. Thus the growth and all round development of this Industry has a direct bearing on the improve-
ment of the economy of the nation.
7.30 Keralas textile industry comprises traditional handloom sector, weaving and spinning sector.
7.31 The Handloom Sector in Kerala stands second to the coir sector in providing employment among
the traditional industries of the State. The Handloom Industry in the State is mainly concentrated in
Thiruvananthapuram and Kannur District and in some parts of Kozhikode, Palakkad, Thrissur, Er-
nakulam, Kollam and Kasaragod Districts. The Industry is dominated by the Co-operative sector cov-
ering with 94% of total looms. The remaining six per cent of Handlooms units is owned by Industrial
entrepreneurs. The Co-operative sector consists of factory type and cottage type societies. There
were 648 registered Primary Handloom Weavers Co-operative Societies in the State on March, 2011
of which 167 are factory type and 481 are Cottage type societies. Out of 648 registered handloom
weavers co-operatives 442 were in working condition as at the end of fnancial year 2010-11.
7.32 The major varieties produced in the handloom sector of the State are dhothis, furnishing material,
bed sheets, grey saree and lungi. Details show that the production of these items contribute 67% of
the total. About 77.62% of the major items are produced in the southern region followed by the North
(12.81%) and Central (5.33%) regions. Of the total production, 95.76% are contributed by the co-
operative sector and the balance of 4.24% is by the units in the entrepreneurial sector.
Fig. 7.4
7.33 The overall production of handloom cloth by Handloom Industry of Kerala shows an increase
from 23.95 million meters in 2009-10 to 25.55 million meters in 2010-11. The total value of production
shows an increase from `.165.33 crores in 2009-10 to ` 182.35 crores in 2010-11. The total number
of weavers employed decreased from 57753 during 2009-10 to 50717 in 2010-11 and the mandays
employment generated during these period. has increased from 95.36 lakh man days to 96.65 lakh
man days. The production and productivity under handloom industry for the last two years are given
in Appendix.
7.34 Promotional measures of handloom sectors such as procurement, sales and marketing of hand-
loom fabrics are done by two state level organisations namely Hantex and Hanveev
7.35 Hantex is the apex society of handloom co-operative societies in the state. Number of PHWCS
Kerala State Planning Board
15
registered under Hantex is 489. Despite grants and loans are being given to the society, the organisation
is running in loss and the accumulated loss of Hantex is `.9450.93 lakhs during the review period. The
working results of hantex are given in Appendix 7.17.
7.36 Hanveev assist handloom weavers outside the co-operative fold by providing necessary raw ma-
terials at reasonable price and making arrangements for marketing their products. This organisation
is also running in losses and the net loss at the end of 2010-11 is `.479.86 lakhs. The working results
of Hanveev are given in Appendix 7.18.
7.37 The Integrated Handloom Development Scheme is a Centrally sponsored Scheme introduced
to the growing competitiveness in the textile industry both at the national and international markets
and the free trade opportunities emerging in the post MFA environment. A growing need has been felt
for adopting a focused yet fexible and holistic approach to the sector to facilitate handloom weavers
to meet the challenges of a globalised environment. A need has also been felt to empower weavers
to chart out a sustainable path for growth and diversifcation in line with the emerging market trends.
The Integrated Handlooms Development Scheme (IHDS) is an attempt to facilitate the sustainable de-
velopment of handloom weavers located in and out side identifed handloom clusters in to a cohesive
self managing and competitive socio - economic unit.
Development of Clusters having Loom-age 300 - 500
7.38 It is intimated that a maximum of Rs.60.00 lakh per cluster will be provided for a period of 3
years depending upon the requirement. The components of IHDS eligible for fnancial assistance are
Baseline survey, formation of consortium, raw material support, design development etc.
7.39 Assistance for individual weavers for basic input and construction of workshed will also be pro-
vided in a cluster having loom-age of 300-500 subject to the condition that the expenditure under these
components will be within 25% of the maximum project cost of `.60.00 lakhs per cluster.
7.40 Government of India has sanctioned 24 projects submitted by Kerala under the component viz.
Cluster Development Programme of the scheme and released the Ist and IInd instalment. Out of the
24 clusters sanctioned,20 Clusters are working well,the remaining 4 were winded up.
IHDS Development of Group Approach
7.41 Handloom Weavers who are not covered by clusters will be benefted by a Group Approach. A
Group should have more than 10 weavers, which can be in the form of SHG, PWCS and other inde-
pendent / individual weavers in groups. Assistance to such a group of weavers will be provided for
basic inputs, skill upgradation, Construction of workshed etc. 192 groups are identifed in the State for
getting benefts under the Group approach for development of handlooms. 21 Groups are approved
by Government of India and released the 1st and IInd instalment.
Integrated Handloom Cluster Development Scheme (IHCD)
7.42 This is a scheme to facilitate sustainable development to handloom weavers located in identifed
clusters into a cohesive, self managing and competitive socio-economic unit. The scheme will address
the requirements of the cluster in a co-ordinated and comprehensive manner.
7.43 Of the 20 handloom clusters identifed throughout the country for development under the IHCD
scheme,1. One is from Kerala i.e. Thiruvananthapuram cluster. Hanveev is the implementing agency.
Textile Sector
7.44 The Textile Industry in Kerala is spread over in public sector as well as in Co-operative Sector
and there exist thirteen Spinning Mills jointly in the public/ co-operative sector.
Economic Review 2011
16
7.45 Kerala State Co-operative Textile Federation (TEXFED) have seven Co-operative Spinning Mills
in its member fold. Five of them are administered by the Government and two have elected boards.
Due to various reasons consequent to globalization, Spinning Industry was facing deep crisis and
the Mills in Co-operative Sector slipped into the huge accumulated losses amounting to Rs. 132.52
crore. From 2006 onwards the Government interfered in the day-today activities of these mills and
turnaround the units in a big way enforcing fnancial as well as technical discipline.
7.46 The main handicaps faced by the Mills were the lack of working capital and availability of raw
materials. The Government through a centralized purchase system interfered in this area and pumped
Rs. 7 crore and is now procuring cotton for the entire textile sector through professionally constituted
committee comprising of RIAB, TEXFED and KSTC. Also the sale of Yarn carried out through depot
system is being monitored by the same committee. Due to this raw material cost was brought down
heavily and suffcient savings in this area accelerated revenue and turnover.
7.47 Majority of textile spinning mills in the state have a life span of 25 years. Though partial mod-
ernization has been done in certain units, it was not at par with the industry standards. Government
constituted an Expert Committee to study the crisis prevailing in the mills due to obsolete technology
and the Committee recommended for modernization of fve Co-operative Spinning Mills in the State.
Government approved the modernization of these Spinning Mills with a total outlay of Rs. 120.00 crore
and provided Rs. 3.00 crore in the budget for the year 2009-10. The revival packages of Malappuram
Co-operative Spinning Mills and the Cannanore Co-operative Spinning Mills recommended by Gov-
ernment has been approved by NCDC. The Malappuram Co-operative Spinning Mills has a project
cost of Rs. 13. 40 crore and the Cannanore Co-operative Spinning Mills has a project cost of Rs. 13.00
crore. In the budget for the year 2010-11, Rs. 8.37 crore has been provided for these projects as Gov-
ernment contribution and promoters equity.
7.48 Heavy bank loans outstanding against these Mills were settled by alienating excess land to the
concerned banks thereby reducing the negative net worth of the units. The Alleppey Co-operative
Spinning Mills by this deal gained an additional income of `. 4.00 crore and with this and with some
internal generation the capacity of the Mills has been doubled to 12000 spindles. This project has an
outlay of `. 6.53 crore. By the end of 2010-11, the Co-operative Spinning Mills in the State will bag
net proft.
7.49 The Co-operative Spinning Mills in the State were formed with a social objective to provide raw
material support to the traditional handloom sector in Kerala. But from 1999 onwards due to various
reasons this has been stopped. The Government took up the issue seriously and to have an inte-
grated approach for the industry decided to establish three hank yarn production centres in the State.
Now Cannanore Co-operative Spinning mills, Alleppey Co-operative Spinning Mills and the Trichur
Co-operative Spinning Mills have hank yarn production centres established with an outlay of `. 2.00
crore each. This amount has been provided in the State budget for the year 2008-09, 2009-10 and
2010-11.
Powerloom
7.50 Kerala consumes cloth to the tune of Rs. 2000 crores every year. The four integrated power
loom co-operative societies in the state at Calicut, Wayanad, Neyyattinkara and Kottayam have been
accelerated by providing budgetary support.
7.51 The Calicut Integrated Power loom Co-operative Society Ltd., has been converted as a textile
park comprising all the segments of a composite mill i.e., weaving , processing and garment making.
Here semi automatic power looms, automatic looms and highly sophisticated machines are working.
The value added products manufactured from these units is being exported through merchant vendors
to Europe and other parts iof the world. They manufacture terry towels, high quality home furnishings,
shirts, dothies, blazers etc. for domestic as well as export market.
Kerala State Planning Board
17
7.52 A modern processing unit to process yarn for both handloom and power loom with modern facili-
ties is functioning in this project. A garment making unit with state of art technology and professionally
trained manpower is also working in this project.
7.53 Wayanad, the most remotest district in Kerala which is lacking industrial initiatives has been
looked into and a rehabilitation cum industrial project is functioning. As part of it, a handloom produc-
tion centre has been started in Thirunelli for tribal women folk and training for the frst batch has been
completed and for another batch is ongoing. This will be converted as an employment generating cen-
tre in handloom for adivasi women. Integrated Power loom Co-operative Societies in Neyyattinkara
and Kottayam has also been activated and are in the process of production of grey cloth and some
conversion orders for export market. The sizing unit functioning at Kottayam is activated as a common
facility centre for all the integrated power loom Co-operative societies in the state.
7.54 To market the products manufactured by the above power loom Co-operatives, Texfed setting
up a marketing and distributing system by spending Rs. 90.00 lakhs by establishing a high tech show
room in Kozhikode.
Handicrafts
7.55 Kerala State Handicrafts Apex Co-operative Society (SURABHI), Handicrafts Development Cor-
poration and Artisans Development Corporation (KADCO) are the major promotional agencies in the
handicraft industry. SURABHI is the apex organization of primary handicrafts co-operatives estab-
lished with a view to uplift the artisans by marketing the product produced by the primary co-operatives
and implementing welfare schemes with the assistance from State and Central [Link]
2010-11, the Society procured handicrafts worth ` 168.26 lakh, achieved sales of ` 271.69 lakh and
the sustained loss was ` 49.94 lakh. The overall performance of the Society during the review period
shows a slightly increasing trend by registering an increase of 16.24% in procurement and 9.08% in
sales compared to the previous year. In order to popularize Kerala crafts the society conducted 10
exhibitions during 2010-11.
7.56 Handicrafts Development Corporation of Kerala was established in 1968. It is engaged in pro-
curing and marketing handicraft products by giving fair returns to artisans through its Kairali emporia
spread all over India. At present it is having a net work of 19 such sales emporia. The sales turnover
of the Corporation rose to ` 1489.24 lakh in 2010-11 from ` 1253 lakh in the previous year, making
Economic Review 2011
18
18.85% proft of ` 236.24 lakh. The Corporation is one of the State channelizing agencies of Nation-
al Backward Classes Finance and Development Corporation (NBCFDC). The Corporation provides
loans to OBC groups of artisans / member of artisans family below double the poverty line for starting
small business, carpentry, blacksmith, weaving, grocery shops, pottery, tailoring, jewellery making
etc. The Corporation has implemented various new projects such as Showroom at International Air-
port, Thiruvananthapuram, Show room cum design centre at CFSC, Attakulangara, and renovation of
Emporium at Chennai and SMSM Institute Thiruvanathapuram during 2010-11. The Corporation had
purchased a 3D Pantograph wood carving Machine at CFSC, Attakulangara.
7.57 The Kerala Artisans Development Corporation (KADCO) was established in 1981. It is one of the
State agencies to provide assistance to artisans for establishing production units, promoting market-
ing of products and providing employment opportunities through schemes of trade fairs and market-
ing centres. The sales turnover of the Corporation during 2010-11 was ` 810.14 lakh as against of `
745.35 lakh in 2009-10. The sales turnover has increased by 8.69 percent and the operating loss was
` 24.37 lakh in the period. KADCO has also been nominated as one of the State channelizing agen-
cies for the implementation of schemes announced by the National Backward Classes Finance and
Development Corporation (NBCFDC).
Bamboo Industry
7.58 Kerala State Bamboo Corporation was set up in 1971. The main objective of the Corporation is
to develop and promote industries based on bamboo, reed, cane and rattan and to undertake manu-
facture and trading of the above products, provide fnancial, technical and other such assistance, guid-
ance to the bamboo workers. Collection of good quality reeds from Government forest, distributes the
reeds to the registered bamboo mat weavers of the Corporation on credit basis and to procure woven
mats are the major activities of the Corporation.
7.59 As part of diversifcation, Corporation has initiated an innovative project viz. Bamboo Flooring
Tiles Project with the fnancial support of Central and State Governments. During 2010-11, the total
sales turnover of the Corporation was `1526.52 lakh against ` 1499.66 lakh in 2009-10 including `
1123.18 lakh towards sale of bamboo ply and ` 253.54 lakh through bamboo mats. The accumulated
loss of the Corporation during 2010-11 has rose to ` 1465.84 lakh from ` 999.87 lakh in 2009-10. The
Corporation produced Bamboo ply worth ` 941.55 lakh during the review period.
7.60 The Kerala State Bamboo Mission was constituted in 2003 with the broad aim of marshalling
the scattered resources of the State adopting a focused approach to revitalize the Bamboo Sector
thereby promoting value addition, enhancing income generation and alleviating poverty. The mission
supported the skill Upgradation training programme to 30 numbers of tribal youth for 30 days at Attap-
padi, Palakkad.
Coir Industry
7.61 The Coir Industry is the largest agro based Traditional & Cottage industry in Kerala and concen-
trated mainly in the rural areas. It provides livelihood to nearly 3.50 lakh people, out of which women
constitutes 76 per cent. The industry consists of three sub sector, namely, fbre extraction, spinning
and weaving sections. Co-operative Sector dominates the Coir Industry in Kerala. Coir yarn produc-
ers, product manufactures, public sector undertakings, exporters, and workers are the other major
stake holders of the Coir industry.
7.62 India produce signifcant share of coir to the world market. Among the states in India, Kerala is
the largest producer of coconuts contributing to 45% of the total production but only a meager portion
of husk is being used for producing coir fbre. Even after a number of initiatives taken by the Govern-
ment for the betterment of the sector, it remains as a sick traditional industry struggling for its survival
due to the competition with similar products of natural as well as synthetic origin both in the domestic
and export markets.
Kerala State Planning Board
19
7.63 Coir, which is environment friendly, is an important product in the industrial, construction and
household sectors This strongest natural fbre, continues to struggle at the low end of the commodity
market primarily due to poor value addition, diversifcation, technological refnement and inadequate
policy intervention. Appropriate mechanization in all areas of processing viz. defbering, spinning,
weaving, etc. has to be brought in to improve productivity and reduced drudgery.
7.64 Government of Kerala has laid emphasis for developing this industry by increased utilization of
coconut husk for production of coir fbre, market intervention through branding techniques, strengthen-
ing of R & D facilities to fnd innovative uses of coir and acquiring new technologies, encouragement
to co-operativisation and providing social welfare, civic amenities and medical facilities to workers.
Modernization is encouraged through incentives to make the coir industry more competitive. During
2010-11, the State Govt. has provided fnancial assistance to the tune of ` 102.95 crore under plan.
7.65 The major scheme during the period under review was the Regulated Mechanization of Coir
Industry. Under this scheme as many as 66.73 lakh husk has procured by spending an amount of `
76.02 lakh, purchased 14181.53 tonnes of fbre at a cost of ` 1309.52 lakh and produced 13281.61
tonnes of yarn worth ` 3075.01 lakh during 2010-11 through coir cooperative socities. An amount of
` 166.09 lakh was sanctioned to 16 Defbering Mills for its revival, distributed 93 Mini DF Machines
costing ` 92.25 lakh, 192 Mini DF Machines were modifed at the cost of ` 47.08 lakh , ` 500 lakh was
released for setting up of 5 DF Mills and established a Bio Organic Manure Manufacturing unit at
Vayalar costing ` 14.75 lakh and released an amount of ` 52.31 lakh as State share for Cluster De-
velopment Programme, ` 709 lakh as thrift/share/gratuity to about 40000 workers of 500 Co-operative
Societies, ` 200 lakh as marketing incentive to160 Societies, ` 32.20 lakh under Special Investment
Subsidy to six units, ` 519.99 lakh as Marketing Development Assistance, ` 25.92 lakh as Government
Share Participation to 18 coir cooperatives. Also provided welfare activities such as pension to 58000
Coir workers, disbursed ` 72.40 lakh to 35 coir cooperatives and ` 59.30 lakh to 376 Small Scale
Producers as debt relief, and lump sum amount as one time retirement beneft to the Coir workers @
Rs.500/- per year of service completed. For propagation & expansion of domestic and export market
of Coir products and other traditional industries, conducted Coir Kerala-2011 an International event
on Coir and Natural Fibre Products at Alappuzha,in which buyers of 19 countries participated apart
Economic Review 2011
20
from those within India. Besides, fve Coir fests at Alappuzha, Ambalappuzha, Mararikulam, Vayalar
and Kozhikode were also conducted.
7.66 The Kerala State Coir Cooperative Marketing Federation (COIRFED) is an apex federation
of primary coir co-operative societies with an objective to procure the entire products of the member
societies and marketing the same throughout the country and thereby providing fair wages and subsis-
tence to the coir workers. It is a non proft organization in the coir co-operative sector. It has bifurcated
into coir yarn and coir product divisions and has six defbering units also. COIRFED reported a net
proft of ` 22.97 lakh in the fnancial year 2010-11 against ` 14.41 lakh during the previous year, reg-
istering 59.4 per cent increase. Total income during the period rose by 28.5 per cent, i:e to ` 3173.98
lakh from ` 2469.84 lakh over to the same period and won four awards for excellence in the coir in-
dustry instituted by MS&ME Ministry, Government of India. Now the COIRFED has 841 members of
which 499 Coir Co-operative Societies are working, 155 Co-operative Societies are under liquidation,
163 societies are dormant and 24 societies have not yet started working.
7.67 Kerala State Coir Corporation (KSCC) and Foam Mattings (India) Ltd. (Fomil) are the two Public
Sector Undertakings in the coir sector. During 2010-11, the annual sales turnover of KSCC Ltd was `
7756 lakh and made a net proft of ` 176.12 lakh. Meanwhile, the annual sales turnover of the FOMIL
was ` 810.43 lakh and made a loss of ` 104.58 lakh as against a proft of ` 12.22 lakh during 2009-10.
The details of various types of coir co-operative societies, their activities and district wise details of
co-operative societies are shown in Appendices 7.19,7.20 & 7.21
7.68 The export of coir and coir products from India during the year 2010-11 was 321016.02 MT valued
at ` 807.07 crore as against the export of 294508.05 MT valued at ` 804.05 crore in 2009-10. This
recorded an increase of 9 % in quantity and a marginal increase of 0.4 % in terms of value over the
export achieved during 2009-10. Among the items of export from India, coir fbre, coir rugs & carpets
curled coir & coir pith have shown an increase both in terms of quantity and value when compared to
the previous year .The items such as handloom mats, tufted mat handloom mattings, coir geo-textile,
coir rope, and rubberized coir have shown a decrease both in terms of quantity and value over to the
previous year.. The items coir yarn and coir other sorts have shown an increase in value even though
the quantity have decreased. USA continues the largest importer of coir and coir products from India
followed by Netherland, U.K, Germany, Italy, Spain etc. Item wise export of coir and coir products
from India during and 2008-09 and 2009-10 are shown in Appendix 7.22
7.69 The National Coir Research & Management Institute (NCRMI), the State Government Organiza-
tion is looking after the research and development of Coir Sector, acting as a nodal agency for coor-
dinating the technological, commercial and academic developments in the entire gamut of activities
related to the coir sector in Kerala.
Khadi and Village Industries
7.70 Khadi and Village Industries Board (KVIB) is the statutory body vested with the responsibility of
organizing, developing and promoting Khadi and Village Industries in the State. It carries out its activi-
ties through co-operative societies, registered institutions and departmental units by availing fnancial
assistance from State Government, Khadi Commission and Nationalized Banks.
7.71 The Board received an amount of ` 933 lakh under plan and ` 2593 lakh under non plan of which
`1075 lakh was towards special rebate on retail sale of Khadi during 2010-11. In addition to this, an
amount of ` 1000 lakh was received under plan from the State Government towards Income Support
Scheme. Khadi and Village Industries Commission also released an amount of ` 987.86 lakh as grant
to the Board for its various programmes. Out of the total amount received, the Khadi Board expended
almost all amount of ` 5513.62 lakh which constitutes 99.99 per cent of the amount received for the
year 2010-11. The major schemes implemented during the period under review were the following.
Kerala State Planning Board
21
Prime Ministers Employment Generation Programme (PMEGP)
During the period under review, the board disbursed margin money grant of ` 968.86 lakh to 462 proj-
ects and generated employment opportunities to 3312 persons over to the target of ` 805.85 lakh to
575 projects with employment opportunities to 5750 persons respectivelly. In the frst half of 2010-11
(up to 30.09.11) an amount of ` 524.90 lakh has been disbursed as margin money grant to 226 proj-
ects creating 1694 employment opportunities as against the annual target of margin money grant of `
763.40 lakh to 545 projects and it is expected to generate 5450 employment opportunities.
Special Employment Generation Programme
Under Special Employment Generation Programme, as many as 567 units were set up each in every
Grama Panchayat with the total cost of ` 254.23 lakh and disbursed an amount of ` 83.59 lakh towards
subsidy and created 1055 employment opportunities.
7.72 During 2010-11 the Khadi Board disbursed an amount of ` 219.15 lakh as production incentive
to 9909 Khadi workers and under income support scheme disbursed the entire amount of ` 10 crore
to 10927 artisans in Khadi sector for supplementing their low income. Apart this, constructed 4 work-
sheds and 3 boiling sheds, renovated a hand made paper unit at Elanthur in Pathanamthitta, revit-
alised10 departmental khadi production centres, 5 khadi co-operative societies and charitable institu-
tions, installed 100 new charkhas and looms, repaired 50 nos. of charkhas and 10 nos. of looms, etc.
7.73 In addition to this, 2 Khadi Grama Soubhagyas and a Project Godown were renovated, and com-
puterized 4 districts offces and 2 Project Godowns, supplied 2.66 lakh fle boards to the Stationery
Department. Through the aided Village Industries units Khadi Board produced goods worth ` 537.62
crore and sold goods worth ` 587.52 crore by providing employment to 171464 persons against goods
produced worth ` 552.06 crore, sold goods worth ` 606.68 crore and provided employment to 183182
persons over the same period in the previous year. The Board has 215 sales outlets for Khadi and
village industries goods (45 Khadi Grama Soubhagya, 44 Khadi Soubhagya, 123 Grama Soubhagya
and 3 Mobile Sales Vans) and sold goods through these outlets worth ` 2733.49 lakh.
7.74 During the period under review, the Khadi Board could produce goods worth ` 15258.62 lakh
and sold goods for ` 17455.01 lakh by providing employment to 133367 persons while at the previous
year it was ` 16036.95 lakh, ` 17727.41 lakh and to 141433 persons respectively. It shows decrease
trend in production, sales and employment, while, wages paid was increased from ` 8119.24 lakh to `
8523.09 lakh. The details of value of production, sales, employment and wages paid and district wise
annual sales for the year 2010-11 are given in Appendixes 7.23 and 7.24. The Board has also con-
ducted publicity, Onam Melas, Silk Fest under Grand Kerala Shopping Festival 2011, District level
Awareness Camp and Exhibitions under PMEGP scheme. As part of popularizing Khadi/Handlooms
cloth and clothes, the State Government has exhorted citizens to wear it in schools and offces once
in a week.
Cashew Industry
7.75 Cashew is an important commercial horticulture crop of India. The overall production of raw ca-
shew nuts in India during 2010-11 was estimated at 653000 MT as against the estimated production of
613000 MT in 2009-10, showed an increase of 6.53 percent. The important cashew growing states in
India are Kerala, Karnataka, Goa, Maharashtra, Tamil Nadu, Andhra Pradesh, Orissa and West Ben-
gal. Maharashtra is the top among the states with high production and productivity (31.85%). Kerala
has a long tradition both in cashew cultivation and cashew nut processing. Though the production of
raw cashew nuts in Kerala shows an upward trend, during 2010-11 it has increased from 66000 MT in
2009-10 to 71000 MT. An estimate of domestic production of raw cashew nuts in various states during
2010-11 is given in Table 7.8 and Fig 7.5
Economic Review 2011
22
Table 7.8
Estimate of domestic production of raw cashew nuts in various states
States
2010-2011
Area
(hectares)
Producton
(MT)
Share of
Producton
( %)
Maharashtra 181000 208000 32
Andhra Pradesh 183000 107000 16
Orissa 149000 91000 14
Kerala 78000 71000 11
Tamilnadu 135000 65000 10
Karnataka 119000 57000 9
Goa 56000 24000 4
West Bengal 11000 11000 2
Others 33000 19000 3
Total 945000 653000 100
Source: Directorate of Cashewnut and Cocoa Development, Cochin
Kerala State Planning Board
23
Fig.7.5
7.76 The total export of Cashew Kernels from India during 2010-11 was 91559 MT, valued at ` 2598.15
crore which registered a heavy decline of 15.32 percent in quantity and 10.59 percent in value as com-
pared to the previous year. Similarly, the total export of cashew kernels from Kerala during 2010-11
was 49692 MT valued at ` 1417.28 crore. It showed a decreasing trend of 3.2 percent in quantity and
4.7 percent in value. Nearly 54 percent of total exports of India is from Kerala. The details of export
of cashew kernels from Kerala and India from 2000-01 to 2010-11 are given in Table 7.9 and Fig 7.6
Table 7.9
Export of Cashew Kernels from Kerala and India from 2000-01 to 2010-11
(Quantity: MT, Value: ` Crore)
Year
Kerala* India Share of Kerala
( per cent) Value Quantty Value Quantty Value
2000-01 49874 1152 89155 2050 56 56
2001-02 54717 971 98203 1789 56 54
2002-03 66859 1217 104137 1933 64 63
2003-04 68119 1205 100828 1804 68 67
2004-05 79950 1716 126667 2709 63 63
2005-06 74376 1623 114143 2515 65 65
2006-07 72861 1505 118540 2455 61 61
2007-08 69298 1395 114340 2289 61 61
2008-09 63729 1716.52 109522 2988 58 57
2009-10 61698 1635.79 108120 2905.82 57 56
2010-11 49692 1417.28 91559 2598.15 54 55
Economic Review 2011
24
Fig 7.6
7.77 Import of raw cashew nuts to India during 2010-11 was 504138 MT while it was 752854 MT dur-
ing 2009-10. Including the export of Cashew nut shell liquid, the net foreign exchange earnings of India
from this industry during 2010-11 was `.150.25 Crore while it was a loss of `.107.41 in the previous
year. Foreign exchange earning of Indian cashew industry and import of raw cashewnuts are given in
Appendix 7.25 and 7.26
7.78 The Kerala State Cashew Development Corporation (KSCDC) and Kerala State Cashew Workers
Apex Co-operative Society (CAPEX) are the two agencies of the State engaged in cashew process-
ing sector in Kerala. The KSCDC has 30 factories spread out in the districts of Thiruvananthapuram,
Kollam, Alappuzha, Thrissur and Kannur. There are about 18000 workers and majority of them are
women. The main activities of the Corporation consists of processing of raw cashew nuts into kernels
and marketing cashew kernels and value added products like cashew soup, cashew vita, cashew
bitz and cashew powder. During 2010-11, the Corporation could provide employment for 282 days as
against 284 days in 2009-10. Total sales turnover of the Corporation increased from ` 17855.04 lakh in
2009-10 to ` 21259.54 lakh in 2010-11, showed 19.07 percent growth. In the current year (2011-12),
Corporation could provide employment for 140 days up to 30.09.2011. The performance of KSCDC by
the last 5 years is given in Table 7.10
Table 7.10
Performance of Kerala State Cashew Development Corporation
Period working days in
factories
Turnover Share of
Producton
( %)
2005-06 230 9100.89 3968.17
2006-07 195 6381.84 1205.83
2007-08 165 6117.55 909.67
2008-09 209 12665.46 563.49
2009-10 284 17855.04 85.53
2010-11 282 21259.54 245.45
Source: KSCDC
Kerala State Planning Board
25
7.79 CAPEX with headquarters in Kollam, is the apex body of cashew workers primary societies
engaged in the procurement of raw cashew nuts and marketing the processed kernels. The Society
owns 10 factories. There are about 6300 workers. The society could provide employment for 257 days
in 2010-11. The total sales turnover of the CAPEX increased from ` 4822.77 lakh in 2009-10 to `
4875.55 lakh in 2010-11, recording only 1 percent of growth. The performance of CAPEX by the last
5 years is given in Table 7.11.
Table 7.11
Performance of CAPEX
Period working days in
factories
Turnover Share of
Producton
( %)
2005-06 151 1748.49 550.34
2006-07 152 1599.15 615.56
2007-08 96 1158.01 417.79
2008-09 210 3671.86 490.73
2009-10 214 4822.77 156.92
2010-11* 257 4875.55 168.28
Source: CAPEX *provisional.
7.80 During 2010-11, the Kerala State Agency for the Expansion of Cashew Cultivation (KSACC) pro-
cured 17,38,887 cashew grafts of high yielding varieties and in June the cashew plants and fnancial
assistance were distributed to farmers and institutions in the State. The agency could achieve an area
of 8694 hectares under cashew. Assistance was given for promoting organic cultivation and establish-
ing apple processing units.
7.81 KSACC organized a Kasumavu Karshaka Sangamom- 2011 involving cashew farmers from
all districts of Kerala, in addition to training programmes. KSACC has given fnancial support to three
ongoing research projects for arriving solutions for major constraints faced by the cashew industry &
cultivation; Bio-control of Tea mosquitoes, Standardisation of processing of bio-ethanol from Cashew
Apples and Standardisation of Cashew cultivation techniques in lateritic areas of Kasargod & other
districts.
7.82 In the last three years KSACC could achieve cashew cultivation in 12735 ha by promoting
about 80,000 farmers and other institutions. Under the mega project Sustainable Production of Ca-
shew Nuts in Kerala the National Horticulture Mission (NHM) released ` 971.754 lakh during 2010-11.
Beedi Industry
7.83 Beedi Industry in Kerala is concentrated in Kozhikkode, Kannur and Kasaragod. The Kerala
Dinesh Beedi Workers Central Co-operative Society Ltd. was the only agency in the State to promote
beedi industry in the organized sector. During the period under review, the society concentrated on the
upliftment of units for the diversifed products for the rehabilitation of about 7000 beedi workers under
the society. The society distributed ` 466.03 lakh as Relief Pension to beedi workers and ` 600.00 lakh
as gratuity to the workers who retired from service from the year 2006-07 to 30.09.2009.
7.84 As part of product diversifcation programme, the Society started a Dinesh Garment unit, Dinesh
Umbrella unit and Dinesh Foods. Dinesh Garment unit, Thana, Kannur provided employment to 150
workers. During 2010-11, the proft of the unit was ` 57.58 lakh and the sales turnover was ` 6.52
lakh. Two more units of Dinesh Garment at Chala , Kannur and Cheruvathur, Kasargod which will
provide employment to 250 workers were initiated functioning with training to workers and the develop-
ment activities of Dinesh Cocunut milk unit is also started.
Economic Review 2011
26
Small Industries Development Bank of India (SIDBI)
7.85 Small Industries Development Bank of India (SIDBI) is the principal fnancial institution for the
promotion, fnancing and development of MSME industries. It also acts as the nodal agency for the
scheme sponsored by Government of India in this regard. It also extends indirect fnancial assistance
by way of refnance facilities to primary lending institutions viz., KFC, KSIDC and Commercial Banks
against their loans granted to small scale units.
7.86 SIDBI, Kochi sanctioned ` 1405.06 crore and disbursed ` 768.25 crore as assistance to various
schemes / programmes during 2010-11 under small scale sector including service sector in the State.
The corresponding fgure during 2009-10 was `.397.17 crores and ` 342.58 crore. Details are given
in Appendix 7.27.
Industrial Development Plots / Areas
7.87 Directorate of Industries and Commerce (DIC) has also promoted investment by providing and
developing infrastructure facilities for small scale sector in the State. At present there are 37 DPs/DAs
under DIC having a total acquired area of 2457.71 acres and allottable area of 2169.69 acres. Besides,
one DP is transferred to KSIDC and another one to KINFRA. In addition to the above, 143.14 acres of
land in Kanjicode West and the land under DP, Unnikulam have been allotted for the proposed Railway
Coach Factory. Out of the total area, 1976.33 acre is allotted to 2590 industrial units and 1902 number
of units is working as on 31.3.11. Details are given in Appendix 7.28.
7.88 The total number of Mini Industrial Estates under DIC as on 31.03.11 is 85 and the total number
of SSI units established in these estates is 773. Out of the total number of 960 sheds, 834 sheds were
allotted to 676 working units. The total number of employees under these units is 3049. The district
wise details of industrial estates, number of employees etc., are given in Appendix 7.29
Kerala Small Industries Development Corporation (SIDCO)
7.89 Kerala Small Industries Development Corporation was established for strengthening the Small
Scale Sectors in the State. It provides infrastructure facilities such as land, work shed, water, distri-
bution of scarce raw materials, marketing the products etc. by setting up of industrial estates, mini
industrial estates and industrial parks. Execution of construction works for Industries department and
public sector undertakings are the other activities of SIDCO. There are 17 major industrial estates and
nearly 7.94 units are working in these estates. These working units provided nearly 6350 employment
opportunities. Besides, there are 36 mini industrial estates under SIDCO as on 31.03.11 and the total
number of sheds is 421. Out of 316 units sanctioned in these estates, 255 are working and 63 units
closed. The turnover during 2010-11 was ` 127.00 crore. Details of Industrial estates and mini indus-
trial estates under SIDCO are given in Appendix 7.30, 7.31 and 7.32.
MSME Development Institute (formerly Small Industries Service
Institute - SISI)
7.90 MSMED Institute provides technical, managerial consultancy services besides attending to re-
vival of small scale sick units in all the districts of Kerala and the Union Territory of Lakshadweep. The
prime motto of MSMED Institute is to provide timely and adequate techno-economic and managerial
assistance to prospective and existing entrepreneurs. It also acts as a technology resource centre,
training centre, service provider of industry, implementing agency of MSME schemes and assistance
of Government of India. The Nucleus Cell of the Institute is also functioning at Cochin for the promo-
tion and development of small scale units in Lakshadweep Islands. Fruit and Vegetable Preservation
Training Centre imparts training to the prospective entrepreneurs and also aims at upgrading the skill
of the entrepreneurs in this line.
Kerala State Planning Board
27
7. 91 The thrust area of Institutes activity during 2010-11 has been the development of industries
through the time tested cluster development model. The institute has conducted tailor made pro-
gramme of entrepreneurship, such as 49 motivation campaigns, 4 Business Skill Development Pro-
grammes (BSDP), 8 Entrepreneurship Development Programmes (EDP), 46 Entrepreneurship Skill
Development Programmes(ESDP), 8 Management Development Programmes(MDP), 15 Special Skill
Development Courses, Educational Seminars and other awareness programmes during 2010-11. 197
units benefted through the services of these programmes. The institute has been providing technical
consultancy to the units for acquiring ISO 9000/14000 scheme and also providing reimbursement to
the extent of 75 percent of the expenses incurred by the units under the scheme. Details are given in
Appendix 7.33.
Box No.7.4
Special Programmes of MSME-DI, Kerala
One day workshop on WTO on 3rd December 2010 at Thrissur.
National level Vendor Development Programme on March 2011 at Kozhikode.
National Award for MSME- Special recognition Award.
2 days Training programme on Export Packaging on October 2010 at Thrissur
Awareness/Sensitisation Programmes on Barcode on 14 December 2010 at
Kozhikode and on 14 J anuary at Kollam.
Awareness/Sensitisation Programme on LLP Act in 8 districts during 2010-11.
Cluster Development
7.92 The Kerala Bureau of Industrial Promotion (K-BIP) is coordinating the Cluster Development
Directorate of Industries and Commerce. It coordinates the implementation of setting up of Common
Facility Centers (CFCs) in clusters as per MSME EDP scheme of Government of India. Government of
India has released fnancial assistance of ` 633.07 lakh for 2 clusters with a total cost of ` 952.30 lakh
of which Government of Kerala share is ` 208.50 lakh and the work for establishment of CFC is in the
fnal stage. Further, for setting up of CFCs in 4 clusters, an amount of ` 979.90 lakh has been sanc-
tioned by Government of India with a total cost of ` 1507.87 lakh of which Government of Kerala share
is ` 300.43 lakh. The National Centre for Hazard Analysis Critical Control Point (HACCP) Certifcation
in association with K-BIP has initiated the process of auditing and certifcation of 39 food processing
and allied units from the State and outside the State. Out of this, NCHC has successfully audited and
certifed 24 food processing units and the remaining is under progress.
Industrial Financing
7.93 Kerala Financial Corporation (KFC) is one of the oldest Industrial Financing Agencies in the
State and it has been providing fnance to a large number of projects and enterprises. The Corpora-
tion has sanctioned 742 projects during 2010-11 at a total cost of `. 50302.76 lakh. This includes 264
SSI units costing `. 11486.18 lakh. Details are given in Appendix 7.34. District wise details of disburse-
ment of loan by KFC during 2010-11 are given in Appendix 7.35. As on 31.3.2011, total amount sanc-
tioned by KFC is `. 469358.58 lakh and the total amount disbursed is `. 370474.51 lakh. The industry
wise classifcation of loan sanctioned and disbursed by KFC are given in Appendix 7.36 and 7.37.
Kerala State Industrial Development Corporation (KSIDC)
7.94 Kerala State Industrial Development Corporation (KSIDC) is a Government agency for industrial
and investment promotion in Kerala. Established in 1961 with the objective of promoting, stimulating,
fnancing and facilitating the development of large and medium scale industries in Kerala, KSIDC acts
Economic Review 2011
28
as a promotional agency involved in catalyzing the development of infrastructure required for constant
growth of industry in the State. It offers professional guidance and support for potential investors
through a comprehensive set of services that include developing business ideas, identifying viable
projects , providing fnancial assistance, guidance and assistance for implementation. KSIDC has a
proven track record of attracting a commendable volume of investment to the State.
7.95 During the year 2010-11. KSIDC had assisted 34 projects with an investment of Rs. 700.94
crore. The projects can provide employment to 2831 persons. Out of the 34 units assisted by KSIDC,
8 are in public sector and 26 are in private sector. The project cost in public sector amounts to `.
151.09 crore and private sector `. 549.85 crore. The district wise details of units assisted by KSIDC
with investment and employment are given in Appendix 7.38 and 7.39.
7.96 The total disbursement during the year 2010-11 by KSIDC was Rs. 86 crore. The corporations
total recovery of principal and interest on loans from its assisted units amounted to Rs. 63 crore during
2010-11. The operating proft of the Corporation for 2010-11 was `. 28 crore. The details are given in
Appendix 7.40.
7.97 During the year 2010-11 KSIDC initiated various new major Industrial and infrastructure proj-
ects which are strategically important to Keralas industrial and economic development. The cumu-
lative investments in these projects are expected to be over `. 100,000 crore which will contribute
immensely to the economic growth of the state. The high speed rail corridor connecting North to south
of the state, for example,, is expected to provide a major fllip to the development of industry and com-
merce in the State, besides providing a new dimension to transportation infrastructure to the common
man. The project is envisaged to mobilize an investment of `. 75,000 crores.
7.98 The other projects promoted by KSIDC, which will contribute to the industrial advancement
of the state, include the Kochi- Coimbatore Industrial Corridor, 1,200 MW Gas based Thermal Power
Project at Cheemeni, Kasaragode, Electronic Hardware Park at Kochi, a world class manufacturing
and R & D facility for Electronic sector. A Life Sciences Park for setting up state of the art manufactur-
ing and R& D facility for Biotechnology, Nanotechnology, Contract Research etc., City Gas Distribution
Project for supplying compressed natural gas for automobile and piped natural gas for domestic use,
Oceanarium, an underwater Aquarium & Marine Research Centre and a Titanium Sponge plant etc.
are some of the other major projects promoted by the Corporation. NIRDESH, The National Institute
for Research and Development in Defence Ship building , a composite R & D facility for ship building,
ancillarization, equipment design etc is being set up by the Ministry of Defence, Government of India
at Beypore with the support of KSIDC.
7.99 The Corporation has also developed the basic infrastructure facilities in its industrial growth
centres in Kannur, Kozhikode and Alappuzha districts. Infrastructure amenities such as water, power,
approach roads and communication facilities have been created by KSIDC in these parks. The vari-
ous projects coming up in these parks include Apparel park, Rubber processing units, Footwear Park,
Food Processing Park and many other innovative projects
7.100 KSIDC is also initiating new activities like Skill Training & Entrepreneurship Program STEP
Mission to make Kerala a hub of Vocational and entrepreneurial skills, Development by developing a
pool of Trainers, Training institutions and Agencies, enhancing employability and entrepreneurial ca-
pabilities of the youth in order to have better economic employment opportunities, leading to sustain-
able Economic Growth and Development.
Kerala Industrial Infrastructure Development Corporation (KINFRA)
7.101 Kerala Industrial Infrastructure Development Corporation (KINFRA) was set up by an Act of
the State Legislature in February 1993, aiming at accelerating the industrial development of
the State by providing infrastructure facilities to industries. KNFRAs thrust has been to facilitate the
development of industrial infrastructure in the State.
Kerala State Planning Board
29
7.102 KINFRA has been focusing on industrial infrastructure development, specifcally aimed at the
economic development of the industrially backward regions of the State, by setting up Industrial Parks/
Townships/Zones etc., which provide all the facilities required for the entrepreneurs to start an industry.
7.103 The Industrial Parks developed by KINFRA have facilities like developed land or built up
space, dedicated power continuous water supply, communication facilities etc., in addition to support-
ing social infrastructure facilities like administrative block, bank, post offce, round the clock security
etc., thus providing a ready-made manufacturing environment for easy start up of industrial units with
minimum time and cost.
7.104 Over the past 17 years, KINFRA has successfully completed 14 theme based Industrial Parks
in Kerala in areas such as garments, Infotainment, marine/seafood, rubber, exports, food processing
etc,.Some of the notable achievements, are the successful completion of Indias frst International
Apparel Park at Trivandrum Indias frst Export Promotion Industrial Park at Ernakulam,: Indias frst
Infotainment Park, the Film & Video Park, at Trivandrum and Indias frst Food Processing Industrial
park at Malappuram.
7.105 A J oint Venture Company between KINFRA and ICICI, known as I-KIN, has been formed to
identify and facilitate the development of infrastructure projects in the State, and another between
KINFRA and NTPC Electrical Supply Co. Ltd. (KINESCO) for distribution of power within KINFRA
Parks in the State.
7.106. KINFRA has developed Small Industries Parks at Trivandrum, Ernakulam, Thrissur, Wayanad,
Kannur, Pathanamthitta and Kasaragod Ministry of Food Processing Industries, Government of India
and Department of Commerce and Industries, Government of India, has appointed KINFRA as the
nodal agency of the State for implementing Assistance to States for Infrastructure Development of
Exports and Allied Activities (ASIDE) . Government of Kerala has also appointed KINFRA as the
Nodal Agency for the Kannur International Airport and the National Institute of Fashion Technology
(NIFT) at Kannur.
7.107 Details of allotment made in KINFRA Parks are given in Table 7.12
Table 7.12
Allotments in KINFRA Industrial Park as on 1.2.2012
Sl.
No
Name of the PARK Total
No. of
Units
Area Alloted Investment
(in lakhs)
Employ-
ment
Land (acres) Built up
space (sq.
f)
1 Kinfra Small Industries Park,
Trivandrum
56 32.62 5271 1508
2 KINFRA International Ap-
parel Park, Trivandrum
20 26.39 309356 13590.6 6771
3 KINFRA Film and Video Park
Trivandrum (including Centre
Dhrishya)
21 25 25395 23735.35 4268
4 KINFRA Export Promotion of
Industrial Park, Cochin
13 47.34 11871.85 2638
5 8 16109 257.8 68
Economic Review 2011
30
Sl.
No
Name of the PARK Total
No. of
Units
Area Alloted Investment
(in lakhs)
Employ-
ment
Land (acres) Built up
space (sq.
f)
6 KINFRA Small Industries
Park, Koratty, Thrissur (SDF)
30 19.6 5625.58 20636
7 KINFRA Small Industries
Park, Koratty, Thrissur
63 45.79 8017.47 1984
8 KINFRA Small Industries
Park,Mazhuvannur, Er-
nakulam
27 31.64 976 8908
9 KINFRA Food Processing
Park, Kakkanchery, Malap-
puram
38 32 4169.42 1115
10 KINFRA Small Industries
Park,Thalassery, Kannur
74 61.83 9700.63 1358
11 KINFRA Small Industries
Park, seethangoli, Kasaragod
28 24.96 4838.99 720
12 KINFRA Small Industries
Park,Kalpetta, Wayanad
32 57771 1199.08 839
13 Neo Space, Malappuram 14 145.49 6331 113777 14136
14 KINFRA HITECH Park, Ka-
lammassery, (including incu-
bation centre)
52 1087.72 69140.19 25625
15 KINFRA Education and
Knowledge Hub, Palakkad
(including BEML) i
9 3 785 237
16 KINFRA Small Industries
Park,Adoor, Pathanamthitta
12 10.67 5140 791
17 KINFRA Food Processing
Park, Adoor, Pathanamthitta
25 19.65 86450 2494.80 1440
18 KINFRA Textile Centre,
Nadukani, Kannur (including
BRFL)
26 10.7387 10745 3225.09 559
548 1624.4387 512157 313815.85 93601
Total
Source: KINFRA.
Kerala State Planning Board
31
Centre for Management Development (CMD)
7.108 The Centre for Management Development (CMD) is a leading, self supporting autonomous
institution, which provides Research, Consulting and Training Support to the Development Agencies,
Corporate and the Government, at the national, state and local levels, Established in 1979 under ACT
XIII of the Travancore-Cochin Literary, Scientifc and Charitable Societies Act 1955. It is sponsored
by the Government of Kerala, as an independent, professional registered society. During the year
2010-11, CMD undertook several research assignments for the Government of India, Government of
Kerala, Public Sector Enterprises and Autonomous Institutions.
7.109 In the training front, CMD, in collaboration with the Bureau of Public Enterprises, Government
of Kerala conducted Management Development Programmes for Offcers / managers of the Public
Enterprises in Kerala during the year 2010-11. Eighteen programmes were conducted during J une to
November 2010 covering 368 managers of 55 organizations on the following topics:
Project Formulation and Management
inance for Non Finance Managers
Behavioural Lab: Developing Managerial Competencies and
Leadership Skills for Management of Change
7.110 Micro Enterprises Development Programmes (MEDPs) is an initiative for promotion of sustain-
able livelihood through vocational training in the State of Kerala. The programme are carried out in as-
sociation with the local self government institutions in the State. The Centre completed 182 MEDPs
all over the State during 2010-11. Another 30 MEDPs are at different stages as on 31st march 2011.
The trainees were selected from rural villages in association with the local self government institutions
and the majority of them were women. Other than these, CMD also conducted twelve Skill Develop-
ment Training Programmes for Kudumbashree members in Palakkad, and a skill development pro-
gramme sponsored by the Ministry of Sciences and Technology, New Delhi.
Cochin Special economic Zone (CSEZ)
7.111 The Cochin Special Economic Zone (CSEZ) is one among the seven Government of India
owned Special Economic Zones set up as a multi-product Export Processing Zone to boost exports
from the State. The Cochin Export Processing Zone was converted into a Special Economic Zone in
November 2000.
7.112 CSEZ is a multi-product zone with 108 working units and 18 under implementation units as on
30.9.2011, in sectors as varied as electronic hardware, software, engineering, readymade garments,
food processing, plastics and rubber products gem and jewellery manufacturing with more than 12000
employees. It is the single largest employment destination in the State. Both multinational corporations
and domestic corporate have set up their units in the Zone. Export during 2010-11 was to the tune
of Rs. 18311.97 crore as against Rs.17099.07 crore during 2009-10 registering a growth of 7.09%.
7.113. CSEZ stands out amongst the SEZs in India having the best infrastructure for attracting inves-
tors globally. A 25 MVA 110/11 KV substation and RMU based power distribution system, Integrated
Water management system comprising 1.8 MLD water supply operation and 1.2 MLD Common Ef-
fuent Treatment Plant, a warehouse measuring an area of 24000 sq. ft for the temporary storage
requirements of CSEZ units are some of the facilities offered in the Zone. The Zone has an effcient
drainage network and an incinerator for disposal of solid waste within the Zone. The Zone also has a
35 m3 capacity bio-gas plant to treat vegetable / seafood waste.
7.114. Besides operating the Central Government owned CSEZ, the jurisdiction of the Development
Commissioner extends to new SEZs being set up in Kerala and Karnataka and also the 100% Export
Oriented Units (EOUs) in Kerala, Karnataka, Lakshadweep and Mahe. During 2010-11, 78 EQUs
have been in operation with another 10 units under implementation in Kerala. Export from EQUs of
Economic Review 2011
32
Kerala was `. 1317.27 crore during 2010-11 as against `. 1270.15 crore in 2009-10. The industry
wise Export performance of units in CSEZ from 2006-07 to 2011-12 (upto 30.9.2011) is shown in Table
7.13
Table 7.13
Industry wise Export Performance of units in CSEZ 2006-07 to 2011-2011 (Rs. Lakh)
Sectors No. of
Export-
ing units
as on
30.9.2011
2006-07 2007-08 2008-09 2009-10 2010-11 2011-12
(upto
30.9.2011)
Electronic
Hardware
8 33000 26480 35452 30763.14 46447.70 19548.81
Electronic
Software
24 4903 12087 14529 19797.79 24441.16 12979.63
Garments 3 9267 11965 20102 14942.12 17133.29 4071.15
Germ & Jew-
ellery
12 21894 382447 1049148 1610209.37 1695149.90 1316288.82
Plastic &
Rubber Prod-
ucts
9 4340 2792 2690 2001.81 3818.85 3040.96
Engineering 12 6078 5647 7260 5407.76 6909.63 1574,.60
Food & Agro 11 13088 12904 12375 11592.11 11841.58 4341.19
Others 29 11182 10818 13348 14263.73 25455.17 13425.91
Total 108 103752 465140 1154904 1709907.83 1831197.28 1375271.07
Source: CAPEX *provisional.
Mining
7.115 Kerala State is endowed with a number of occurrences / deposits of minerals such as Heavy
Mineral Sands (Ilmenite, Rutile, Zircon, Monazite, Sillimanite), Gold, Iron Ore, Bauxite, Graphite, Chi-
na Clay, Fire Clay, Tile and Brick Clay, Silica Sand, Lignite, Limestone, Limeshell, Dimension Stone
(Granite), Gemstones, Magnesite, Steatite etc. However, mining activities on large scale are con-
fned mainly to a few minerals Heavy Mineral Sands, China Clay and to a lesser extent Limestone/
Limeshell, Silca Sand and Granite. In fact, Heavy mineral sand and China Clay contribute more than
90% of the total value of major mineral production in the State. However, 75% of the mineral revenue
comes from the minor minerals.
7.116 The State owns mineral deposits like placers, china clay (kaolin), limestone, limeshell, silica
sand, bauxite, graphite, iron ore, granite etc. The major mineral based industries like Indian Rare
Earths Ltd., Chavara, Kerala Minerals and Metals Ltd., Chavara, Malabar Cements, Walayar, Travan-
core cements Ltd., Kottayam, Kundara Ceramics, Kollam, English Indian Clays Ltd. (EICL), Thiru-
vaanthapuram, Excel Glass Industry, Alappuzha, Kerala Clays and Ceramic Products Ltd., Pazhay-
angadi, Kannur are some of the mineral based industries working in the State since several years.
The resources of beautiful ornamental granites in the State are being exported to different countries.
7.117. As on 31st March 2011, there are 81 major mineral mines that are operation in the State. Table
7.14 given the statistics of the mines. Total area covered by mining leases is 2727.92 ha. The details
are given in Appendix 7.41
Kerala State Planning Board
33
Table 7.14
Details of Major Mineral Mines in Kerala
[Link] Name of major mineral No. of mining leases
1 Graphite 1
2 China clay 34
3 Laterite 8
4 Iron Ore 1
5 Quartz 2
6 Lime Shell 5
7 Mineral Sand 4
8 Lime Stone 1
9 Silica Sand 25
Total 81
Source: Department of Mining and Geology
7.118 There are more than 3500 licensed minor mineral quarries in the State. The mineral concession
in force as on 31st March 2011 with respect to minor mineral is given in the Table 7.15.
Table 7.15
Economic Review 2011
34
Details of Mineral Concession pertaining to Minor Minerals
[Link] Type of mineral concession Number of conces-
sions
1 Quarrying permits 3043
2 Quarrying leases including Dimen-
sion stone
537
3 Dealers License 1510
4 License for registered metal
crusher unit
112
Source: Dept. of Mining & Geology
7.119 The production of various major minerals in the State during the year 2010-11 and the royalty
are summarized in the Table 7.16
Table 7.16
Production of Major Minerals in Kerala during 2010-11
[Link] Mineral producton in Tonnes
Royalty (Rs.)
1 China Clay 10,25,112 20502247
2 Limestone 5,27,557 33236091
3 Ilmenite 1,11,988 11637768
4 Silca Sand 72,425 3983369
5 Lime Shell 56,906 3585080
6 Laterite 47,303 3784214
7 Zircon 13,648 10971980
8 Sillimanite 7,367 2055374
9 Rutile 6,514 4470021
10 Graphite 250 12480
11 Quartz 59 1180
Source: Dept. of Mining and Geology
7.120 The production of various minor minerals in the State and the royalty during the year 2010-11
are given in the Table 7.17
Table 7.17
Production of Minor Minerals in Kerala during 2010-11
[Link] Mineral producton in Tonnes
Royalty (Rs.)
1 Granite (building stone) 1,09,60,209 175363340
2 River Sand* 30,84,704 30847044
3 Ordinary Sand 27,91,576 27915759
Kerala State Planning Board
35
[Link] Mineral producton in Tonnes
Royalty (Rs.)
4 laterite 13,32,571 21321133
5 Brick Clay 8,37,152 8371523
6 Lime Shell 10,451 470302
7 Grantie (dimension stone)m(in
cubic meters)
1068 4272636
Source: Dept of Mining and Geology
*The production fgures are based on the royalty received reported by revenue Department
Revenue from minerals
7.121 Government gets revenue from minerals mainly by way of royalty. About 75% of the revenue
comes from minor minerals and rest from major minerals. Revenue collected during the year 2010-11
was `. 36.3 crores. The year wise details of revenue collected is given in Table 7.18 and district wise
details of revenue collected during 2010-11 are given in Appendix 7.42
Table 7.18
Revennue Collection details for the period 2006-11
Year Amount collected for Major Mineral
(Rs.)
Amount collected for
Minor Mineral (Rs.)
Total amount in (Rs.)
2006-2007 6,54,24,712 19,92,58,251 26,46,82,963
2007-2008 7,05,32,053 24,03,12,854 31,08,44,907
2008-2009 7,59,26,174 27,90,05,659 35,49,31,833
2009-2010 8,81,27,172 27,40,44,838 36,21,72,010
2010-2011 9,42,39.804 26,91,73,740 36,34,13,544
Source: Dept. of Mining and Geology
Information and Communication Technology
7.122 The repute of the country as a favored IT/ITES destination has been growing phenomenally
even in times of recession. The size of Indian IT-BPO industry has crossed 70 billion USD, contribut-
ing 5.8% of countrys GDP. In the last 5 years kerala too has witnessed the emergences of the IT &
ITES business as a key contributor to the economy. The growth of the knowledge economy has been
benefcial for the state as it enjoys many natural vantages that can be utilized effectively. The high
density of technology graduates, lower salaries and lower employee attrition rates have also helped
the states progress. Kerala is also one of the 2 states in the country to have two submarine cable land-
ings. Initiatives taken by successive governments to promote Kerala as an IT destination have been
very fruitful. The state Government has invested nearly Rs. 2000 crores during 2010-11 and 2011-12
to develop the infrastructure required for the sector. In addition to speeding up the Smart City Project,
most of the existing IT parks in the state are on an expansion mode to accommodate the growing
number of startups and MNC IT frms opting to move into the state.
Kerala State Information Technology Mission (KSITM)
7.123 Kerala State IT Mission (KSITM), the nodal IT implementation arm of the Government was es-
tablished in the year 1999. KSITM was registered as a Society under the Travancore, Cochin, Literary,
Scientifc and Charitable Societies Act (Act 12 of 1955). The Governing Body of IT Mission is chaired
Economic Review 2011
36
by Honble Minister for IT and the Principal Secretary of IT is the Chairman of the KSITM Executive
Committee.
7.124 The Key Objectives of KSITM include e-governance, disseminating Information across citi-
zens and Government, interfacing between Government and Industry, bridging digital divide, investor
interactions and device strategies in achieving speed and transparency in governance. The thrust
activity is e-governance, KSITM has conceptualized and implemented many citizen centric E-gover-
nance Projects directly or helped the departments indirectly.
7.125 Various e-governance projects that are being, implemented in the State can be broadly clas-
sifed under the heads of Core IT Infrastructure, Common IT Infrastructure, Common Applications
and Capacity Building/Enhancement Initiatives. Components of these programme are as follows.
Core IT Infrastructure Common IT Infrastructure Common Applica-
tons
Capacity Building /En-
hancement Initatves
State Data Centre
New Data Centre
KSWAN
SecWAN
Department WAN
Civil Station WAN
Akshaya
FRIENDS
Citizens Call Centre
Email Server
Video Conferencing
Mobile Governance
Infrastructure
State Service Delivery
Gateway
E-District
Malayalam
Computing
E Government Procure-
ment
E-payment Gateway
SPARK
IDEAS
MESSAGE
SPARSH
Entegramam
INSIGHT
E-Krishi
Womens Skill
Enhancement
Programme
SPEED IT
FOSS Training for
Government Em-
ployees
ICFOSS
Kerala State Planning Board
37
Akshaya
7.126. Akshaya was envisioned as an e-literacy project started in the State during 2002 in Malap-
puram District. Initially it was intended for identify the Village Level Entrepreneurs (VLE) in each
Panchayat and link their project to private public partnership model. The major objectives are 100% e-
literacy, delivery of G2C services, single window for all services, friendly face of government, empow-
ering citizens through ICT, sustainability of Akshaya entrepreneurs and creation of ubiquitous CSC
network. After Malappuram the programme rolled out to seven districts and now the entire districts
in the State is implementing this projects. The major achievements of Akshaya are given in Box 7.5
Box 7.5
RSBY Health Insurance policy for 1.7 crore Population. Registered 1.6 lacs APL
families and 19 lacs BPL families. Renewal of policy for 13 lacs families
Transaction worth 100 crores
Filed 4.8 lacs online Application for Ration Card
Intel Learn program covered 80,000 school children
Enlisted 1500 students for various IGNOU
More than 2.5 lac application submitted under e-district within 8 months time
Over 30,00,000 citizens enrolled under UID through Akshaya Centres
More than one dozen G2C Services launched
Total Revenue of Akshaya Entrepreneurs from G2C services for the year 2010-11 is
Rs. 16 crores
Monthly income of Akshaya Entrepreneurs from G2C service is increased from
15 lac to 2 crore
Indian Institute of Information Technology and Management
Kerala (IIITM K)
7.127. Indian Institute of Information Technology and Management Kerala, (IIITM-K) established
in the year 2000, is a non-proft making autonomous institution registered under Section 25 of the
Companies Act. Government of Kerala holds all the shares of the Company and the management of
the Institute is vested with the Board of Directors comprising senior Government offcials, academi-
cians and eminent industrialists nominated by the Government of Kerala. It was originally envisaged
that IIITM-K shall be a Centre of Excellence on the lines of the IITs/IIMs and shall impart high-end skill
development in leading IT disciplines.
7.128 IIITM-K is a premier institute of excellence in Science. Technology and Management related
to Information that develops professionals and leaders of high caliber imbued with values of entrepre-
neurship, ethics and social responsibility. IIITM K will actively promote higher education and industry
across Kerala and beyond through its IT facilitated education programs and services.
7.129 IIITM-Ks Mission is a to be an institution of excellence in education, research, development,
and training in basic and applied Information Technology and Management and to be a leader in
educational networking and services provider for high education and professions. The Institute will
help the regions development through its education, expertise and services and thereby make it an
attractive destination for hi-tech industry. Besides, its core academic and research programs, the in-
stitute will support HRD for industry, teachers training for colleges, IT ventures incubation, multimedia
authoring for faculty and experts, and development of IT and IT enabled services for the region.
Kerala State IT Infrastructure Limited
7.130 Kerala State Information Technology Infrastructure Ltd (KSITIL) is a public limited company
formed for the creation of infrastructure for IT/ITES in the State The company has been incorporated
under the Companies Act on 31.1.2008 and has commenced business on 5.3.2008
Economic Review 2011
38
7.131 The business model for the company is to acquire land, create value addition by providing
basic infrastructure like electricity, water, and road, obtain SEZ status and such other Government
approvals that may be required and then allot land to private developers for development of either IT
SEZs or IT parks, realizing value of land based on market prices. Revenue so generated is reinvested
in projects it promotes as companys share capital. The company holds upto 26% in the projects.
7.132 The company is currently in the process of acquiring land for the following projects: Phase 3
expansion of the Technopark, Technocity at Thiruvananthapuram, Cyberpark at Kozhikode, Infopark ex-
pansion at Kochi. The company has completed acquisition of 39 acres of land at Cyberpark Kozhikode.
In addition, government land has been provided in the districts of Kollam, Alappuzha (Ambalapuzha
and Cherthala) Thrissur, Kannur and Kasaragode for development of IT Parks. An extent of 60.61
acres of land at Cherthala has been purchased from KSIDC. In all these areas the company is simulta-
neously in the process of developing basic infrastructure necessary to start the development process.
The IT Park at Koratty in Thrissur district has been opened with 40000 sq. ft built up space in the frst
phase and 14 companies have already started operations there. First IT buildings are under construc-
tion at Kollam and Cherthala and expected to be opened for business operations in the frst half of 2012.
Technopark
7.133. Technopark was set up under the auspices of Electronics Technology Park, Kerala an au-
tonomous body under the Department of Information Technology, Government of Kerala. The Park is
home to over 240 Companies employing more than 32,000 professionals. Technoparks aim was to
create infrastructure and provide support required for the development of high technology companies
.
7.134 Technopark has been growing steadily both in size and employee strength. Park Centre,
Pamba and Periyar were the only buildings in the beginning. Technopark has periodically added new
buildings such as Nila, Gayathri and Bhavani. With the inauguration of the 850,000 sq. ft. Thejaswini
on February 22, 2007, Technopark became the largest It Park in india. Technopark has become the
single largest source of employment in Kerala, with over thirty two thousand people working directly
in the facility itself and creating Rs. 2000 crores turn over with export earnings of Rs. 1977.32 crore as
per details provided
7.135 The total land available with Technopark is about 771.54 acres. Total land available with Tech-
nopark for phase I and II is about 239.54 acres. Out of this 9.9 acres is leased out to NISH for develop-
ing their institute, 50 acres and 36 acres to M/s Infosys and M/s US Technology International Pvt. Ltd
for creating their own private IT complex. The summary of physical achievements is given in Table 7.19
Table 7.19
Physical Achievements of Technopark
Sl. No. Partculars Land/Area/[Link]
1 Total Land (Phases I,II,III) 326.54 acres
2 Land for Technocity 451 acres
3 Land for Technopark, Kollam 40 acres
4 Total Built up space for Industries 31, 81,500 [Link]
5 Total space for support facilities 1, 78,850 [Link].
6 Total built up space by companies 20,35,500 [Link].
7 Total built up space by companies in SEZ 98,17,400 [Link]
Kerala State Planning Board
39
Sl. No. Partculars Land/Area/[Link]
8 Number of companies in Techno park 240
9 Total Employment 32000
10 Total investment (2010-11) Rs.2100 crore
11 Total turnover (2010-11) Rs.2000 crore
12 Total Export (2010-11) Rs.1977.32 crores
Source: Technopark
7.136 Details of total area created for Industrial modules in Technopark is given in Table 7.20
Table 7.20
Area created for Industrial Modules in Technopark
Sl. No. Name of Building Area (Sq.f.)
1 Pamba 36,000
2 Periyar 36,000
3 Nila 4,69,500
4 Chandragiri 60,000
5 Gayathri 1,50,000
6 Bhavani 4,80,000
7 Thejaswini 8,50,000
8 Phase III-IT Building 10,00,000
9 Ashtamudi-Technopark,Kollam 1,00,000
Total 31,81,500
Source: Technopark
7.137 Space created by Technopark for other Support facilities are shown in Table 7.21
Table 7.21
Space created by Technopark for other Support Facilities
Sl. No. Name of Building Area (Sq.f.)
1 Park Centre 60,000
2 Restaurant & Cafeteria 17,000
3 Guest House 16,000
4 Club House (including Guest House) 60,000
5 Technomall 23,500
6 Reception Building 1,600
7 Site Offce-Technopark,Kollam 750
Total 1,78,850
Source: Technopark
Economic Review 2011
40
Infopark
7.138 Infoparks Kerala is a society registered under Travancore Cochin Literary Scientifc and Chari-
table Society Act XII of 1955 and fully owned by Government of Kerala. The main objectives include
creation of state-of-art infrastructure facilities such as space for IT/ITES companies, supply of power,
water, connectivity etc. Since its inception in 2004 Infopark has created over 34 lakhs [Link]. of IT
space and has provided employment to over 15,000 IT professionals through around 104 IT compa-
nies who have taken space in its Parks. Currently, Infoparks Kerala has the following IT Parks
Park Area District/Village
1) Infopark Park Kochi Phase I
In operation
100 acres Kakkanad village, Enakulam
District
2) Infopark Kochi Phase II (125
acres taken possession) - under
development
160 acres Kunnathunad / Puthencruz vil-
lages, Ernakulam District
3) Infopark Thrissur - in operation 30 acres Koratty
4) Infopark Cherthala
- operation started
66 acres Pallippuram village, Alappuzha
district
5) Infopark Ambalapuzha Ambalapuzha
CyberPark
7.139 Cyber Park is strategically positioned to provide the benefts of large pool of skilled resources,
the lower infrastructure cost and the high quality of living combined with its location and benefts to
investors around the world. Further the number of reputed universities and educational institutions in
the region has made it even more compelling to start the next phase of IT Parks developments in this
region. The purpose of Cyberpark is to provide a friendly, cost effective and top of the line infrastruc-
ture to the IT/ITES investors, there by acting as a catalyst for the social and infrastructure development
of the region with a vision to provide unlimited employment opportunities and a substantial contribution
to economic development of the state especially the Malabar Region.
7.140 A high development potential for Cyberpark coming up in Kozhikode, Kannur and Kasaragod
is due to the absence of any organized IT infrastructure in the gap starting from Kochi to Mangalore
along the west coast. There is a very strong opportunity for IT and ITES companies to tap into the
huge potential of untapped human resources. Many ITES investors are looking at this region as a po-
tential destination because of its high rate of literacy, the high quality of living, the closeness to major
IT destinations like Bangalore, Mysore and Mangalore added to the loyal and dutiful nature of people
from the Malabar region. The initiative of Cyberpark by the Government of Kerala would be a huge
incentive for the investors to come in and operate from the region.
Kerala State Planning Board
Banking, Insurance and Finance
C
H
A
P
T
E
R
222
Banking, Insurance and Finance
Kerala State Planning Board
223
The Indian economy rebounded strongly in 2010-11 from the moderation induced by global
fnancial crisis. However, several macroeconomic factors posed new challenges in 2010-11. During
the preceding year and a half, Reserve Bank of India (RBI) had to carefully calibrate its monetary
policy as the global fnancial crisis and the consequent slowdown in the global growth, adversely
impacted Indias real and fnancial economic conditions. The RBI responded to the infation challenges
by raising repo rate seven times during the year by 25 basis points (bps) each. Despite these actions,
infation remained elevated due to both newer supply-side shocks and demand factors. In response
to the generalization, the RBI raised its policy rate - the repo rate - more aggressively in 2011-12.
During 2010-11, the RBIs monetary policy stance became strongly antiinfationary. Money growth was
moderate during the year but picked up during the last quarter of [Link] to the commercial
sector increased rapidly during the frst quarter of 2010-11, refecting mainly the borrowings by telecom
companies to pay for spectrum auctions. Notwithstanding some deceleration in the second quarter
of 2010-11, credit growth remained strong throughout the year, in line with the strong growth of the
economy.
8.2 During 2010-11 NABARD has substantially increased its refnance assistance and dis-
bursed an amount of ` 13485.87crore at the all India level against ` 12009.08 cores during 2009-
10. As in the previous year, Andhra Pradesh availed highest refnance assistance from NAB-
ARD during 2010-11 which accounted for ` 2293.47 crore (17%), followed by Kerala availing
refnance assistance of ` 1617.69 crore (12%). The state wise disbursements by NABARD dur-
ing 2010-11 and cumulative disbursements up to March 2011 are given in Appendix 8.1 and 8.2.
8.3 At the national level, number of bank branches of all scheduled commercial banks grew from
98694 at March 2010 to 104770 at the end of March 2011, an increase of 6076 branches within one
year. Of the total bank branches, 33325 are in rural areas, 22419 are in semi urban areas, 33366 are
in urban areas and metropolitan cities having 15660 branches. The largest number of bank branches
are in Uttar Pradesh (12390 Nos.) followed by Maharashtra (11654 Nos.) and Andhra Pradesh (8495
Nos.). In Kerala, total number of bank branches as on March2011 was 4527, which shows that there
is an increase of 300 bank branches within one year. Of this, 348 are rural branches, 3048 are semi
urban branches and 1131 are urban branches. Kerala has the largest number of semi urban branches
with 3048 nos. compared with the other 14 major states in India. The state wise distribution of Sched-
uled Commercial Bank Branches is given in Table 8.1
Banking, Insurance and Finance
Economic Review 2011
224
Table 8.1
Major state wise distribution of Scheduled Commercial Bank Branches at the end of March 2011
Sl.
No
State Rural Semi Urban Urban Metropolitan Total
No. % No. % No. % No. % No. %
1 2 3 4 5 6 7 8 9 10 11 12
1 Andhra Pradesh 2562 7.7 1788 8.0 3015 9.0 1130 7.2 8495 8.1
2 Assam 802 2.4 390 1.7 312 0.94 - - 1504 1.4
3 Bihar 2435 7.3 992 4.4 776 2.3 276 1.8 4479 4.3
4 Gujarat 1591 4.8 1192 5.3 2110 6.3 1396 8.9 6289 6.0
5 Haryana 813 2.4 627 2.8 1183 3.5 145 0.9 2768 2.6
6 Karnataka 2195 6.6 1338 6.0 2758 8.3 1442 9.2 7733 7.4
7 Kerala 348 1.0 3048 13.6 1131 3.4 - - 4527 4.3
8 MadhyaPradesh 1765 5.3 1137 5.1 1413 4.2 566 3.6 4881 4.7
9 Maharashtra 2220 6.7 1651 7.4 4542 13.6 3241 20.1 11654 11.1
10 Orissa 1722 5.2 650 2.9 596 1.8 - - 2968 2.8
11 Panjab 1282 3.8 1180 5.3 1315 3.9 547 3.5 4324 4.1
12 Rajasthan 1834 5.5 1176 5.2 1342 4.0 441 2.8 4793 4.6
13 Tamil Nadu 1789 5.4 2211 9.8 2601 7.8 1139 7.3 7740 7.4
14 Uttar Pradesh 5077 15.2 2119 9.5 3571 10.7 1623 10.4 12390 11.8
15 West Bengal 2426 7.3 715 3.2 2356 7.0 1320 8.4 6817 6.5
Total 28861 86.6 20214 90.2 29021 87 13266 85 91362 87
All India 33325 100 22419 100 33366 100 15660 100 104770 100
Source: Quarterly Statstcs by Reserve Bank of India, March 2011
Advances by Scheduled Commercial Banks
8.4 The total advances fnanced by Scheduled Commercial Banks as at the end of March 2011 at all
India level grew by ` 731249 crore to reach at ` 4076868 crore, as against ` 3345619 crore during the
corresponding period of 2010 resulting in an increase of 21.86 percent. A major portion of this advance
has gone to 15 major states. Maharashtra continues to remain the top most position in the country to
avail the highest amount of credit of ` 1196639 crore representing an increase of `201296 crore from
the previous year. Tamil Nadu and Andhra Pradesh secured the second and third positions to receive
the credit to the tune of ` 392128 crore and ` 321372 crore respectively. Kerala availed an amount
of `122823 crore at the end of March 2011 against ` 95785 crore during the corresponding period in
the previous year and the increase in actual terms is ` 27038 crore. Major state wise disbursement
of advances by scheduled Commercial Banks as on March 2010 and March 2011 with its percent-
age to all India total are given in Table 18.2. The priority Sector advances disbursed by commercial
banks in 2010-11 was ` 71145.14 crore as against ` 58204.35 crore in the previous year. Among the
Banks, State Bank of Travancore maintains the highest percentage of advances (18.73%) followed
by Canara Bank (11.20%) The details of outstanding advances of major Commercial Banks in Kerala
under priority sector as at the end of March 2011 is given in Appendix 8.3. Agricultural sector has been
provided with ` 27438.85 crore followed by `16894.07 crore to Small and Medium enterprises and
remaining portion of ` 26807.50 has been released to other priority sector. (SLBC: 2011)
Kerala State Planning Board
225
Table 8.2
Major state-wise Advances Financed by Scheduled Commercial Banks
at the end of March 2010 and March 2011. (` crore)
Sl. No State Advances 2010 Advances 2011
Amount Percentage Amount Percentage
1 2 3 4 5 6
1 AndhraPradesh 262286 7.8 321372 7.9
2 Assam 18311 0.5 21053 0.5
3 Bihar 29025 0.9 34568 0.8
4 Gujarath 141316 4.2 173432 4.3
5 Haryana 69067 2.1 92773 2.3
6 Karnataka 224359 6.7 253121 6.2
7 Kerala 95785 2.9 122823 3.0
8 MadhyaPradesh 71358 2.1 83302 2.0
9 Maharashtra 995343 29.8 1196639 29.4
10 Orissa 44361 1.3 52909 1.3
11 Panjab 94980 2.8 118906 2.9
12 Rajasthan 94408 2.8 115474 2.8
13 Tamil Nadu 321418 9.6 392128 9.6
14 Uttar Pradesh 134015 4.0 162890 4.0
15 West Bengal 169698 5.1 199582 4.9
Total 2765730 82.7 3340972 82.0
All India 3345619 100 4076868 100
Source: Quarterly Banking Statistics, March 2010 & 2011, RBI
8.5 The total advances disbursed by banks in Kerala including Co-operative Banks, (SLBC: 2011) at
the end of March 2011 are ` 126894.48 crore, out of which, State Bank Group disbursed an amount
of `39201.16 crore (30.89%) with an increase of about18.19 percent over the previous year. Nation-
alized banks disbursed ` 40376.51 crore which represents 31.81%. All the Private Sector Banks to-
gether disbursed ` 36813.45 crore which constitute 29.01% of total advances. The two Regional Rural
Banks(NMGB& SMGB) disbursed ` 5590.74 crore. State Bank Group and Nationalised Banks come
in the forefront in disbursing advances compared to the Private Sector Banks in the State.
8.6 Advances disbursed by scheduled Commercial Banks from 2001 to 2011 in Kerala as well as in
India with percentage of annual growth and incremental advance are furnished in Table 8.3. The data
shows that over a period of 11 years, the advances by Commercial Banks in Kerala exceeded the
all India growth rate during 2001and 2011. During these years the percentage growth in advances
by Commercial Banks in Kerala was 20.3% and 28.23 % respectively against the national growth of
17.3% and 21.9%.
Economic Review 2011
226
Table 8.3
Advances by Scheduled Commercial Banks in Kerala and India (` crore)
Sl.
No
Year Advance in Kerala Incremental
Advance in
Kerala
Advance in India
Amount % of
growth
Amount % of growth
1 2 3 4 5 6 7
1 2001 19180 20.3 3239 511434 17.3
2 2002 22062 15.0 2882 589723 15.3
3 2003 27007 22.4 4945 759210 28.7
4 2004 31548 16.8 4541 890866 17.3
5 2005 39351 23.5 7803 1157807 30.0
6 2006 49153 24.91 9802 1517497 31.1
7 2007 60615 23.32 11462 1949567 28.50
8 2008 71226 17.51 10611 2394566 22.83
9 2009 81612 14.58 10386 2857525 19.33
10 2010 95785 17.37 14173 3345619 17.1
11 2011 122823 28.23 27038 4076868 21.9
Source: Quarterly Banking Statistics by Reserve Bank of India
Advances by Public Sector Banks
8.7 Deposit mobilization and disbursement of credit by the Public Sector Banks in India increased
considerably every year. Total deposit and advances in Public Sector Banks in India during 2010-11
was ` 4210894 crore and ` 3154558 crore respectively. Deposit mobilization and disbursement in
respect of Kerala during this period was `109508 crore and ` 85047 crore respectively keeping the
CD ratio at 77.66 %. A quick review reveals that among the 15 major states, Maharashtra mobilized
highest amount of deposit in the country with ` 982747 crores while advance stood at `840246 crore.
In terms of CD ratio, Maharashtra occupies the third position (85.50%), and the frst and second being
Tamil Nadu (113.62%) and Andhra Pradesh (112.48%) respectively. The State wise Deposits, Credits
and Credit-Deposit Ratio of Public Sector Banks in India are shown in Appendix 8.4.
Kerala State Planning Board
227
Growth of Bank Deposit
8.8 The deposit growth of the countrys banks outpaced credit expansion, on the back of high deposit
rates and a sluggish loan demand. While deposits expanded at 18 percent from a year ago, the credit
growth was capped at 17.6 percent, according to RBI. The higher deposit accretion has enabled the
banks to invest in government securities at more-than-required levels. RBI has projected a deposits
growth of 17 per cent and credit growth of 18 per cent by March 2012. But the current trend suggests
otherwise. Credit growth is expected to slow down to 15-16 per cent, because of the overall economic
scenario.
8.9 The total deposits of all scheduled Commercial banks at all India level in March 2011 was
` 5426510 crore, according to RBI statistics, registering a growth rate of 17.9 percent over the last
year. Total deposit of Kerala during this period also increased by ` 19928 crore from ` 150619 crore
to `170547 crore. Banks in Maharashtra state mobilized the largest amount of deposit of `1471685
crore during 2011. During the period under review, Uttar Pradesh and Karnataka occupied the sec-
ond and third position respectively in deposit mobilization. Major state wise deposits in Scheduled
Commercial Banks as at the end of March 2010 and March 2011 and their percentage to all India total
are furnished in Table 8.4.
Table 8.4
Major state-wise Deposits in Scheduled Commercial Banks (` crore)
Deposits 2010 Deposits2011
Sl. No State
Amount Percentage Amount Percentage
1 2 3 4 5 6
1 AndhraPradesh 249467 5.4 292277 5.4
2 Assam 49545 1.1 59101 1.1
3 Bihar 101452 2.2 119153 2.2
4 Gujarath 216470 4.7 261485 4.8
5 Haryana 109577 2.4 129721 2.4
6 Karnataka 291655 6.3 349009 6.4
7 Kerala 150619 3.3 170547 3.14
8 MadhyaPradesh 119335 2.6 139575 2.6
9 Maharashtra 1224329 26.6 1471685 27.1
10 Orissa 83446 1.8 103225 1.9
11 Panjab 133571 2.9 153737 2.8
12 Rajasthan 107021 2.3 128297 2.3
13 Tamil Nadu 285337 6.2 343635 6.3
14 Uttar Pradesh 314778 6.8 373634 6.9
15 West Bengal 276704 6.0 313348 5.8
Total 3713306 80.7 4408429 81.2
All India 4601926 100 5426510 100
Source: Quarterly Banking Statistics, March 2010 & 2011, RBI.
8.10 SLBC Report reveals that the annual growth rate of deposits in Commercial Banks in Kerala
during 2011 was 12.66%, with a total deposit of `161562 crore, the growth rate of the deposit has
been increased by 2.65% over the last year. (Table 8.5). Domestic deposit increased every year.
Economic Review 2011
228
During 2010 domestic deposit in Kerala was `106518 crore. As at the end of March 2011, it increased
to `123872 crore registering a growth rate of 16.29percent. However, the share of domestic deposit to
total deposit was estimated during 2010-11 as 76.67%. Banking group wise comparison reveals that
33.92 percent of the total deposit in the state is with State Bank group and 31.0 percent with Private
Sector Bank group.
Table 8.5
Growth of Bank Deposit in Kerala
(` crore)
Total Deposit Domestc Deposit NRE Deposit
Year Amount Annual
Growth%
Amount Annual
Growth%
Amount Annual
Growth%
1 2 3 4 5 6 7
2000 38619 22.5 19895 9.3 18724 40.5
2001 44850 16.1 23419 17.7 21431 14.5
2002 51656 15.2 27122 15.8 24534 14.5
2003 59399 15.0 30703 13.3 28696 17.0
2004 65961 9.95 35861 16.8 30100 4.89
2005 69396 5.21 40276 12.3 29121 -3.25
2006 77677 11.93 47006 16.7 30671 5.06
2007 94510 21.07 58393 24.22 33304 8.58
2008 105488 11.62 75599 29.47 29889 -10.25
2009 130350 23.57 93331 23.46 37019 23.85
2010 143404 10.01 106518 14.13 36886 -0.36
2011 161562 12.66 123872 16.29 37690 2.18
Source: SLBC, Kerala.
NRE Deposit
8.11 NRE deposits in Kerala has increased to Rs.37690 crore in 2011 against Rs.36886 crore during
[Link] share of NRE Deposit to total deposit in the State during 2011 was 23.33 percent. The State
Bank Group has the highest share (9.97%) of NRE deposit in the State followed by Private Sector
Banks (6.74%) and Nationalised Banks (5.77%). Growth of Bank deposits in Kerala from 2000 to 2011
are shown in Table 8.5.
Credit Deposit Ratio
8.12 The Credit Deposit (CD) Ratio of all Scheduled Commercial Banks in India by the end of March
2011 was 75.13 percent, which was 72.70 percent during the last year. Tamil Nadu occupied topmost
place among the major 15 States in the CD ratio (114.11%) followed by Andhra Pradesh (109.95%),
and Rajasthan (90%). In Kerala C.D. ratio was observed as 72.02% in March 2011. During March
2010 this was 63.60%. The details of major state wise deposits, credits and C.D. ratio of all Sched-
uled Commercial Banks at the end of March 2011 are given in Table 8.6. As per the RBI statistics on
Public Sector Banks in India, the C.D. ratio in March 2011 was 74.91 percent against 72.79 percent
during March 2010. In Kerala C D ratio was estimated as 77.66 percent in 2011 against 69.32 percent
during 2010. (See Appendix 8.4).
Kerala State Planning Board
229
Table 8.6
Major state wise deposits, credits and C.D ratio of all
Scheduled Commercial Banks at the end of March 2011
Sl. No
States Deposits
(crore)
Credits
(crore)
C.D Rato
1 2 3 4 5
1 Andhrapradesh 292277 321372 109.95
2 Assam 59101 21053 35.62
3 Bihar 119153 34568 29.01
4 Gujarath 261485 173432 66.33
5 Haryana 129721 92773 71.52
6 Karnataka 349009 253121 72.53
7 Kerala 170547 122823 72.02
8 Madhyapradesh 139575 83302 59.68
9 Maharashtra 1471685 1196639 81.31
10 Orissa 103225 52909 51.26
11 Panjab 153737 118906 77.34
12 Rajasthan 128297 115474 90.00
13 Tamil Nadu 343635 392128 114.11
14 Uttar Pradesh 373634 162890 43.60
15 West Bengal 313348 199582 63.69
Total 4408429 3340972 75.79
All India 5426510 4076868 75.13
Source: Banking Statistics Quarterly Handout, RBI.
8.13 An analysis of deposit and credit operations of Public Sector Banks in Kerala reveals that total
Deposit as at the end of March 2011 was `109860.03 crore, and the total advance was ` 85168.41
crore with a C.D. ratio of 77.52% . The CD ratio of Commercial Banks in Kerala has increased to 75.50
percent in March 2011 from 67.63 percent in March 2010. Among all Public Sector Banks in Kerala,
State Bank of Bikanir & Jaipur stood frst as the C.D ratio with 472.67% followed by United Bank of India
286.88%. The C.D ratio of total banking sector (Including Co-operative Banks) in 2011 was 76.09 percen-
tages. Credit deposit ratios of selected major banks in Kerala for 2000 to 2011 are shown in Table 8.7.
Table 8.7
Credit Deposit Ratios of Selected Major Banks operating in Kerala
Name of Bank 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011
1 2 3 4 5 6 7 8 9 10 11 12 13
State Bank of
India
39.80 46.68 42.64 42.32 45.59 56.45 67.19 68.4 75.09 64.44 74.40 82.81
State Bank of
Travancore
45.97 46.00 46.13 48.06 50.89 56.67 62.74 68.65 68.82 58.23 59.48 62.16
Canara Bank 36.95 37.41 42.45 45.84 50.09 59.91 67.32 61.23 64.23 60.18 61.44 69.42
Indian Overseas
Bank
26.25 28.00 33.14 32.33 35.68 39.01 43.08 45.88 47.36 45.14 49.72 62.24
Syndicate Bank 34.94 32.79 31.00 34.17 41.27 63.26 70.27 78.03 88.41 81.48 99.57 112.94
Indian Bank 32..59 35.53 29.80 31.78 33.61 35.59 43.67 51.03 54.98 53.20 52.27 55.00
Economic Review 2011
230
Bank of India 32.83 34.08 31.20 59.31 62.48 80.61 96.64 103.95 80.91 71.79 68.20 70.50
Central Bank of
India
35.48 37.03 35.00 35.26 53.79 63.70 66.95 73.47 65.69 58.19 72.62 98.99
Union Bank of
India
51.36 45.00 49.97 53.54 61.33 81.57 90.80 73.08 66.93 66.98 79.25 84.77
Vijaya Bank 31.05 44.28 40.51 44.44 56.90 57.06 60.09 58.95 54.34 51.47 57.95 78.25
State Average 41.28 42.77 42.71 45.47 48.31 61.39 68.70 70.09 71.39 63.54 67.63 76.09
Source: SLBC, Kerala.
8.14 The Share of NRE Deposit and C.D ratio of some major banks in Kerala as on March 2011 is
given in Table 8.8. It reveals that, State Bank of Travancore holds 28.95% of the total NRE deposit
followed by State Bank of India (15.10%) and Federal Bank (14.04%).
Table 8.8
Share of NRE Deposit and CD Ratio of Major Banks in Kerala (as on March 2011)
Sl. No. Name of Bank Share of NRE Deposit
%
CD Rato
1 2 3 4
1 State Bank of India 15.10 82.81
2 State Bank of Travancore 28.95 62.16
3 Bank of India 1.81 70.50
4 Canara Bank 9.25 69.42
5 Central Bank of India 0.74 98.99
6 Indian Bank 1.79 55.00
7 Indian Overseas Bank 3.04 62.24
8 Syndicate Bank 1.82 112.94
9 Union Bank of India 2.00 84.77
10 Vijaya Bank 0.62 78.25
Total Nationalized Banks 25.53 83.33
11 Catholic Syrian Bank 2.37 48.29
12 Federal Bank 14.04 66.86
13 South Indian Bank 6.41 52.18
Total Private Sector Banks 29.84 71.20
Total Regional Rural Banks 0.52 115.57
Total State 100.00 75.50
Source: SLBC, Kerala - March 2011.
8.15 Bank group wise total deposits, advances and C.D ratios in Kerala from 2001 to 2011 are given
in Appendix 8.5. District wise and bank group wise banking statistics as at the end of March 2010 in
Kerala is given in Appendix 8.6. The District-wise details of banking statistics in Kerala reveals that
Ernakulam district with 724 branches holds the largest number followed by Thrissur with 520 branches
and Thiruvananthapuram 499 branches. In Wayanad and Idukki districts, the credit intake exceeded
considerably against the deposits. The disbursement of credit against deposit in Pathanamthitta dis-
trict was very low with the C.D ratio of 31.6%. In the light of intervention of the State and Central
Governments, Banks in Kerala have slightly modifed their lending policy. Sanctioning of housing,
education and other loans has substantially increased, likewise advances to the weaker sections and
Kerala State Planning Board
231
SC/ST also improved during 2011. Owing to the upward trend of the bank advances, CD ratio reached
the all time higher level of 76.09 in Kerala during 2011. CD ratio trend in the State from 2005 to 2011
is given in Fig. 8.1
Fig: 8.1
Financial Inclusions
8.16 Financial inclusion broadly refers to the process of ensuring access to appropriate fnancial prod-
ucts and services needed by vulnerable groups such as the weaker sections and low income groups
at an affordable cost, in a fair and transparent manner by mainstream institutional players. As of March
2011, 74.4 million No Frill accounts have been opened by domestic commercial banks with outstand-
ing balance of `6566 crore. Basic banking No Frill accounts have nil or very low minimum balance as
well as charges that make such accounts accessible to vast sections of the population. Banks have
been advised to speed up opening of accounts, leveraging ICT to provide benefts to their customers
at their door step. As on March 2011, banks had opened 37.2 million accounts using ICT through Busi-
ness Correspondents.
Housing Loans
8.17 During 2010-11, banks in Kerala including Private Sector Banks sanctioned an amount of `
18531.91 crore to 596934 benefciaries as housing loan against ` 17852.16 crore to 585943 benefcia-
ries during 2009-10 (SLBC: 2011). State Bank of Travancore disbursed an amount of ` 3958.05 crore
to 180762 benefciaries, while State Bank of India sanctioned ` 3331.06 crore to 78318 benefciaries.
Among the nationalized banks, Union Bank of India released largest amount of ` 1193.26 crores to
30515 benefciaries as housing loan during 2010-11, followed by Canara Bank with ` 1115.32 crore
to30058 benefciaries. The bank group wise analysis shows that the State Bank Group disbursed `
7574.18 crore to 180762 benefciaries, Nationalized Banks, ` 5864.93 crore to161518 benefciaries,
Regional Rural Banks ` 464.64 crore to25859 benefciaries, and Private Sector Banks, ` 3468.55.
crores to 80021 benefciaries, Co operative Bank disbursed ` 1159.61 crore to 148774 benefciaries.
The state total was ` 18531.91crore to 596934 benefciaries.
Educational Loans
8.18 There was substantial increase in the disbursement of educational loans in Kerala during 2010-
11. At the end of March 2011, ` 5551.72 crore was sanctioned to299542 students and the percentage
Economic Review 2011
232
increase of education loan and benefciaries during March 2011 was 16.44 and 8.87 respectively over
the last year. State Bank Group has disbursed `` 2275.13 crore to 124894 students, Nationalised
Banks disbursed ` 2566.65 crore to 129629 students. Regional Rural Banks has disbursed ` 310.46
crore as educational loan to 21195 students; Private Sector Banks has disbursed `378.76 crore to
22301 students.
Advances to Weaker Sections and SC/STs
8.19 During 2010-11 an amount of ` 23186.37 crore has been disbursed to 3841112 benefciaries
of weaker sections in the state. Corresponding fgures in 2009-10 was ` 17395.22 crore to 3268270
benefciaries. Weaker sections advances grew by `5791.15 crore during the last fscal. During 2010-
11 the advances to SC/STs was ` 3654.72 crore to 329107 benefciaries against ` 3659.22 crore to
344257 benefciaries during 2009-10. Issuing of advances to them has been reduced slightly during
the last fscal. State Bank group disbursed ` 1881.21 crore to 102068 benefciaries, Nationalized Bank
disbursed ` 1496.11 crore to 151647 benefciaries, RRB disbursed ` 82.89 crore to 42700 benefcia-
ries and Private sector Banks disbursed ` 104.34 crore to 15887 benefciaries as SC/ST advances.
According to the SLBC report, State Bank Group is in the forefront in issuing advances to the SC/ST
compared to other Nationalised and Private Sector Banks in Kerala.
Micro fnance
8.20 Micro enterprise development is viewed as an opportunity for providing gainful employment to the
people below poverty line and thereby improving their income and living standard. Various commercial
as well as co operative banks are extending loans to SHG s for starting productive activity. Members
of the group in an area come together and form an enterprise group. Almost 97 activities are under-
taken by the various Kudumbashree micro enterprise groups in the state and these vary from catering
services, dairy units, hotels, ethnic delicacies, garment units, goat rearing etc.
8.21 In Kerala, more than 3.5 lakh Self Help Groups (SHG) maintaining their savings bank accounts
with ` 1024.68 crore in various banks as on March 2011. Table 8.9 depicts that category wise money
transaction of SHG under different bank group. Despite State Bank Group holds major share of SHG
accounts (51%), Nationalised Banks mobilized highest amount of deposits (41.45%) followed by Pri-
vate Sector Banks (36.28%).
Table 8.9
Self Help Groups Maintaining Savings Bank Accounts (` crore)
Sl
No
Bank Total [Link] SHGs
maintaining SB A/C
Of (3) under Govt.
Sponsored Schemes
Of (3) exclusive
women SHGs
Of(5) under
Govt. Sponsored
Schemes
No Amount No Amount No Amount No Amount
1 2 3 4 5 6 7 8 9 10
1 State Bank
Group
189442 216.67 58727 83.64 170054 200.50 54628 77.84
2 Nationalised
Banks
88609 424.82 23506 76.64 74699 343.48 15737 73.40
3 Regional Rural
Banks
40851 11.40 13387 4.53 34440 7.96 11811 3.86
4 Private sector
banks
48570 371.79 10929 160.33 42320 344.45 9486 142.10
Total Com-
mercial Banks
367472 1024.68 106549 325.14 321513 896.39 91662 297.20
Source: SLBC,Kerala,2011
Kerala State Planning Board
233
Insurance Sector
8.22 India ranked 9th among the 156 countries in life insurance sector [Link] are 49 insur-
ance companies in India. The frst year premium, which is a measures of new business secured,
underwritten by the life insurers during 2010-11 was `126381 crore as compared to `109894 crore in
2009-10 registering a lower growth of 15per cent against 25.84 percent of 2009-10. The total premium
underwritten by the life insurance sector in 2010-11 was `291605 crore as against `.265447 crore
in 2009-10 showing a growth of 9.85 percent. On the other hand the non life insurers underwrote
premium of ` 42576 crore in 2010-11, as against ` 34620 crore in 2009-10 registering a signifcantly
higher growth of 22.98 per cent against growth of 14.06 percent in the previous year. During 2010-11,
life insurers issued 482 lakh new policies.
8.23 During the year 2010-11, the life insurance industry reported a net proft of ` 2657 crore as against
net loss of `989 crore in 2009-10. Out of the 23 life insurers in operations during 2010-11, twelve
companies reported profts including LIC of India. LIC has reported net proft of `1172 crore i.e., an
increase of 10.47 percent over `1061 crore in 2010.
8.24 In Kerala, individual new business No of policies and premium amount of all insurance companies
achieved respectively are 2193836 and `4645.81crore. New business under group wise in the state
is ` 862.58 crore premium and through which 919667 lives are covered. Direct premium income for
2010-11 in Kerala under various sources like Personal Accident, Health, and Crop Insurance etc are
estimated at ` [Link].
Agricultural Finance
8.25 Agency-wise disbursement of the annual credit fow in the state is given in Table 8.10 In the dis-
bursal of total advances, commercial banks stood at the frst place disbursing `34281 crore (57.43%)
in 2010-11, followed by Co-operative Banks (34%), RRBs (7.66%) and KFC(0.90%). In Agriculture
lending also commercial banks dominated by disbursing `18857 crore (65.81%) followed by Co-
operative Banks (24.45%) and RRBs (9.75%).
Table 8.10
Agency-wise Annual Credit fow to Agriculture and total priority sector in Kerala (` in crores)
Priority Sector Agriculture
Agency 2008-09 2009-10 2010-11 2008-09 2009-10 2010-11
Commercial Banks 23691 29753 34281 11796 14741 18857
RRBs 3083 4303 4573 2081 3090 2785
Co-operatives including KS-
CARDB
12748 17103 20297 4941 6292 7008
Kerala Financial Corporation 199 333 539 18 1 3
Grand total 39721 51492 59690 18836 24124 28653
Source: State Level Bankers Committee
8.26 The credit fow to agriculture sector during the last 5 years is given in Table 8.11 The share of
production credit has increased by 4% while investment credit diminished by 4% during 2010-11.
Table 8.11
Production and Investment Credit to Agriculture Sector (` Crores)
Year Producton Credit Investment Credit Total
2006-07 9664 (81%) 2262 (19) 11906
2007-08 13203 (83%) 2757 (17%) 15960
2008-09 14605 (78%) 4228 (22%) 18836
2009-10 18817 (78%) 5307 (22%) 24124
2010-11 23512 (82%) 5141 (18%) 28653
Source: SLBC
Economic Review 2011
234
8.27 In the agency-wise analysis, it is seen that the major portion of short term and medium term credit
requirements in the state are met by commercial banks followed by the Co-operative banking sector
consisting of the State Co operative Banks, District Co-operative banks and Primary Agriculture Credit
Societies which covers 1/5th of the activities. The share of co-operatives in the disbursal was 92 per
cent in production credit and 8 per cent in investment credit. The share of RRBs in production credit
and investment credit was 98 per cent and 2 per cent respectively.
Table 8.12
Agency wise fow of credit during 2010-11 (` Crores)
Agency Producton
Credit
Investment
Credit
Total Agricul-
ture Credit
% Produc-
ton Credit
to total Agri.
Credit
% Invest-
ment Credit
to Total
Credit
Commercial banks 14459 4398 18857 77 23
Co-operative Banks 6101 506 6607 92 8
LDB 221 180 401 55 45
RRBs 2730 55 2785 98 2
Other Agencies 0.75 2 2.75 28 72
Total 23512 5141 28653 82 18
Source: SLBC
Long term credit:
8.28 A net work consisting of the Kerala State Co-operative Agricultural and Rural Development Bank
(KSCARDB) at the Apex and 49 Primary Co-operative Agricultural and Rural Development Banks at
Taluk Level is responsible for long term credit disbursement for rural development in the state. Vari-
ous activities covered by KSCARDBs lending in scheme loan include Minor Irrigation, Plantation and
Horticulture Agricultural machinery, Land Development, poultry, fsheries etc., where as under ordi-
nary loan include construction of Wells/Tanks, construction of Godowns/cattle, Barbed wire or stone
fencing, Construction of drainage channels etc. The Bank raises funds through foating of debentures
issued on government guarantee; NHB, LIC, SBI and SBT etc., are the fnancial institutions which
invest in the debentures foated by the KSCARDB. The total long term loan disbursed during 2010-11
by KSCARDB was `890.57 crore against that of `689.42 crore in 2009-10 registering an increase of
29%. The details of loan disbursement is given in Appendix. 8.7 Purpose wise classifcation of long
term loans issued by Primary Co-operative Agricultural and Rural Development Banks is shown in
Appendix.8.8
8.29 The Non farm sector lending scheme intends to provide fnancial assistance to meet the credit
needs of individual artisans, craftsmen, handicraftsmen and small entrepreneurs who undertake man-
ufacturing and processing activities as approved by the Development commissions of SSI, Govern-
ment of India. Small Road and Water Transport operators scheme for public goods carriage and pas-
senger vehicles/boats, Integrated Loan Scheme for new industrial ventures/modernization of existing
SSI, Educational Loan for higher education in India and abroad as recognized by Central and State
Government are also introduced under the long term loan disbursement scheme. The Bank has also
fnancing tourism related activities with the assistance of NABARD to promote farm tourism / home
stay which enables the farmers to generate additional income. A new scheme in the name of Card
Bank J ewel Scheme was introduced by the Bank to the member borrowers to acquire asset in the form
of gold coin or ornaments to meet the future requirements as marriage of their daughter / son.
Kerala State Planning Board
235
Refnance Support by NABARD
8.30 Investment credit facilitates necessitate capital formation in agriculture, which considered to be a
pre-requisite for upgrading the technology and improving resource use effciency in agriculture. NAB-
ARD provides refnance for investment credit at concessional rates of interest, facilitates augmenting
the fow of investment credit at the ground level through various policy initiatives/programmes.
8.31 At the national level, the total refnance disbursement during 2010-11 stood at `13485.87 crore
as compared to the disbursement of `12009.08 crore during previous year. In Kerala the total dis-
bursement of refnance from NABARD was `1538.30 crores durimg 2010-11. Commercial Banks
accounted for the highest share of 69.57% in the total refnance disbursed in the state. This was fol-
lowed by Kerala State Co-operative Agricultural Rural Development Bank ` 334.78 crore (21.76%) and
RRBs. The disbursement of RRBs registered a lowest of 8.67%. Agency wise and purpose wise dis-
bursement of refnance assistance by NABARD in Kerala is given in Appendix 8.9 and Appendix 8.10
8.32 The purpose-wise analysis of the refnance by NABARD reveals that as in the previous years,
the major share of assistance was availed by the non-farm sector (26.81%), and under farm sector,
the refnance disbursement has shown a declining trend. In the disbursement, the major share was
for Self Help Groups (2.13%). The refnance for the sectors like fsheries and poultry which are very
important in the rural economy of Kerala but the sectors were neglected during 2010-11.
Rural Infrastructure Development Fund (RIDF)
8.33 The RIDF was set up in NABARD with contribution from the Commercial banks which were not
able to fulfll the commitment of channelising at least 18 per cent of their total lending to agriculture.
RIDF has been instrumental in strengthening the rural infrastructure in the State. The RID Fund start-
ed in 1995-96 with a corpus of `2000 crores has emerged as a popular and effective mechanism for
fnancing rural infrastructure projects and its corpus from RIDF I to XVI stands at `121888.40 crore
and `80498.74 crore disbursed as on 31.3.2011.
Assistance to Kerala
8.34 Kerala has been receiving assistance under RIDF for the last ffteen years. The major projects for
which refnance has been disbursed include watershed development projects, rural bridges, rural roads,
reclamation of waterlogged area, inland navigation, tourism oriented roads and rural market yards.
8.35 The cumulative sanction amount as on 31.3.11 was `3427.56 crore and the disbursement was
`2302.38 crore (67.17%) for the implementation of 3226 projects. The tranche wise sanction and dis-
bursement under RIDF are shown in the Table8.13
Table 8.13
Tranche wise Sanction & Disbursement under RIDF (` crore)
RIDF Kerala as on 31.3.2011 India as on 31.3.2011
Sanction Disbursement Sanction Disbursement
1 2 3 4 5
I 91.66 81.98 1906.21 1760.87
II 86.91 73.13 2636.08 2397.95
III 89.29 73.88 2732.69 2453.50
IV 64.00 56.73 2902.55 2482.00
V 126.77 117.23 3434.52 3054.96
VI 172.51 159.02 4488.51 4070.85
VII 181.87 158.59 4582.32 4052.59
VIII 193.97 167.62 5950.19 5148.50
Economic Review 2011
236
RIDF Kerala as on 31.3.2011 India as on 31.3.2011
IX 89.94 74.37 5638.26 4916.48
X 216.71 178.18 7650.51 6568.69
XI 174.71 133.88 8310.50 7010.19
XII 241.87 190.11 10377.15 8000.72
XIII 295.94 265.72 12614.46 8968.09
XIV 500.71 312.64 14726.35 9252.67
XV 368.72 143.08 15623.22 6629.24
XVI 531.98 116.22 18314.88 3731.44
Total 3427.56 2302.38 121888.40 80498.74
Source : Annual Report 2010-11, NABARD
Kerala State Planning Board
237
Tourism
8.36 Kerala, located on the south western tip of India, enjoys unique geographical features that have
made it one of the most sought-after tourist destinations in the world. Fondly referred to as Gods
Own Country, Kerala was selected by the National Geographic Traveller as one of the 50 destinations
of a lifetime and one of the thirteen paradises in the world. Its unique eco tourism initiatives, culture
and traditions coupled with its varied demography has made Kerala one of the most popular tourist
destinations in the world. An equable climate, serene beaches, tranquil stretches of backwaters; lush
hill stations and exotic wildlife are the major attractions of this land. A unique advantage of Kerala is
that most of the destinations here are only a two - four hour drive from the other. Kerala has fascinated
people from all over the world with her secularism and her culture.
8.37 The tourism industry has taken the state of Kerala to the global map with its branding. The brand
Gods own country has become popular around the world. Kerala has an active tourism industry and
is accepted as one among the most suited industry for Kerala. Popular attractions in the state include
the beaches such as Kovalam, Varkala, Marari, Bekal and Kannur. Keralas most popular backwater
destinations are Kumarakom, Alappuzha, Kollam, Kochi and Kozhikode, and its best known hill sta-
tions are Ponmudi, Munnar, Wayanad and Wagamon. Kerala has a number of well- known wildlife
reserves, including the Periyar Wildlife Sanctuary, Eravikulam National Park, Thattekkad Bird Sanctu-
ary and Parambikulam Wildlife Sanctuary .
8.38 Kerala is today the most acclaimed tourist destination in India with its Super brand Gods Own
Country and is continuing as one of the prime tourist destinations of South Asia. Tourism industry in
Kerala not only facilitates infrastructure development but also help in balanced and sustainable re-
gional growth by generating income and creating employment opportunities.
Keralas model for success
Strong brand positioning
Product differentiation
Model public private partnership
Tremendous political support
Public acceptance
Vibrant Private sector
Performance of Kerala Tourism during 2010-11
Foreign Tourist arrival to Kerala during the year 2010-11 was 6,59,265. It shows an
increase of 18.31% over the previous year.
Domestic Tourist arrival to Kerala during the year 2010-11 was 85,95,075. It shows
an increase of 8.61% over the previous year.
Foreign exchange earnings for the year 2010-11 were `. 3797. 37 crores which re-
corded an increase of 33.09% over the previous year.
Total Revenue (including direct & indirect) from Tourism during 2010 was `.17348
crores, showing an increase of 31.12% over the last years fgure.
In India, Foreign Tourist Arrival during 2010 was 5.58 million with a growth rate of
8.1% as compared to the previous year.
In India, Foreign exchange Earnings in Rupee terms during 2010 were Rs. 64889
crores as compared to 54960 crore in 2009 which shows an increase of 18.07%.
The 8.1% growth rate in Foreign Tourists arrival in India for 2010 over 2009 is much
better than UNWTOs projected growth rate of 5% to 6% for the world during the
same period.
Tourisms contribution to States GDP is around 9%
The average per day expenditure of a foreign tourist is Rs. 3600 /-
The average per day expenditure of a domestic tourist is Rs. 1800/-
The average length of stay of a foreign tourist is 16 days
The average length of stay of a domestic tourist is 6 days
Economic Review 2011
238
Foreign Tourist Arrivals
8.39 The year 2010-11 has been recorded as a year of revival compared to the previous [Link]-
national Tourist arrival continued to decline due to the impact of Global Economic crisis in the previ-
ous years. But the year 2011 marked a signifcant improvement. The number of foreign tourists ar-
rived in Kerala in the year 2010-11 is 6,59,265 against 557258 in 2009-10. It shows an increase of
18.31 per cent over the previous year. During the last year Kerala has contributed 11.81 % of the total
foreign tourist arrivals to India. Appendix 8.11 gives the details of foreign tourist arrivals in Kerala and
in India from 2005 to 2010. Fig 8.2 gives a comparison of growth of foreign tourist arrivals in Kerala
Fig 8.2
Source: Dept of Tourism
Domestic Tourist Arrivals
8.40 The number of domestic tourists to Kerala in the year 2010-11 was 8595075 against 7913537
in 2009-10. It shows an increase of 8.61 per cent over the previous year. Appendix 8.12 gives the
domestic tourist arrivals to Kerala from 2005 to 2010. The growth in foreign and domestic tourist ar-
rivals to Kerala from 2005 to 2010 is given in fg 8.2.
Fig 8.3
Source: Dept of Tourism
Kerala State Planning Board
239
District wise arrival of foreign and domestic tourists in Kerala.
8.41 Thiruvananthapuram and Ernakulam are the two leading districts recording the foreign tourists
arrivals to Kerala for the last few years. For the domestic tourists arrival to Kerala, Ernakulam and
Thrissur are the leading districts. Ernakulam is leading district in domestic and foreign tourists arrival
where as Pathanamthitta is the least. The district wise arrival of foreign and domestic tourists for the
year 2011 is given in Appendix 8.13. Figure 8.4 gives the comparison of District wise arrival of foreign
and domestic tourists in Kerala.
Fig 8.4
Source: Dept of Tourism
Economic Impact of Tourism
8.42 Tourism sector occupies a signifcant place in the foreign exchange earnings of the World, and
has acquired tremendous progress in recent years. The sector is growing at a faster pace, especially
in the developing countries. The tourism industry is a major contributor of foreign exchange earnings
to the States economy. The details are given in Appendix 8.14. It is found that the foreign exchange
earning during the year 2010-11 is `.3797.37 crore which recorded an increase of 33% over the previ-
ous year. The total revenue generated from tourism comes to `17348 crore, showing an increase of
31.12 per cent over the previous year and the tourism contribution to states GDP is 9 per cent. From
the graph shown below, it is clear that earnings from Tourism show an increasing trend over the years.
Fig. 8.5
Economic Review 2011
240
Financial Assistance
8.43 Adequate plan support are made available to the sector in every successive fve year plans.
Private investments are promoted by providing incentives and infrastructure support. The State plan
allocation for tourism for the last 5 years are given in Appendix 8.15 and central plan allocation for
Tourism for the same period are given in Appendix 8.16.
New Initiatives in Tourism sector
Responsible Tourism adopted as the cornerstone for tourism development in the state. Desti-
nation level Responsible Tourism Committees and Working groups were formed at Kovalam,
Kumarakom, Thekkady & Wayanad
Destination Management Councils were formed to undertake and maintain the tourism projects
completed in tourism destinations and to evaluate the basic infrastructure , security , protection
, encroachment , new schemes etc
Wake up to Malabar - Comprehensive plan to promote North Kerala
Kerala Souvenirs - Unique project launched for design development and capacity building- the
committee appointed by the Govt. approved 110 souvenir designs and necessary steps were
taken to market these items.
Lets Learn - Unique HR initiative launched for skill development in the tourism and hospitality
sector-training at various sector is going on
Grand Kerala Shopping Festival - A bold initiative to make Kerala, the shopping hub in the
country- steady increase in participation 13 lakhs coupons were distributed during the second
edition compared to that of 6 lakhs in the 1st edition .
Utsavam- Year-long festival of traditional arts spread through out the state- 23 venues 805
programmes more than 1000 artists
Dream Season campaign launched to tackle seasonality
Monsoon Tourism- offering many packages by travel & tourism industry
International Convention Centre at Thiruvananthapuram
Homestay-Promotion and Classifcation- Presently 469 classifed homestays
Vazhiyoram a unique scheme for development of way side facilities through private participa-
tion
Tourism Conservation and Preservation Act- To regulate tourism development
A series of online initiatives branded [Link] have been launched to promote Kerala ag-
gressively on the internet .
A social media optimization activity is also being carried out to use social media tools like Twitter
, Facebook , You Tube etc to reach out to travellers .
Kerala Tourism has also entered in to a partnership with Google , the No.1 internet property
worldwide for the popular search based campaigns.
Projects/schemes
Special focus was given to Malabar area and projects are sanctioned to develop the following
centers in Malabar.
International Hospitality Institute at Kozhikkode
Kodungallur Heritage Circuit
Nila Heritage Circuit
Wayanad destination development
Development of Palakkad Mangalam Dam
Development of Malampuzha, Palakkad
Development of Kottakkunnu , Malappuram
Development of Thalassery heritage circuit 2nd Phase
Development of Iringal art & Craft village 2nd phase
Development of Pazhassiraja memorial museum, Mananthavady,W ayanad
Development of Beeyem Kayal at Malappuram
Kerala State Planning Board
241
Responsible Tourism
8.44 Responsible Tourism is a Tourism Management strategy embracing planning, management,
product development and marketing to bring about positive economic, social, cultural and environ-
mental impacts to the local community. Kerala Tourism has been piloting the responsible tourism ini-
tiatives at 4 destinations viz Kovalam, Kumarakom, Thekkady and Wayanad with very active support
of the local self Governments, Tourism Industry, Kudumbasree, NGOs and the local community as a
whole. The remarkable feature of Responsible Tourism is that it provide better living conditions to the
local community, extra income generation, emergence of new entrepreneurs, micro enterprises, large
area brought under cultivation.
Tourism as an upcoming Industry
Kerala is aiming to attract more and more investment in the Tourism industry
According to Kerala, Tourism is a high growth industry holding great potential and invited entre-
preneurs to invest
Health Tourism , Kerala is leaping to the top destination of the world . Kerala has world class
medical infrastructure and can provide quality health care at about 10 percent of the costs in the
US or UK
A thrust was given to the Malabar area , waterways from Manjeswaram to Kovalam , cleanliness
and safety of tourism destinations , tourism festivals etc
Effort has been taken to meet the additional room requirements by encouraging Home stays and
private investments at different levels
The focus will be on the development of basic infrastructure in tourism. Destinations and make
them clean and safe as per international standards.
Supporting Organisations
Tourist Accommodation
8.45 The hotel sector forms one of the most important parts of tourism industry. Kerala has to its credit
a total of 13861 rooms in classifed hotels, which is 15.9% of total classifed room availability in India.
The maximum number of rooms being in 3-Star categories ie 7480, followed by 2 star categories.
Compared to 2009, classifed rooms available in Kerala shows an increase of 29%. The details of
availability of accommodation facility in classifed hotels in 2009and 2010 are given in Appendix 8.17
Kerala Tourism Development Corporation (KTDC)
8.46 KTDC is a commercial agency, which is actively participating in building up basic infrastructure
needed for the development of tourism in the State. KTDC is running hotels and wayside amenity
centers in almost all tourist destinations. Presently they own 8 classifed hotels, 7 budget hotels,
13 motels, 13YatriNivas/Tamarind Hotels, 20 Restaurants & Beer parlour, 4 Restaurant and 4 Boat
Clubs. In total there are 706 rooms. They conduct tours and central reservation [Link] number
of bed available for the year 2010-11 is around 493827and Domestic Tourists occupied 124017 and
foreign tourists 11670 beds. The details of income and operational expenditure for the year 2010-11
is given in Appendix 8.18
District Tourism Promotion Councils (DTPCs)
8.47 The District Tourism Promotion Councils have undertaken the responsibility of creating and mar-
keting local tourism products and opportunities. They are constantly improving the quality standards
of these tourism products and services through surveys and other data collection means. The DTPCs
also monitor and supervise the levels of sanitation in tourist destinations. Other related activities of
the DTPCs are the creation of awareness of facilities and services in their specifc area, development
of tourism clubs, dissemination of tourism specifc information, home stay scheme and development
of local basic infrastructure.
Economic Review 2011
242
Tourist Resort (Kerala) Ltd (TRKL)
8.48 Tourist Resort (Kerala) Ltd is the agency meant for joint venture projects. Presently there are 4
hotels at Varkala, Kumarakom, Thekkady and Ernakulam sharing with TAJ group. It also overseas
the Land Bank Scheme. Investment development at tourism Sector, conducting of Investors Meet
and formation of consultancy cell for tourism development are the other major achievements of TRKL
during the year.
Bekal Resort Development Corporation (BRDC)
8.49 Bekal Resorts Development Corporation Ltd. is a company formed for the development of Bekal
and surrounding tourist attractions. The main focus is to provide marketing resources and to be ac-
tively involved in local, regional and state wide marketing promotions.
Kerala Institute of Tourism and Travel Studies (KITTS) and Food craft
Institutes (FCIs)
8.50Kerala Institute of Tourism and Travel Studies is a pioneer organization offering quality education
and training in tourism in the state. These institutes are actively involved in the recruitment, and placing
of quality staff in the tourism site throughout Kerala. All aspects of Human Resources Development for
the tourism and hospitality sectors are impacted by KITTS and FCIs by establishing and monitoring the
quality regulations of the Tourism and Travel Training Institutes.
Eco - Tourism
8.51 Kerala is famous for its ecotourism initiatives. The broad objectives of Eco-tourism are
convert entire tourism industry in Kerala into Eco-friendly mode.
strengthen Eco-tourism development initiatives in the State.
ensure local community involvement in tourism initiatives leading to employment and income
generation and it also intends to create public awareness and involment in responsible tourism
development.
Thenmala Ecotourism Project
8.52 The frst phase of the Thenmala Ecotourism project was inaugurated during 1999 with the com-
mencement of boating in the Shenduruney Wildlife Sanctuary reservoir and the Deer Rehabilitation
Center. The second phase of the Thenmala Ecotourism Project was inaugurated during 2001 with the
commencement of eco-friendly general tourism activities like Leisure Zone with Sculpture Garden,
Board Walk, etc., Adventure Zone with Elevated Walkway and lots of adventure activities and Culture
Zone with the Facilitation center, Musical Dancing Fountain, Amphitheatre, Restaurant, offce com-
plex.
The activities like Butterfy safari has been attracting large number of tourists. Deer Rehabilitation
Center had commenced in 1999 itself. TEPS in association with Shendurney Wildlife Sanctuary has
initiated trekking activities in the tourism zone of wildlife sanctuary.
The details of the revenue generated and the number of tourists visited from 2005-2011 are shown in
the Table.
Table-I
Number of Tourists visited and Revenue Generated from Thenmala Ecotourism
Financial Year Number of tourist visited Revenue generated
(in rupees )
2005-06 114443 3926430
2006-07 120178 4954459
2007-08 104758 4602536
Kerala State Planning Board
243
Financial Year Number of tourist visited Revenue generated
(in rupees )
2008 -09 92191 4813440
2009-10 114714 5535195
2010-11 130961 7050000
Source: Directorate of Eco Tourism
During the fnancial year new eco-friendly activities like solar powered and manual coracle rides
rafting in the reservoir, up-gradation of musical dancing fountain and creation of jungle camping fa-
cilities, enhancing interpretation facilities etc were successfully completed and started operation.
Ecotourism initiatives Implemented Through Forest Department
8.53 The Forest Department is evolving modalities for developing community based ecotourism products
in the already identifed potential ecotourism spots through the institution of Vana Samrakshana Smithy
(VSS) / Eco Development Committees (EDC) ie., the committee of the local dependent communities. Certain
successful models of these efforts are programmes at Athirappally, Vazhachal and Thekkady. Community
led ecotourism activities are already in place at Palaruvi, Kallar, Chinnar, Aralam, Thommankoothu etc.
Awards & Recognitions
u Kerala selected as the 3rd best tourist destination in Asia by Smart Travel Asia
u Kerala Tourism bagged 6 more National Awards from Govt. of India , Ministry of Tourism in the
following categories :
n Best innovative adventure activities
n Best state-most innovative cultural initiative Utsavam
n Best Responsible Tourism Award
n Best tourist friendly award Trivandrum Golf Club
n Best Tourist friendly port- Kochi
n Best Tourism Film- Rhapsodies from Gods own country
u Pacifc Asia Travel Association (PATA) - 2011
u 3 Gold Award in marketing media, marketing secondary government destination , marketing
media public relations for your moment is waiting
u 7 times winner of Best Tourism State award from India Govt. in the last eight years
u Kerala tourism website [Link] bagged one more award for the best tourism
website from PC world.
u CNBC Travel Award
u A survey conducted by Smart Travel Asia Travel Magazine reveals that Kerala has won the
distinction of being the third popular tourist destination in Asia ,Bali and Phuket in Thailand, in
the frst and second places .
Threats to the Tourism Industry in Kerala
Global Warming and changing weather patterns
Differing monsoon pattern.
Global Economic Recession
Opening of Srilanka as a safe destination
Economic Review 2011
244
Priorities of the State
v To position Kerala as a model state on Responsible Tourism with Community participa-
tion Involvement of local self government, community groups and NGOs in tourism
planning, implementation and operation of tourism products, and creation of employ-
ment opportunities for the local population
v To promote private investments in tourism
v To Identify and promote new tourism destinations and circuits by utilizing the natural and
cultural heritage of the state
v To create quality infrastructure at waysides and tourist destinations
v To focus on domestic market and identifed international markets
v To fully utilize the tourism potential of Malabar Region for the dispersal of tourism activity
concentration in the South and Central Kerala
v To conserve the natural and cultural heritage of the state
v To revive and promote traditional industries and agricultural sectors
through tourism
v To promote innovations in tourism
v To create new tourism products
v To continue the focus on eco-tourism, backwater tourism, Ayurveda and other forms of
wellness tourism
v To Strengthen the Human Resource Development sector in tourism to take care on the
large volume of capacity building needs of the local community and various stakeholders
in the tourism industry
v To bring in innovative IT projects to promote Kerala Tourism
v To bring in a quality control system
v To create and develop a new brand image
v To strengthen the organizational set up in tourism development and promotion to take
care of the new challenges
v To improve connectivity
v To have clean and safe tourist destinations
v To institutionalize the coordination between Government and the industry
Kerala State Planning Board
Energy Development
C
H
A
P
T
E
R
248
Kerala State Planning Board
249
Energy is an essential input to the overall development of the economy. It provide light and fuel
to millions of households, electricity to industry, agriculture, commerce, all service sectors and so on.
Since energy is a critical component, development of conventional and Non-conventional forms of en-
ergy for meeting the growing demand of the society at reasonable price and quality is the responsibility
of the Govt. For the purpose so many projects are initiated during XI
th
plan.
Power Sector in India
9.2 The power sector has achieved signifcant progress since planned development of the Indian
economy. The Eleventh Plan envisaged an increase in primary energy availability (i.e. from coal, lig-
nite, crude oil, natural gas, hydro power, nuclear power, wind power and non-commercial energy)
at 6.4 % per year taking the total availability from 550Mtoe in the terminal year of the Tenth Plan to
715Mtoe in the terminal year of the Eleventh Plan. Hydro power and coal based thermal power have
been the main sources of generating electricity in India and nuclear power development is at slower
pace. The Government of India got itself involved in a big way in the generation and bulk transmission
of power to supplement the efforts at the State level and took upon itself the responsibility of setting up
large power projects to develop the coal and hydroelectric resources in the country as a supplemen-
tary effort in meeting the countrys power requirements.
9.3 The Indian Power Sector is one of the fastest growing sectors in the world and energy availability
has increased by around 36% in the past 5 years, the demand for power exceeds its supply. Nearly
60 crore Indians do not have access to electricity. The energy and peaking defcits have been hover-
ing around double digits for the past two years and the condition might worsen in the coming years
considering the huge demand of power from Indias rising population and rapid industrialization and
urbanization. Hence, there is no slowing down of demand for the Power Sector , thus offering ample
scope for rapid capacity addition.
Installed Power Generation in India
9.4 Power sector witnessed severe fuctuations in performance during the periods of Eleventh Five
Year Plan in terms of capacity addition. The country hopes to achieve 78000 MW in the generation
capacity in the fve years ending 2012. The country produces 173626.40 MW of power as on March
2011, but nothing can illustrate the slack pace of capacity addition. The total demand for electricity in
India is expected to cross 950000 MW by 2030. About 65 % of the electricity consumed in India is
generated by thermal power plants, 22 % by hydro electric power plants and 3 % by nuclear power
plants and 10 % by renewable sources. Details shown in the Table 9.1
Energy Development
Economic Review 2011
250
Table 9.1
Total Installed Capacity in India as on 31.03.2011
Fuel MW (Percentage)
Thermal 112824.48 64.98
Hydro 37567.40 21.64
Nuclear 4780.00 2.75
Renewable Sources 18454.52 10.63
Total 173626.40 100.00
Source: Ministry of Power, Govt of India
9.5 The installed power generation in the country has increased from 167077.36 MW as on 30.11.2010
to 173626.40 as on 31.03.2011. The capacity addition was 6549.04 MW. Out of the total installed
capacity of 173626.40 MW, a major chunk of the energy generation comes from thermal energy as
112824.48M.W (64.98%). It was followed by hydro 37567.40 MW (21.64%), nuclear 4780.00 MW
(2.75%) and 18454.52 MW (10.63) of renewable sources. The percentage of increase in installed
capacity from 2010 to11 was 3.92 %. Contribution of each sector to the national grid as on March 2011
is shown in the table 7.2.
Table 9.2
Sectoral Contribution as on 31.03.2011
Sector MW (Percentage)
State Sector 83340.67 48
Central Sector 53824.18 31
Private Sector 36461.55 21
Total 173626.40 100.00
Source: Ministry of Power, Govt of India
Keralas Power Sector Projections
9.6 In the past, the energy demand was presumed to be basis with load factor being used to convert
the projected energy demand to peak MW demand. The projected energy demand was worked out
by a combination of end use and time series analysis. This was the methodology used in the Electric
Power Surveys (EPS) conducted by CEA in conjunction with the State Electricity Boards.
9.7 One of the problems with the above approach has been consistent over projection of peak de-
mand. The annual growth of peak power demand has been assumed to be of the order of 7-8% and
this has resulted in projections well beyond actual demand realised.
9.8 Some of these anomalies have been corrected in the current Electric Power Surveys conducted
and the projections for Kerala as continued in the 17th Survey. The fgures for Kerala in terms of de-
mand projection in the Draft 17th EPS are given below.
Table 9.3
17th EPS Estimates for 11th Plan period
Year
Energy Consumption
Peak Demanded Annual Load Fac-
tor (%)
2006-07 11147 2699 60.75
2007-08 12037 2823 61.54
2008-09 12973 2947 62.34
Kerala State Planning Board
251
Year
Energy Consumption
Peak Demanded Annual Load Fac-
tor (%)
2009-10 13977 3078 63.14
2010-11 15112 3227 63.94
2011-12 16345 3391 64.74
Source: EPS Draft report
9.9 It is evident from the 17th EPS Draft Report, that a number of assumptions made for projections
which may result in the actual demand being more than what is projected in the EPS or less. KSEBs
own projections taking into account a higher growth rate and a slightly lower load factor projects the
following demands for the 11th plan period.
Table 9.4
KSEBs projections for the 11th Plan Period
Year Energy Consumption Peak Demand Annual Load Factor (%)
2007-08 15217 2856 60.82
2008-09 16096 3004 61.17
2009-10 17025 3159 61.52
2010-11 18077 3335 61.87
2011-12 19230 3528 62.22
Source: EPS Draft report
Power Sector in Kerala
9.10 Power Sector in Kerala plays a vital role in all developmental activities in Kerala. Obviously power
crisis is the prime obstacle to start new initiatives in the industrial feld. The need for power is increas-
ing and the production of power should also be increased accordingly. Monsoon is essential to sus-
tain the hydropower base in the state and the shortage in rainfall usually creates power crisis. Kerala
received abundant monsoon during the current year and it increased the infow in to KSEB reservoirs;
the KSEB could manage the power supply situation with higher quantum of cheaper hydel power.
Kerala is one among the very few states in the country where there was no load shedding and power
cut during 2010-11. KSEB has been responsible for the generation, transmission and supply of elec-
tricity in the Sate, with particular emphasis to provide electricity at affordable cost to the domestic as
well as for agricultural purposes. The Board has been passing through a transitional phase of reforms
in the electricity sector. The Electricity Act 2003 envisages separate organizations for Transmission
and Distribution.
Economic Review 2011
252
Generation
9.11 The history of Hydro Power development in Kerala begins with the commissioning of Pallivasal
Hydro Electric Project in 1940. Next few decades refected the progressive developments of various
hydroelectric schemes implemented in the state. Sabarigiri in 1966 and Idukki in 1976 are milestones
of Power Development in Kerala.
9.12 As per the seventeenth power survey, there is an additional generation requirement of about1000
MW for the state during next fve years. KSEB has set a target for providing affordable and reliable
electricity to all households on demand by 2011. Water is the only commercially viable source for
power generation within the State. To ensure reliability of supply as well as energy security, capac-
ity addition in Kerala has to be given due importance. Meanwhile KSEB has proposed to add about
610.50 MW of new hydel capacity during Eleventh plan period.
Capacity Addition during 2010-11
9.13 Power System in Kerala consisted of hydel, thermal and wind sources. Hydel energy is the most
reliable and dependable source in Kerala. Of the total installed capacity, 2857.59 MW during 2011, the
lions share of 2040.8 MW of installed capacity comes from 24 hydel stations; 783.11 MW is from the
thermal projects including NTPC at Kayamkulam which is Keralas dedicated thermal station. Kanjik-
ode wind farm, Palakkad has an installed capacity of 2.03 MW. Wind Energy from IPP is 31.65 MW.
Capacity addition made during 2010-11 was only111.40 (4%) that of 2746.19 MW on 2009-10. The
table (9.5) depicts detail of energy source and its installed capacity in Kerala as on 31-3-2011.
Table 9.5
Energy Source in Kerala as on 31-3-2011
Sl. No. Source of Energy Installed Capacity (MW)
1 Hydel KSEB 1997.80
2 Thermal : KSEB 234.60
3 Wind : KSEB 2.03
4 NTPC 359.58
5 Thermal :IPP 188.93
6 Hydel : Captive 33.00
7 Hydel: IPP 10.00
8 Wind: IPP 31.65
Total 2857.59
Source: KSEB
9.14 Total Sector wise installed capacity in Kerala as on 31.03.2011 as shown in the Table 9.6
Table 9.6
Sectror wise Installed Capacity in Kerala as on 31.03.2011
Sector MW Percentage
State Sector 2234.43 78.19
Central Sector 359.58 12.58
Private Sector 263.58 9.22
Total 2857.59 100
Source: KSEB
9.15 Figure 9.1 highlights total installed Capacity from hydel, thermal and wind sources.
Fig 9.1
Kerala State Planning Board
253
9.16 Under the purview of KSEB, 28 hydel projects are in the pipeline. The details of the project can
be seen in the Table 9.7
Table 9.7
Projects in the pipeline
Sl. No Name of the Project Installed Capacity
(MW)
Energy Potential
(MU)
1 Pallivasal Extension 60.00 153.90
2 Adyanpara 3.50 9.01
3 Athirappally 163.00 233.00
4 Sengulam Augmentation 85.00
5 Sengulam Tailrace 3.60 12.57
6 Chathankottunada II 6.00 14.76
7 Vilangad 7.50 22.63
8 Thottiar 40.00 99.00
9 Mankulam 40.00 82.00
10 Ranni-Perunadu 4.00 16.73
11 Perumthenaruvi 6.00 25.77
12 Chimony 2.50 6.03
13 Peechi 1.50 3.30
14 Barapole 15.00 36.00
15 Achankovil 30.00 75.81
16 Chinnar 24.00 78.00
17 Anakkayam 7.50 22.83
18 Poringalkuthu 24.00 45.02
19 Pazhassi Sagar 15.00 42.14
20 Kakkayam 3.00 10.39
21 Upper Kallar 2.00 5.15
22 Peechad 3.00 7.74
23 Western Kallar 5.00 11.23
24 Chembukadavu III 6.00 14.92
25 Olikkal 4.50 10.18
26 Poovaramthodu 2.70 5.88
Economic Review 2011
254
Sl. No Name of the Project Installed Capacity
(MW)
Energy Potential
(MU)
27 Vakkallar 24.00 45.00
28 Pambar 40.00 84.79
Total 543.30 1258.78
Source; KSEB
Hydel Generation
9.17 During the year 2010-11, Kerala received abundant infow into KSEB reservoirs. During this pe-
riod the peak demand reached 3119 MW. On account of various factors like the reduction in infow,
high cost of naphtha and LSHS during the beginning of the year, reduction in availability of CGS etc,
refected wide gap in the availability and the requirement.
Availability of Negative Surplus Power during 2010-11
9.18 With the hike in the consumption of energy, the States power quota from the central pool has
suddenly shrunk from 900 MW to 650 MW and also poor yield from hydel reservoirs is creating an
expensive predicament, thermal power too is not beyond agenda etc leads KSEB in to a situation of
Negative Surplus Power during 2010-11 though there was signifcant increase in hydel generation.
Negative situation occurred mainly due to the drastic reduction in the purchase of power from IPPS
and decline in thermal power generation and at the same time the total requirement increased to
17739.51 in 2010-11 from 17335.57 MU in the previous year and at the same time power availability
was 15996.07Mu resulted a negative surplus. The details are shown in Table 9.8
Table 9.8
Details of Power Availability as on 31.03.2011
Sl. No. Internal Generation Million Units
1 Hydel Generation 7095.73
2 KSEB -Thermal Generation 315.35
3 Wind 1.51
4 Total Internal Generation 7412.59
5 Less Auxiliary Consumption 55.13
6 Power Purchase from CGS 7245.30
7 Power Purchase from IPPs 1393.31
8 Total Energy Availability 15996.07
9 Energy requirement 17739.51
10 Surplus -1743.44
Source: KSEB
9.19 Total Internal Energy generation in Kerala from 2008-09 to 2010-11 are shown in Fig. 9.2
Kerala State Planning Board
255
Fig. 9.2
6494.5
7240.38
7412.59
6000
6200
6400
6600
6800
7000
7200
7400
7600
2008-09 2009-10 2010-11
Internal Energy Generation Internal Generation
Internal Energy Generation
Internal Generation
I
n
t
e
r
n
a
l
G
e
n
e
r
a
t
i
o
n
Year
Power Consumption
9.20 The domestic category consumers showed a reasonable growth of 3.9 percentages to 8063039
in 2010-11 from 7760645 in 2009-10. But LT & HT Commercial category consumer registered an in-
crease of 9.99 percentages over 2009-10. Growth of other agricultural pumping, Licensees (Bulk sup-
ply) also increased substantially over the year. The sale of energy has increased corresponding to the
increase of total consumers. During 2010-11, 14678.14 MU of energy was sold showing an increase
of 630.39 MU as compared to the last year (14047.75 MU). The details of consumption and revenue
collected during 2010-11 can be seen in the Appendix 9.6
9.21 As per the 17th Power Survey, it is estimated that by the end of 11th plan period (2012), the an-
nual consumption and maximum demand will be 19230 MU and 3528 MW respectively.
Power Purchase Agreement (PPA)
9.22 KSEB has entered into PPA with various Central Generating Stations of NTPC, NLC, NPCIL etc.
envisaged for Southern Region. In addition to this, power was purchased from Rajiv Gandhi combined
cycle power plant of NTPC at Kayamkulam, BSES Kerala Power Ltd, Kochi and Kasaragod Power
Corporation Ltd., Mylatti. Recently, KSEB has also executed PPAs with Mega Power Projects such as
SIMHADRI Stage II, NLC, Tutucorin-a joint venture project of NLC and TNEB, NLC Stage II expansion
etc. As a measure to encourage non-conventional sources of energy, KSEB has executed 38 PPAs for
purchase of power from wind energy projects and from two Small Hydro Projects, namely, Meenvallom
and Iruttikkanam. The capacity allocated from various stations for which the PPAs have been executed
is given in the table 9.9
Table 9.9
Power Purchase Agreement with Power Generation Stations
Sl. No. Name of the Power Generation Stations Allocation MW
I CGS
A Nuclear Power Stations
1 Kaiga I & II 38.00
2 Madras Atomic Power Station (MAPS-440 MW) 18.00
B Thermal Power Stations
1 NLC Stage II -ITPS II Stage I 63.00
2 NLC Stage II II 90.00
Economic Review 2011
256
Sl. No. Name of the Power Generation Stations Allocation MW
3 NLC Stage I Expansion 58.80
4 NLC Stage II Expansion 70.00
5 NLC New (1000MW) 32.38
6 Ramagundam I & II 245.00
6 Ramagundam III 61.00
7 Talcher II 247.00
8 RGCCP 180.00
9 Simhadri Stage II 80.90
10 Vallur Thermal Power Plant (VTTP) 49.90
11 Tutucorin 72.50
II IPPs
A Thermal
1 BSES Kerala Power Ltd 157.00
2 KPCL 20.436
3 MP Steel 10.00
B Hydro
1 Meenvallam 3.00
2 Iruttukkanam 3.00
C Wind
1 Agali 17.4
2 Ramakkalmedu 14.25
Source: KSEB
9.23 Kerala is planning a capacity addition of 610.50 MW (1653.86 MU) through hydel and non-
conventional sources during the Eleventh plan. Allocation of 733 MW power from the projects viz.
Koodamkulam Atomic Power Station (266 MW), Neyveli Lignite Corporation Expansion (70 MW), Sim-
hadri Thermal Power Station (200 MW), Vallur (75 MW) and Tuticorin (122 MW) are expected. To fulfll
the demand in 12th plan period, KSEB has planned for 1000 MW coal based project. Allocation of coal
(200.66 MT) for generating 1000 MW power for the next 25-30 years from Baitarni West Coal Com-
pany Ltd (BWCCL) in Orissa has already been obtained from Ministry of Coal, Government of India.
Cheemeni Power Plant back in favour
9.24 The Kerala State Electricity Board is seriously contemplating the setting up of a 2400 MW ther-
mal power project at Cheemeni in Kasaragod district. The coal for this project will come from the coal
feld of the Union Government in Orissa has allotted for Kerala. A Company for undertaking the mining
operations has already been set up there by the KSEB in association with outside public sector power
utilities. The Centre would provide all assistance for the project. The centre was attaching top priority
to power capacity addition all over the country.
9.25 Earlier, Kerala has been wavering between the options of setting up a pit head power project in
Orissa in association with outside public sector power utilities and having a new power projects in the
State itself to utilize the coal from the feld allotted to it in Orissa. Land is already available for the
project at Cheemeni. KSEB was taking concrete steps to ensure long term power security in the State.
With the commissioning of the LNG Terminal in Kochi, expected by 2012, natural gas would be avail-
able as fuel for power generation here. The plant now is to upgrade the KSEBs Brahmapuram Power
Project to 1000 MW capacity, in addition to setting up one more project with a capacity to generate
Kerala State Planning Board
257
1000 MW of electricity with LNG as fuel. KSIDC has been appointed as the nodal agency for setting up
the project. A special purpose vehicle will be formed between KSIDC and KSEB with 50:50 participa-
tion for implementing the project. Board has decided to transfer its share of 5 MT per annum of coal
produced from Baitarni West Coal Block to the Cheemeni project.
Growth of Power System in Kerala
9.26 The installed capacity has been increased to 2857.59 MW during 2010-11 as against the 2850
MW in the previous year. Likewise, per-capita consumption has also been increased by 519.29 KWh
from 474 KWh. The details of growth of power system in Kerala is seen in Table 9.10
Table 9.10
Growth of Power System in Kerala
Particulars/Year 2008-09 2009-10 2010-11 2011 up to
30.09.11
Installed Capacity (MW) 2685.00 2746.19 2857.59 2857.59
Annual Sales (MU) 12414.32 13971.09 14547.9
Per-capita Consumption
(KWh)*
472 474 519.29
EHT lines (circuit KM) 10139 10406 10514 10566
Sub stations (Nos)* 305 330 340 348
H.T. lines (circuit KM) 41791 45541 49232 50240
L.T lines (circuit KM) 252458 260670 266856 268731
Distribution Transformers
(Nos)
46955 52724 58247 60575
Revenue from sale of power
([Link])
4893.02 4950.60 5403.76 2950.96
Source: KSEB
* includes 1 No. 400 KV Pallippuram S/s of PGCIL
Hydro Thermal Energy
9.27 Taking into account the present hydro storage status in the reservoirs, expected, an infow equiva-
lent to the average of past 10 years during the remaining period of the current water year (2010-11),
the present allocation from the CGS and CERC norms for target availability and auxiliary consumption,
the average quantum of energy expected to KSEB from CGS is 18.48 MU per day. Expecting the nomi-
nal pattern of increase in peak demand during summer months, KSEB proposed to schedule about 40
MW from BDPP and 60 MW from KDPP during peak hours to meet the evening peak demand. Hydro-
thermal mix in Kerala is shown in Table 9.11.
Economic Review 2011
258
Table 9.11
Hydro-Thermal Mix in Kerala from 2003-04 to 2010-11
Year Hydel (MU) Thermal +
Import (Mix)
(MU)
Total (MU) Hydel (%) Thermal (%)
2003-04 3910 8545 12455 31 69
2004-05 6134 6314 12448 49 51
2005-06 7539 5866 13405 56 44
2006-07 7497 7029 14526 52 48
2007-08 8327 6884 15211 55 45
2008-09 5839 10283 16122 36 64
2009-10 6612 10711 17389 38 62
2010-11 7065 10742 17870 39 60
Source: KSEB
9.28 The ratio of hydro-thermal mix indicates that from 2005-06 to 2007-08 availability of hydel power
has comparatively greater than the thermal power and subsequent years thermal power increased
till 2010-11. It reveals that KSEB has purchased high cost thermal power for meeting the power
requirment.
Electrical Energy Consumption
9.29 In Kerala, electrical energy consumption has increased to 14547.9 MU during 2010-11 from
13971 MU during 2009-10. The percentage of consumption increased to 4.13 %. Electrical Energy
consumption in Kerala during 2007-08to 2010-11 are depicted in Fig 9.3
Fig. 9.3
Transmission
9.30 Transmission of Electricity means bulk transfer of power over a long distance at high voltage, gen-
erally of 132 KV and above. It is an important sector to evacuate the power in different parts of Kerala.
A good transmission system is necessary to the effective distribution and to bring power from out-
side the state. In the transmission Sector tragetted commissioning 41 substations and construction of
484.26KMS kms of transmission lines during the period . Of which 8 substations were commissioned
Kerala State Planning Board
259
and 51.96ct kms of lines were completed during 2011. At present there are two 400 KV substations.
One at Madakkathara (Thrissur) and the other at Pallippuram (Thiruvananthapuram). Also another
400 KV substation at Arecode (Malappuram District) is being constructed by PGCIL. The site for the
construction of this substation has been identifed and taken over by PGCIL and the route Survey for
the construction of Mysore - Arecode line has also been completed. Thus, there will be one 400 KV
substations in each region of Kerala, i.e North, Central and South.
9.31 As per the scheme approved by Southern Regional Electricity Board (SREB), 400 KV Multi Cir-
cuit line is proposed from Thirunelveli Edamon and 400 KV Double Circuit line from Edamon-Kochi
(East) Madakkathara. One 400 KV sub station at Kochi (East) is also sanctioned as part of this evacu-
ation scheme.
9.32 Keralas Transmission system consisting of substations and its connected lines are given in
Tables 9.12 & 9.13
Table 9. 12
Transmission Infrastructure
[Link] Item Target Unit Achieve-
ment
Unit Percentage of
Achievement
1 400 KV Substation Nil Nos Nil Nos
2 220 KV Substations Nil Nos Nil Nos
3 110 KV Substations 13 Nos 5 Nos 38.46
4 66 KV Substations 4 Nos 1 Nos 25.00
5 33 KV Substations 24 Nos 7 Nos 29.17
Source: KSEB
9.33 It is evident that the progress of construction of substation with various capacities has not achieved
the target. Out of the target of 13 numbers 110 KV substations, only 5 substations are completed and
in the case of 66 KV substations, 1 substation is completed against the target of 4 numbers and out of
24 number of 33 KV substations, only 7 substations were completed. The present status of Transmis-
sion facilities set up in state due to upgradation and construction of transmission lines are shown in
the table9.13.
Table 9.13
Transmission facilities in Kerala (As on 30.9.2011)
Capacity Substation (Nos) Lines (Ct km)
400 KV 2* 260**
220 KV 17 2701
110 KV 131 4035
66 KV 80 2387
33 KV 118 1418
Total 348 10842
Source: KSEB
* One number owned by PGCIL ** owned by PGCIL
Voltage Improvement Works
9.34 KSEB is committed to provide 230 volts between phases and neutral consumers premises in
the L.T services and corresponding higher voltages in the case of higher voltage service within allow-
Economic Review 2011
260
able limits. KSEB cannot always fulfll this commitment due to rapid load growth and corresponding
changes in system parameters. When conditions prevailing low voltage in any locality come to the no-
tice of KSEB, work is taken up as voltage improvement work. This is usually carried out at the expense
of the Board. Converting existing single phase lines to 3 phase, strengthening distribution system by
providing higher capacity conductors, providing additional transformers on the existing 11 KV line or
by extending 11 KV line by providing adequate size of capacitors are the works usually carried out for
providing higher voltage in distribution network.
Renovation, Modernisation and Uprating (RMU) of
old Generating Stations
9.35 The normal life span of a hydro generating station is 30-40 years, depending on service condi-
tions in many of our existing generating stations are old and in service for 30 years and beyond. When
the machines become old, their operational effciency decreases. Major breakdowns occur and shut-
downs of long duration will be necessary for maintenance work.
9.36 The renovation and modernization and uprating of Sabarigiri Power Station has been completed.
In the case of R&MU of rehabilitation of Panniyar Power House,rebuilding of (unit 3 & 4) of Sabarigiri
powerhouse, Idamalayar protection works are being undertaken.
Transmission and Distribution Loss (T&D loss)
9.37 KSEB have to bear proportionate losses in PGCIL line through which allocation to KSEB from Ex
bus of Central Generating Stations (CGS) is transmitted to KSEB Periphery and this loss component
is treated as external losses to KSEB system. The energy loss in the KSEB System is accounted as
internal loss.
9.38 During 2010-11 T&D loss has come down to 16.09 percent from17.71 percent in 2009-10. KSEB
made signifcant achievement in the feld of reducing the T&D loss. During 2003-04 onwards T&D loss
was considerably reduced by way of faulty meter replacement, intensifcation of theft detection, instal-
lation of new substations and lines, upgradation and modernization of sub transmission and distribu-
tion network through APDRP Scheme. This is in line with the efforts of reducing the loss by 2% every
year. It can be seen in the fg 9.4
Fig 9.4
Kerala State Planning Board
261
Distribution
9.39 Distribution Sector is a profound area, which provides electricity to all consumers in Kerala. In the
distribution segment, 3644.67 kms of 11 KV lines, 6928.69 kms of LT lines and 5800 nos of distribu-
tion transformers were added during the period under review. Kerala has achieved full electrifcation
in all villages, which is above average of national level. KSEB has given great attention to strengthen
the distribution backbone by new ventures of Restructured- Accelerated Power Development and
Reforms Programme (R- APDRP) and Rajiv Gandhi Grameen Vidhythikaran Yojana (RGGVY). The
power consumption comes to all time high. As on 2010-11, total number of consumers has increased
to 10127946 nos against the 9743476 during 2009-10. The details of pattern of power consumption
and revenue collected are shown in the Appendix 9.6. The distribution infrastructure is an essential
part of electrifying to all domestic and non-domestic purpose. The target and achievement of the dis-
tribution infrastructure during 20010-11 is given in the Table 9.14
Table 9. 14
Targets and Achievements of distribution Infrastructure during 2010-11
Sl.
No.
Item Target Unit Achieve-
ment
Unit Percentage of
Achievement
1 11 KV Lines 4063 Kms 3644.67 Kms 89.70
2 Distribution Trans-
former
5812 Nos 5800 Nos 99.79
3 L.T. Lines 3141 Kms 6928.69 Kms 220.59
4 Service Connections 425221 Lakhs 442611 lakhs 104.09
Source: KSEB
9.40 The above table reveals the lying of 11 KV lines the expected target could not achieved during
this period. Whereas effecting new service connections and LT lines that achievements exceeded the
targets.
9.41 During the fnancial year 2011-12, 442611 service connections were given as against the target
of 425221 and 3644.67 kms of 11KV lines, 5800 nos of transformers and 6928.69 kms of LT lines were
commissioned during the year.
Tariff
9.42 Over all average realisation rate from tariff has been increased to 354.24 paise per unit in 2010-
11 as against the 338.03 paise per unit in 2009-10
R-APDRP (Restructured APDRP) Scheme
9.43 The APDRP Scheme for the improvement of sub transmission and distribution system with a
total outlay of ` 863.61 Crore has been completed on 31.3.2009. The new restructured APDRP (R-
APDRP) sanctioned as per order No. 14.04.2008 APDRP/GOI/MOP/ dated, 19.9.2008 of Govern-
ment of India has been launched from 1.4.2009. The focus of the Programme shall be on actual
demonstrable performance in terms of sustained loss reduction i.e. 15% AT & C loss reduction on a
sustained basis for a period of 5 years. Projects under the scheme shall be taken up in two Parts.
Part A of the project includes collection of accurate base line data and adoption of IT in the areas of
energy accounting, networking, MIS, consumer indexing, etc. and enable objective evaluation of the
performance of utilities before and after implementation of the programme. The Ministry of Power
had approved detailed project reports for an amount of ` 214.38 Crore submitted by KSEB for 43
town schemes. First installment of loan amounting to ` 64.31 Crore has been disbursed by the PFC.
Evaluation of bids of implementing agency is completed; tender fnalized & LOI issued to M/s KDN
ltd on 30.6.201, Government approval obtained on 4.9.2010 and LOA issued on 6.9.2010. After is-
Economic Review 2011
262
suing LOA, Government vide letter dated 1.10.2010 issued direction to keep the order issued to M/S
KDN Ltd in abeyance. On 27.12.2010 Government issued order to cancel the contract awarded to M/s
KDN ltd and directed for retendering.
Rajiv Gandhi Grameen Vidyuthikaran Yojana (RGGVY)
9.44 Under the Rajiv Gandhi Grammeen Vidyuthikaran Yojana (RGGVY), sanction has been obtained
to implement the scheme in 7 districts of Kerala, namely, Kasargod, Kannur, Kozhikode, Wayanad,
Malappuram, Palakkad and Idukki with an amount of ` 221.75 crore as a frst package on 5.8.2005.
Implementation of the Scheme in Idukki District has been completed. REC issued sanction on revised
DPR for Kasargod, Kannur, Kozhikode, Wayanad, Malappuram and Palakkad for a total amount of `
114.57 crore.
9.45 The details of the fnancial and physical progress of implementation of RGGVY as on 30-09-2011
is shown in the Table 9.15.
Table 9.15
Financial & Physical Progress of implementation of RGGVY as on 30.09.2011 (`lakh)
Sl. No. Name of Item Unit Amount
released
Target for
2006-07
to 30.09.2011
Achievement
as on
31.09.2011
Expenditure
As on
30.09.2011
1 Installation of 25
KVA transformer
No.
4844.21
308.00 275.00
3068.966
2 Construction of
11KV Line
KM 2725350.90 253.00
3 Construction of LT
single phase line
KM 25835.00 368.688
4 Construction of LT
three phase line
KM 62.14 76.00
5 Effecting BPL/SC
service connection
No. 16097.00 17238.00
Source: KSEB
Non - Conventional Energy
9.46 The major programmes targeted by ANERT during 2011 comprises of Baseline studies on energy
demand, renewable energy potential and energy conservation potential, implementation of renewable
energy and energy conservation programmes and infrastructure development for sustaining interac-
tive energy planning and development programmes with local governments.
9.47 The programmes of ANERT can be brought under fve categories of activities as follows:
l Baseline Energy Studies
l Energy Resource Assessment
l Energy conservation Programmes
l Decentralised Energy Generation Programmes
l Other supporting and Institution Building Programme
9.48 As part of the baseline energy demand studies ANERT had carried out a detailed study of the
households that are yet to be electrifed. The total houses registered as Un-electrifed counts to 2,
03,694 from the 454 local bodies. The direct survey conducted in these households covers the reason
for non-electrifcation as well as the distance of existing grid from the surveyed houses as well, along
with an estimation of power requirement. The data being consolidated forms a frm basis for charting
Kerala State Planning Board
263
out programmes for the coming years with a focus to achieve the long cherished dream of the State
to achieve 100% household electrifcation, through collaborative functioning with Local Self Govern-
ments and KSEB.
9.49 Under the renewable energy potential assessment studies ANERT had compiled the Database
on Probable SHP sites in the state covering 867 locations spread over 163 local bodies in 13 districts
of the State, having a total estimated potential of 331 MW at 30 % dependability. In continuation to
this, detailed study of a cluster of sites with 14 locations in Peravoor of Kannur district has also been
completed and the implementation of these projects with RIDF support as a model for cluster based
development of mini hydel projects. Steps for taking forward Wind Energy potential assessment stud-
ies in collaboration with Centre for Wind Energy Technology (C-WET) are also being planned.
9.50 Energy conservation potential assessment studies planned for the year comprised of energy
audit in 10 selected institutions transferred to local governments and installation of renewable energy
and energy conservation devices based on the recommendations of the study. Presently energy Audit
Study of 5 institutions are completed with the help of the Energy and Resources Institute ( TERI).
Conservation of Energy
Energy Management Centre
9.51 Energy Management Centre Kerala (EMC) is an autonomous body under Department of Pow-
er, Government of Kerala, registered under the Travancore Cochin Literary, Scientifc and Chari-
table Societies Act of 1955. The Centre is devoted to the improvement of energy effciency in the State,
Promotion of energy conservation and encouraging development of technologies related to energy
conservation and management through research, training, demonstration programmes and aware-
ness creation. The centre is networking with institutions within and outside the State for research and
training activities.
Economic Review 2011
264
9.52 Government of Kerala, with the concurrence of Bureau of Energy Effciency, Ministry of Power,
government of India designated EMC as the State Designated Agency to enforce, regulate, co-ordi-
nate and to implement the provision of the Energy Management Centre. The United Nations Indus-
trial development Organisation (UNIDO) has opened its frst Regional Centre for Small Hydro Power
Development in EMC in the year 2003
Achievements
l As a recognition of the excellent performance in the feld of promoting energy effciency, EMC got
3 National Awards. In the year 2008 and 2010 EMC was adjudged as the Best State Designated
Agency in India and award was given by then Ministry of Power, Government of India. Received India
Power Award for the best Demand side Management Programmes for the year 2010.
l EMC jointly with KSEB distributed 1.27 crores of CFLs as part of the Bachat Lamp Yojana proj-
ect. Two CFLs were distributed to each domestic consumer against two incandescent lamps of 60
W. Kerala is the frst State which implemented Bachat Lamp Yojana (BLY). Due to the distribution of
CFLs a savings of 300 MW was achieved during the peak hours of March and April 2010.
l 217 Million Units of electricity saving through SAVE Programme. EMC in association with Malayala
Manorama organized a programme for students and general public on the need of Energy Conserva-
tion. Quiz,Essay Competition and other prgorammes were organized andalso the participants were
requested to meter their energy consumption for one month. After implementing best practices on
energy conservation, the meter reading was taken and it was noticed that 217 Mu were saved by the
participants in the programme.
l Energy Conservation Fund: The Government of India has launched Energy Conservation Fund, in
compliance with Energy Conservation Act 2001, providing State Governments with fnancial support
to promote energy effciency. Government of Kerala constituted the State Level Steering Committee
for Energy Conservation Fund Rules. As part of this, fnancial support are envisaged to Government
agencies, State enterprises, non-government organizations Individuals and business that implement
provision of Energy Conservation Act and intend to save energy by means new technology adoption
and other means.
l Implemented frst LED Village : The village Ayakkurissi in Palakkad district in Kerala is the frst.
LED village in south India for which EMC joined hands with BEE to showcase this village as energy
effcient model village. 250 household bulbs and 50 streetlights were replaced with LED lights.
l EMC is regularly conducting training, awareness, demonstration programmes to general publics,
skilled and unskilled employees of industries, students, and housewives etc. to make aware of the
need for energy conservation. Also EMC is conducting Energy Audit/Energy Effciency studies in dif-
ferent organization with a view to reduce the energy consumption and to improve energy effciently.
Students being the future of Nation, EMC started energy conservation clubs in schools and Energy
environment Conservation clubs in colleges/ polytechnics / it is to inculcate the habit of Energy
conservation.
l Energy Smart School programme have started in schools as an energy education programme in
association with General Education Department, Government of Kerala.
lEMC developed computer based touch screen energy information kiosks for school students to dem-
onstrate how to save energy. With the support of BEE the systems were distributed to 14 Government
High Schools (one each in each district)
Electrical Inspectorate
Kerala State Planning Board
265
9.53 The Electrical Inspectorate is a department of the Government of Kerala. Safety inspections are
carried out and sanction for energisation for all HT / EHT and other medium voltage installation in the
State are issued by this department. Enquiry of all electrical accidents occurred in the State and for-
warding the enquiry report to the Government and take actions against responsible person / authority
are also done by this department.
Activities and Achievements for the year 2010-11
l Accreditation for the parameter Energy by the NABL is received during J uly 2011.
This Laboratory is the frst and only one in the state with NABL Accreditation for energy.
l Started online application for supervisor Grade A, B permit by the licencing board.
l Providing Patent Seal to Energy Meter Testing as per the regulation of
Central Electricity Authority.
l Purchase of equipments required for Meter Testing Labs and Inspecting
Offcers are in Progress.
Challenges in the Energy Sector
l Inadequate capacity addition over the years leading to massive in-house demand supply gap.
l Hydel power dominated supply scenario,
l Negligible share of Renewable Energy in the Energy mix,
l High Aggregate Technical & Commercial (ATC) Losses,
l Losses/ineffciencies of the main power utility
l Gap between energy conservation potential and its realisation,
l Limited presence of Independent Power Producers (IPPs) and Co-Generating Stations (CGS),
l Limited penetration of star labelled products,
l Insuffcient interventions/incentives to promote energy conservation and thereby
manage demand,
l No coal based plant, no gas based plant,
l Energy price volatility.
Economic Review 2011
Water Resources
C
H
A
P
T
E
R
268
Kerala State Planning Board
269
Development patterns, increasing population pressure and the demand for better livelihoods
across the globe are contributing to a looming global water crisis. Addressing this crisis will require
maintaining a sustainable relationship between water and development, one that balances current
needs against the prospects for future generations. Only 3 percent of the worlds water supply is fresh
water and two-thirds of that is locked in glacier ice or buried in deep underground aquifers, leaving only
1 percent readily available for human use.
10.2 In most developing countries, agriculture is the dominant user of water, accounting for more than
85 percent of all water use. Agriculture water use raises signifcant issues for water resource manage-
ment like issues dealing with water scarcity, competing demands from other sectors, irrigation service
delivery and system management, water use effciencies are so forth. The primary objective in coming
years will be to balance water supply and demand among users to ensure adequate water for agricul-
ture and sustainable irrigation system management while satisfying other needs.
10.3 The surface irrigation constitute major chunk of irrigation infrastructure in the state. There are 18
dams in the state intended for irrigation. Out of this, 14 have storages and remaining are barrages.
Live Storage Capacities of Irrigation Reservoirs
10.4 The live storage position of the reservoirs during the beginning and end of the monsoon period
during 2009 to 2011 are given in table 10.1
Table 10.1
Live Storage Position in the Reservoirs (Mm3)
Sl.
No
Item 2009 2010 2011
1. Storage at the beginning of the Monsoon 392 531 525
2. Storage at the end of the Monsoon 1150 1212 1274
3. Increase due to Monsoon 771 681 749
4. Average for 10 years(2002-2011)
(i) at the beginning of the monsoon 430.48
(ii) at the end of the monsoon 1133.168
(iii) increase in monsoon storage 702.68
Source: Water Resource Department
Water Resources
Economic Review 2011
270
10.5 In the beginning of the Monsoon (in 2011) the total storage was 525Mm
3
and at the end of the
monsoon the level of the storage was 1274 Mm
3
, against the storage level of 531 Mm
3
at the beginning
of the Monsoon and 1212 Mm
3
at the end of the monsoon period during the previous year. The storage
capacities of reservoirs are deteriorating due to silting in reservoirs. Sedimentation or silt removal
need be done periodically for the proper upkeep of the reservoirs. The storage position at the beginning
and at the end of the Monsoon during 2009 to 2011 are given in Fig.10.1 (a) and 10.1(b). The Live
storage capacities of the Irrigation Reservoirs is given in Appendix 10.1
Fig. 10.1(a)
Fig. 10.1(b)
Kerala State Planning Board
271
Investment in Irrigation
10.6 Irrigation development in Kerala is mainly centered on the development of surface water re-
sources mainly on the development of major and medium irrigation projects. In each Plan, priority in
allocation was given for the development of major and medium irrigation projects. Out of a cumulative
expenditure of ` 6713.72 crores as on 31.10.2011, ` 4725.15 crores (70.38%) is invested for major &
medium irrigation. About 60 to 70 percent of the investment in each plan was made for this purpose.
Rice is the major crop benefted through irrigation infrastructure. Even in the case of this crop, the
incremental yield, which the irrigation support could bring, is not signifcant. With the fast changes
taking place in the farm front of Kerala with notable reduction in the area under rice cultivation, even
the distribution systems already developed for gravity irrigation to service rice cultivation now require
realignment.
10.7 Investments in irrigation are changing globally in response to changes in environment and ex-
perience with previous projects. In the 1970s and 1980s, investment typically involved large irrigation
and drainage projects with considerable infrastructure development. In the 1990s investment often
supported system rehabilitation and management and more recently to small irrigation schemes. In-
creased water scarcity has shifted the focus from exploitation of water resources and building infra-
structure to improvement of water use effciency.
Financial Performance
10.8 Summary of outlay and expenditure of different sub-sectors of Irrigation sector is shown in table
10.2 below:
Table 10.2
Outlay and Achievement during Annual Plan 2010-11 (` Lakh)
Sl.
No
Item
Annual Plan 2010-11
Outlay Expenditure Percentage
1 Major & Medium Irrigation 21800 14491.30 66.47
2 Minor Irrigation 7824 2993.81 38.26
3 Command Area Development 627 248.97 39.70
4 Flood Control & Coastal Zone Management 7410 3547.20 47.87
Total 37661 21281.28 56.50
Source: Water Resource Department
10.9 The expenditure on Major and Medium Irrigation (66.47%) was the highest followed by Flood
control and Coastal zone management (47.87%), Command Area Development (39.70%), minor ir-
rigation (38.26%).
Water Resource Management
10.10 Effective demand management is one of the several critical challenges worldwide in the face
of increasing water scarcity. Efforts to improve the effciency of water use and limit demand in the ag-
riculture sector, the largest consumer of water, have had limited success. Integrated water resources
management has made limited progress.
10.11 The basic premise of water resource management is that river basins are best managed and
developed as an integrated whole. This is always legally and politically complex due to the challenges
of allocation between users and between uses. In many cases the need for river infrastructure such
as weirs, dykes, regulators and other storage structures are primary drivers for adopting institutional
solutions. The investment in storage structures is essential to optimize water use as well as to address
the growing number of water conficts.
Economic Review 2011
272
10.12 During 12th plan, it could be attempted in the state to select 2-3 basins for integrated water
resources management. Bharathapuzha basin is one such basin which needs immediate attention.
Accelerated Irrigation Beneft Programme (AIBP)
10.13 The accelerated Irrigation Beneft programme (AIBP) was introduced by Government of India for
providing assistance to acceleration of irrigation projects. The release of central assistance to Kerala
under AIBP is very low compared to other states. There has been a decreasing trend in the funding
during the last few years and very low release during the year under report. The details of release of
central assistance under AIBP are shown in the Table 10.3.
Table 10.3
Central Assistance / Grant Released under AIBP during last Seven year (` Crores)
Year
States
Total
Andhra Pradesh Karnataka Kerala Orissa
2004-05 87.540 396.290 49.440 24.230 2867.300
2005-06 311.382 140.776 9.359 151.374 1900.314
2006-07 843.422 160.373 16.647 133.885 2301.972
2007-08 987.769 349.900 0.000 624.359 5445.705
2008-09 855.180 442.419 0.905 724.439 7598.220
2009-10 1300.730 823.830 3.812 871.570 9309.631
2010-11 0 0 5.85 0 5.850
Total 4386.023 2313.588 86.013 2529.857 29428.992
Source:Ministry of Water Resources, GOI
10.14 The total assistance under the AIBP to the state during the period from 2004-05 to 2010-11 is
`86.013 crores against the total assistance for the entire states during the period, which works out to
` 29428.992 crores. It is only 0.30 per cent of the total assistance under the scheme during the same
period.
10.15 The details of AIBP implemented in the state during the Eleventh fve year plan period and the
expenses thereon are shown in table 10.4 below:
Table 10.4
Total Provision Earmarked and Expenditure under AIBP during Eleventh Plan (` lakh)
Sl
No
Sub Sector/
Scheme
2007-08 2008-09 2009-10 2010-11
Bud-
get
Esti-
mate
Expen-
diture
Budget
Estimate
Expen-
diture
Budget
Estimate
Ex-
pendi-
ture
Bud-
get
Esti-
mate
Expen-
diture
1 Moovattupuzha
Valley Irrigation
0.00 0.00 500.00 1088.78 6935.00 73.41 2000 790.29
2 Karappuzha 0.00 0.00 2500.00 984.28 1500.00 53.35 1000 0.19
Rehabilitation
Package
32.46 0.00 2902.00 0.00 7565.00 309.51 6000 2378.00
Total 32.46 0 5902.00 2073.06 16000.00 436.27 9000 3168.48
10.16 During the period from 1997-98 to 2010-11 (December), Government of India had sanctioned
Kerala State Planning Board
273
`43425.63 crores to various states. The assistance sanctioned to Kerala was `175.105 crores (0.40
%). The details of release of assistance under AIBP from 1996-97 to 2010-11 is shown in the Appendix
10.2
10.17 More focused attention is required for the implementation of AIBP assistance in Kerala. The
assistance has been released for Muvattupuzha project, Karappuzha and three projects under Prime
Ministers rehabilitation package in Palakkad District covering Malampuzha, Kanjirapuzha and Chit-
turpuzha projects.
10.18 Summary of the important observation of CAG of India in the performance audit of AIBP for
2010-11 are shown in Box 10.1.
BOX 10.1
Summary of the observation of CAG on AIBP
Reform measures introduced under AIBP viz, the concept of reforming states and the fast track
approach for speedy completion of projects were not satisfactory and were subsequently
abandoned.
AIBP role in overall creation and utilisation of Irrigation potential could not be ascertained
in the audit due to the non furnishing of project wise data regarding actual utilisation and
creation of IP, by the Ministry of Water Resources on the Central Water Commission. Also
in the absence of detailed data, the authenticity of creation and utilisation of Irrigation
potential under individual AIBP MI projects could not be verifed.
Poor progress in completion of projects sanctioned under AIBP between October 96 and
March 08 and those projects which were reported as completed, the authenticity of completion
could not be verifed in he absence of detailed project wise with the Ministry.
Short creation of Irrigation potential, non utilisation of created Irrigation potential either due
to splitting a single irrigation project into two or more or dividing a project into AIBP or non
AIBP components.
Preliminary reports and detailed project reports were defciently prepared without survey
and investigation and the Beneft cost ratio has also not assessed, resulting defciency in
planning and approval of AIBP projects.
Incorrect phasing of project implementation resulted in the poor project execution.
There were poor fnancial management in the releasing and sanctioning of funds under the
AIBP programme.
Irregular contractual management including granting of undue benefts to contractors as
well as cases of unauthorised / irregular expenditure were detected in the audit scrutiny.
Poor monitoring and evaluation of projects, proposed under AIBP by the Central Water
Commission.
Source: Ministry of Water Resources 2010-11
Review of Major Projects
10.19 The overall performance of the major and medium irrigation sector during the initial years was
not encouraging. The cumulative area brought under irrigation through major and medium irrigation
projects is 29346 hectares (gross). The details of the progress of implementation of ongoing projects
as on November 2011 are given in table 10.5 below:
Economic Review 2011
274
Table 10.5
Project-wise Details of Ongoing Projects (` lakh)
Sl.
No.
Name of
Project
Y
e
a
r
o
f
s
t
a
r
t
i
n
g
O
r
i
g
i
n
a
l
e
s
t
i
m
a
t
e
R
e
v
i
s
e
d
e
s
t
i
m
a
t
e
Y
e
a
r
o
f
r
e
v
i
s
i
o
n
C
o
s
t
e
s
c
a
l
a
t
i
o
n
(
%
)
E
x
p
e
n
d
i
t
u
r
e
u
p
t
o
N
o
v
e
m
b
e
r
2
0
1
1
Target area to
be irrigated
(Ha)
Physical
achievement
as on 3/10 (Ha)
Net Gross Net Gross
1 2 3 4 5 6 7 8 9 10 11 12
1 Muvattu-
puzha
1974 4808 79300 2008 1649 76933.00 19237 37737 19784 29846
2 Idama-
layar
1981 904 60000 2008 6637 37448.00 14394 29036 - -
3 Karapuzha 1979 760 49800 2008 6553 27801.77 5221 8721 601 -
4 Banasur-
asagar
1999 1137 12700 2008 1117 3501.28 2800 4740 - -
5 Chamra-
vattom
1983 7000 11417 2008 163 3965.48 3106 9659 - -
Karapuzha Irrigation Project
10.20 The Karapuzha Project is the frst project for irrigation taken up in the Wayanad District of
Kerala. The project is to construct an earthen dam with concrete spillway in Right bank at Vazhavatta
across Karapuzha stream and the saddle dam at Pakkam, Cherupetta and Cheengeri to create a
reservior of 76.50 Mm
3
storage capacities. The project was originally envisaged for Irrigation only and
now it has turned to be a multipurpose project. Now there is a proposal of incorporating Mini Hydel
Scheme for producing 0.5 to 0.75 MW of Electricity by Kerala State Electricity Board.
10.21 The original estimate of the project was ` 7.60 crores in 1979and the revised estimate as per
2010 schedule of rates is `44150 lakhs. The cumulative expenditure is `28127 lakhs. The project has
been partially commissioned on 20.6.2010 and an ayacut area of 601 ha has been achieved so far.
Major components under head works viz., (i) Earth dam and saddle dams and (ii) Spillway are already
completed. Work of stilling Basin and Energy Dissipating Chamber connection structure to RBC from
diversion chamber is in progress. Raising of roads completed to the extent of 90 per cent. As regards
Left Bank canal, it is in the nearly completion stage (99%). Seventy fve per cent of the work in respect
of Padinjareveedu Branch canal of LBC is completed, investigation of Thondippally Branch and Kut-
toor Branch of Left bank canal is completed for which land acquisition is in process. Investigation of all
Distributaries of LBC is completed and land acquisition is in progress except Pallikkunnu Distributary.
As regards the Right Bank canal, it is completed only with the exception of the connection structure
of length 24.28 m. The work of one distributary is completed and the investigations for other distribu-
taries are completed and land acquisition proposals were submitted. The progress of implementation
of the project is very slow. More proactive steps are required to complete the project in the drought
affected district. The project has been included under AIBP. Prioritization of work to complete the ongo-
ing work is also required.
Muvattupuzha Valley Irrigation Project
10.22 The project envisages the utilisation of the tailrace water from the Idukki Hydro electric project
and the works started during 1978. The tailrace water which is let off into the Thodupuzha river and
the run off from the catchment upstream of Thodupuzha river are impounded by constructing a dam
Kerala State Planning Board
275
across Thodupuzha river at Malamkara, 8 km upstream from Thodupuzha town. Water from the
reservoir is intended to give irrigation facilities to 19237 ha.(net) and 37737 ha.(gross) in Ernakulam,
Kottayam and Idukki districts.
10.23 The estimated cost of the project as per 1980 Schedule of Rates was ` 48.08 crores and the
revised estimate of which is ` 841crores based on 2009 Schedule of rates. The cumulative expen-
diture is ` 773.73 crores. The canal system consists of left bank main canal of 37.10 km length and
right main canal of 28.337 Km of length and branches and distributaries of 57.154 and 241.014 Kms
of length respectively. The work of the dam, Left Bank main Canal and Right bank main Canals are
completed and in respect of branches and distributaries it is completed for a total length of 43.544
Km, 159.19 Km respectively. The project was commissioned partly in November 2004, since when
water distribution is being carried out in the completed stretches of canal. Project was initiated in 1974
for implementation with an original estimated cost of `20.86 crores. The escalation in expenditure till
2005-10 was 3526 percent. The project has to be closed during the eleventh plan itself considering the
implementation of the project for more than decades. The cropping pattern in the ayacut has changed
and additional investment is required to irrigate the fve crops. The Project is receiving assistance un-
der AIBP from 1998-99 onwards.
Idamalayar Irrigation Project
10.24 The Idamalayar Irrigation Project is a diversion scheme intended to irrigate an extend of 14394
ha. of wet and dry lands and the Cultivable Command Area (C.C.A.) is 13209 Ha. The source of
water for irrigation is the tail race discharge of Idamalayar Hydro - Electric Project for which a Dam
at Ennakkal, has already been completed. This barrage was constructed in 1960-67. The canal
system of the Project consists of a main canal, (32.272 Km) long on the right bank of the river Peri-
yar. The main canal bifurcates itself into 2 canal systems. The low level canal, 27.25 Km long and
the link canal (6.73Km) long. The link canal connects its main canal with the L.B.C. of the existing
Chalakudy River Diversion Scheme ([Link]) conveying the same discharge of the L.B.C. of
Economic Review 2011
276
C.R.D Scheme. The right bank canal of Chalakudy Scheme will be remodeled to convey discharge
now passing through the L B.C. of CRD Scheme. In addition to its present discharge thus increasing
the ayacut of Chalakudy R.B.C, from the present 6338 ha. to 14851ha , an increase of 8513 ha. The
latest estimate of the project as per 2009 SOR is `650.00 crores and the cumulative expenditure as
on 31.03.11 is `347.56 crores.
10.25 Out of the total length of 32.278 km of the main canal, work relating to 12.554 km have been
completed. Out of 27.3 km of low level canal, 12.286 km have been completed. Out of 7.575 km of link
canal, 2.842 km is in progress.
Banasurasagar Irrigation Project
10.26 The project was commenced in 1971 with an estimated cost of `1137.07 lakhs to irrigate an area
of 2800 ha. agriculture land for the second and third crops. The project consist of canal system only
viz. 2.73 length, two branches with a total length of 13.76 kM, 14 no. of disstributories having a total
length of 69.04 km. The project report was revised based on 96 schedule of rates and Administrative
Sanction was given to a cost of ` 37.88 crores. The revised estimate of the project based on 2010
schedule of rate is ` 185.5 crores. The work of the Main canal of length 2.73 Km. except for the acq-
ueduct from Ch.0-150 M. and from Ch. 1130 M to 1500 M. is completed. The distributories taking off
from the main canal will be completed during this year. Expenditure incurred is ` 3697 lakhs including
a part of the share cost given to KSEB.
Chamravattom RegulatorcumBridge
10.27 A regulator cum bridge at Chamravattom across Bharathapuzha about 6.5 Km upstream of river
mouth is a multi-purpose project. The targeted irrigated area is 4344 ha. (Gross) and 3170 ha. (Net).
The original estimate was `70.00 crores during the year of commencement (1983). The NABARD
has approved the project on 31.01.2008 for `106.00 crores with their share of 95.12 crores. Later, the
estimate was revised to an amount of ` 134.30 crores. The total expenditure incurred for the project is
`10819.24 lakhs and the physical achievement is 68.5%. The project is expected to be completed on
or before 4.12.2011
Irrigation Status
10.28 The source-wise area irrigated as on March 2011 is given in table 10.6 below:
Table 10.6
Net Area Irrigated (Source wise) (in Ha.)
Sl.
No.
Source 2005-06 2006-07 2007-08 2008-09 2009-10 2010-11
1 2 3 4 5 6 7 8
1 Government canals 104669 98664 88318 95956 94813 85825
2 Private canals 4965 4300 4324 6318 2656 5584
3 Tanks 45062 42064 41580 39752 40851 51064
4 Wells 110000 114477 131002 133312 125892 137716
5 Other sources 135227 125900 122321 123915 122050 108093
6 Total 399923 385405 387545 399253 386262 388282
7 Gross irrigated area 464765 475231 455310 458238 454783 -
8 Net area irrigated to net
area Sown (%)
19 17.52 18.41 18.86 16.34 -
Kerala State Planning Board
277
Sl.
No.
Source 2005-06 2006-07 2007-08 2008-09 2009-10 2010-11
1 2 3 4 5 6 7 8
9 Gross irrigated area to
gross cropped area (%)
15 16.29 16.44 16.96 17.04 -
10 Irrigated area under
paddy to total irrigated
area
38 45 40 37 37 -
Source:Directorate of Economics & Statistics
10.29 As per the assessment of the Directorate of Economics and Statistics the net irrigated area in
the state as on March 2011, is 3.88 lakh ha. and the gross area irrigated is 4.66 lakh ha. The net area
irrigated has increased from 3.86 lakh ha during 2009-10 to 3.88 lakh ha in 2010-11. The district wise
details of net irrigated area is given in Appendix 10.3
10.30 During 2010-11, among the crops, coconut tops among the major crop supported by irrigation.
It accounted for about 34.63 per cent followed by paddy (32.33%), banana (8.96%), arecanut (7.81%)
and tubers (4.57%). The crop-wise area irrigated as on March 2011 is given in table 10.7 below:
Table 10.7
Gross Area Irrigated (Crop-wise)(in Ha.)
Sl.
No.
Source 2006-07 2007-08 2008-09 2009-10 2010-11
1 2 3 4 5 6 7
1 Paddy 173068 154400 169024 168587 150798
2 Tubers 5158 7281 10293 13065 21328
3 Vegetables 24434 16924 19238 17044 15581
4 Coconut 177734 171336 157199 151913 161503
5 Areca nut 34625 34090 33626 34240 36434
6 Nutmeg/clove 10527 10155 7956 13063 14332
7 Other Spices and conti-
ments
4312 6431 7369 5976 8530
8 Banana 40852 42116 34888 35532 41796
9 Betel leaves 590 435 399 286 450
10 Sugarcane 1156 2361 2976 2899 571
11 Others 17552 9781 15270 12178 15022
Total 490008 455310 458238 454783 466345
Source:Directorate of Economics & Statistics
10.31 There has been a good progress in irrigated area under coconut cultivation during the year.
There was a decline in the area under irrigation for paddy cultivation this year compared to previous
year. The district wise details of Gross area irrigated is shown in Appendix 10.4
Minor Irrigation
10.32 Minor irrigation is considered to have an important role to play in states like Kerala, where the
average farm size is small, land labour ratio is low and capital and foreign exchange resources scarce.
Kerala has a wide network of rivers and rivulets and springs spread over the entire cropped area.
Minor irrigation sector received considerable attention from Seventh Plan onwards and got a consider-
able boost during the Ninth Plan period consequent to the enhanced fow of funds from the grant in
Economic Review 2011
278
aid of the local bodies as well as special support received from the external agencies like European
Economic Community, Dutch Government and assistance under RIDF of NABARD. With the introduc-
tion of decentralised planning, all minor irrigation works (having cultivable command area up to 2000
ha.) were vested with the Panchayat Raj Institutions (PRIs). But by the enactment of the new Act
Kerala Irrigation and Water Management Act 2003 the defnition of minor irrigation has been changed
and works benefting an area less than 15 ha. only come under the category of minor irrigation and
are vested with PRIs. All other works having cultivable command area greater than 15 ha. have been
taken over by the Water Resources Department as medium irrigation. Schemes having a cultivable
command area upto 2000 ha. are treated as Minor Irrigation Schemes. Out of these, schemes having
an ayacut area below 50ha. were classifed as Minor Irrigation class II and those having ayacut area
of 50 ha. or more as minor irrigation class I schemes. The works generally taken up under minor ir-
rigation are check dams, construction and renovation of irrigation tanks, vented cross bars, sluices,
regulators, reclamation of Kayals, lift irrigation works etc.
10.33 The cumulative physical achievement of Minor irrigation up to Xth Five year plan was 237816
ha. (net). Minor irrigation has been given a considerable thrust during Eleventh Plan. About 24 per
cent of the outlay in Irrigation sector is proposed for the development of Minor Irrigation. The details
of physical achievement for 2008-09, 2009-10 and 2010-11 are shown in table 10.8
Table 10.8
Physical Achievement of Minor Irrigation (Surface Water)
(Net area in ha.)
Sl
No
Name of Schemes 2008-09 2009-10 2010-11
1 MI Class I 1474.81 396.30 791.13
2 MI Class II 1522.93 404.86 486.33
3 Lift Irrigation works 173.75 407.43 61.31
4 Repairs to MI structure 323.17 201.42 583.04
5 MI Class I NABARD 2032.90 4682.73 2753.81
6 MI Class II NABARD 3015.90 2522.78 479.43
7 Lift Irrigation NABARD 88.62 68.19 0
Total 8632.08 8683.71 5155.05
Source:Water Resources (Irrigation and Administration) Department
10.34 NABARD has been providing loan assistance for irrigation works through RIDF phase I to XVI
since 1995-96. The assistance of NABARD is by way of reimbursement. RIDF I to X have been
closed and the works under RIDF XI to XVI are in progress.
10.35 Five works progressing under RIDF XI are expected to be completed by 31-12-2011. The work
viz. RCB at Chamravattom sanctioned by NABARD under project I is in good progress. 84% of the
work has been completed so far. One work under RIDF XIV and 12 works under RIDF XV are in
progress.
10.36 NABARD under RIDF XVII has fxed sectoral ceiling of Rs. 26 crores for IWT, Rs.34crores for
minor irrigation and Rs.55 crores for major irrigation.
10.37 In order to rehabilitate farmers in distress affected districts like Palakkad, Wayanad and Kasar-
god, an amount of Rs.70.30 crores was allotted for minor irrigation sector. 75 proposals for an amount
of Rs. 1970.73 lakh and 62 proposals for an amount of Rs.4656.25 lakh were sanctioned for the above
three districts under NABARD RIDF XIII and NABARD RIDF XVI respectively. So far 66 works have
been completed under RIDF XIII and 13 works completed under RIDF XVI.
Kerala State Planning Board
279
Table 10.9
Details of Completed Projects under different Trenches of RIDF
Sl
No
RIDF Trenches
No of Schemes
completed
1 RIDF I 59
2 RIDF II 115
3 RIDF III 91
4 RIDF IV 66
5 RIDF V 122
6 RIDF VI 82
7 RIDF VII 40
8 RIDF VIII 43
9 RIDF IX 20
10 RIDF X 12
11 RIDF XI 139
12 RIDF XIII 222
13 RIDF XIV 27
14 RIDF XV 11
15 RIDF XVI 28
Total 1077
Source:Water Resources (Irrigation and Administration) Department
Ground Water Development
10.38 Some of the major schemes implemented during the year 2010-11 were Ground Water Inves-
tigation and Development, control and regulation of Ground Water, Rajiv Gandhi Drinking Water Mis-
sion, Conservation of Ground Water and artifcial recharge and establishment of Hydrology data Bank.
10.39 Ground Water Investigation is mainly done to identify Ground Water potential areas and to lo-
cate sites for various Ground Water extraction structures. Under this scheme Ground Water resource
estimation is carried out and materials and accessories for well construction and drilling operations is
provided. During the period 2010-11, 1162 numbers of wells were constructed and 2497 hand pumps
were repaired. Analysis of 2900 water samples were undertaken and various machineries were pur-
chased. The expenditure incurred during the period 2010-11 was ` 747.86 lakh against the budget
outlay of `.1075.61 lakhs.
10.40 Ground water control and regulation scheme aims at preventing adverse environmental impacts
of Ground Water over exploitation. Mass awareness programme, well census, well registration activi-
ties etc. are carried out. During the period, registration certifcates, permit and conversion permit were
issued to 488, 629 and 587 wells respectively. The fnancial achievement during the year is `.6.74
lakhs.
10.41 To increase the quality of service, scientifc, technical and administrative personnel are ad-
equately trained.
10.42 Rajiv Gandhi Drinking Water Mission aims at providing drinking water supply to acute drinking
water scarce areas. Under this scheme, for the year 50 bore wells were drilled. 34 bore well mini
water supply schemes and 32 bore well hand pump schemes were completed.
10.43 To prevent the overexploitation and depletion of ground water conservation, artifcial recharge
Economic Review 2011
280
has utmost importance. Under this, 22 schemes were completed for the period 2010-11 and the ex-
penditure incurred was ` 39.54 lakhs.
10.44 The physical achievement during the year under report is given in Appendix 10.5
National Hydrology Project
10.45 The Hydrology Project Phase-II which is an external aided project is a sequel to Hydrology
Project I. The project aims at supporting the Decision Support System (DSS) for Integrated Water
Resources Management (IWRM) in the state.
10.46 During the year 2010-11, data has been collected from 366 open wells, 392 piezometres and
from 7 climatic stations. An amount of `151.67 lakhs had been expended for the same during the
period.
Flood Management
10.47 The incidence of foods in the state of Kerala is becoming more frequent and severe. The con-
centrated rainfall in a short period of time of 80-90 days in a year and the steep terrains create fooding
and overfowing of riverbanks and causes river bank erosion. Continuous occurrence of high intensity
rainfall for a few days is the primary factor contributing to extreme foods. Other factors include wrong
land use practices, mismanagement of water resources and forests, reclamation of wet lands and
water bodies, change in land use pattern, deforestation etc. It is estimated that about 25% of the total
geographical area accommodating about 18% of the total population of the state is prone to foods.
10.48 Four rivers, viz., Chaliyar, Bharathapuzha, Periyar and Pamba together drain about 35 per cent
states total area and carry about 45 percent of the total surface water.
10.49 Structural and non structural measures are adopted for preventing bank erosion and fooding.
During the XI plan period, an amount of `.4431.82 lakhs was spent for the food management works
and an area of 4147.35 ha was protected.
10.50 The Government of India has approved the Kuttanand Flood protection works under the 75%
as on Flood management. The department has prepared projects for strengthening the outer bund
of the identifed padasekharam for assistance. The implementation of Flood control works of C & D
block has been initiated. Government of India has approved schemes for `143 crores under the food
management programme, a restructured scheme approved in principle by the cabinet under the state
sector in 11th plan by amalgamating four ongoing schemes of the 10th plan.
Flood Management Programme
10.51 During 11th plan, GoI launched a food management programme for providing central assis-
tance to the states for undertaking works related to river management, food control, anti erosion,
drainage development, food proofng etc.
10.52 Initially an outlay of `. 8000 crore was approved in principle which was subsequently revised to
`. 2715 crore. During 11th plan, a total of 406 number of schemes with an estimated cost of ` 7574.80
crore were included for funding under food management programme with a central share of ` 5984.19
crore. The state wise schemes approved and the central assistance released under food manage-
ment programme during 11th plan is shown in table. An amount of Rs. 22.43 crore was released to
Kerala for the Kuttanad project under the programme.
Kerala State Planning Board
281
Table 10.10
State wise schemes approved and central assistance released under Flood Management Pro-
gramme during 11th plan
(Rs. in crore)
Sl.
No.
State
Schemes included under FMP
Funds re-
leased (as on
31.08.2011) Nos. Total cost Central share
1 Arunachal Pradesh 21 107.33 96.55 57.85
2 Assam 100 996.14 896.50 508.92
3 Bihar 43 1370.42 1027.80 502.00
4 Chattisgarh 3 31.13 23.34 0.00
5 Goa 2 22.73 17.05 9.98
6 Gujarat 2 19.79 14.84 2.00
7 Haryana 1 173.75 130.31 46.91
8 Himachal Pradesh 3 225.32 202.78 117.45
9 J ammu & Kashmir 23 331.23 298.10 136.05
10 J harkhand 3 39.30 29.47 10.53
11 Karnataka 3 59.46 44.59 0.00
12 Kerala 3 249.74 187.30 22.43
13 Manipur 22 109.34 98.41 52.65
14 Mizoram 2 9.13 8.22 2.06
15 Nagaland 11 49.35 44.38 11.21
16 Orissa 66 155.42 116.56 94.74
17 Puducherry 1 139.67 104.75 7.50
18 Punjab 5 153.40 115.04 34.59
19 Sikkim 24 86.21 77.59 63.57
20 Tamil Nadu 5 635.54 476.66 59.82
21 Tripura 11 26.57 23.92 16.22
22 Uttar Pradesh 25 659.82 494.86 203.68
23 Uttarakhand 10 101.93 88.61 28.01
24 West Bengal 17 1822.08 1366.56 591.08
Total 406 7574.80 5984.19 2579.25
Source:Water Resources (Irrigation and Administration) Department
10.53 The scheme would cover all ongoing and new works related to river management, food con-
trol, anti erosion, drainage development, food proofng including food prone area development pro-
gramme to be implemented by the State Government in their respective states with central assistance.
Central assistance to the state government has also been proposed for the frst time for restoration of
damaged food management works, based upon the recommendation of Taskforce on food manage-
ment / Erosion control 2004.
Coastal Zone Management
10.54 Construction of sea walls is a popular method for stabilizing and for protecting the shores. Out of
the identifed coastline of 478 km which needs protection, 354.29 km of seawall has been newly con-
structed. The balance length of new seawall to be constructed is around 123.71 km. In the area of pro-
Economic Review 2011
282
tection of seashore, modern technologies like geo textiles, polyethylene fabrics/sheets, nourishment
of foreshore with biomaterials, etc. are emerging. During the XI Plan period, an amount of ` 17866.15
lakhs has been spent for the construction of new seawall for a length of 22.50km and reformation of
damaged seawall for a length of 69.72 km using State Fund, Tsunami Rehabilitation Package and XIII
Finance Commission Award. The physical and fnancial achievement under food management and
coastal zone management during 2007-08 to 2010-11 are given in table 10.11
Table 10.11
Financial and Physical Progress of Flood Management and Coastal Zone
Management Programmes during 2007-08 to 2010-11 (` lakhs)
Sl.
No
Item
Financial
Achievement
(2007-08 to
2010-11)
Physical
Achievement
Cumulative Physical
achievement (2007-08
to 2010-11)
1 Flood Control 5222.76 500 ha 4147.35 ha
2 Anti-Sea Erosion Works
New sea-wall constructed
Reformation of old & damaged
sea-wall
20957.08
5 Km
10 Km
22.5 Km
69.72 km
Source:Water Resources Department
10.55 The Twelfth Finance Commission has awarded `175 crores for the construction, maintenance
and reformation of the sea walls. Kerala Coast is subject to severe erosion, which undermines the
valuable coastal eco system and affects the lives of millions of people. Nearly 100 Kms. coastal zone,
prone to severe sea erosion needs to be urgently protected on a long term basis. The amount allotted
is for construction and reformation of sea walls for the protection of the coastal area and for establish-
ing permanent bench marks in the coastal area and conducting pilot studies using new techniques.
The target envisaged for the utilization of Twelfth Finance Commission Award is to construct new
sea walls to a length of 33.64 Kms, 21 groynes and reformation of 52.52 Km. during 2005-10. The
Government have accorded administrative sanction for implementation of the action plan for ` 64.05
crores, for the year 2006-07 and for ` 89.452 crores for the balance period of 2007-10. A length of
16.17 Km of new sea wall and reformation of 42.3 Km of damaged sea wall have been completed as
part of the Finance Commission Award.
Command Area Development
10.56 Various centrally sponsored and state sector schemes are carried out under CADA. There are
three ongoing projects under CADA viz, Kanhirappuzha, Pazhassi and Kallada irrigation projects.
Govt. of India has introduced restructured CADWN programmes in 4 projects viz, Pamba, Periyar
Vally, Kanhirappuzha and Pazhassi.
10.57 Local level water resources development and management programme, Participatory Irrigation
Management Scheme, construction of farm roads for transporting seeds and manure to agricultural
felds are some of the projects under taken through CADA.
10.58 Physical achievements of the existing CAD programme during 2010-11 are given in Appendix:
10.6 and 10.7.
Kerala State Planning Board
Transport
C
H
A
P
T
E
R
287
Transport sector plays a pivotal role in the overall development of the country which enables social
and culture and trade development between countries. Transport infrastructure consists of fxed instal-
lations necessary for transport, such as roads, railways, airways, waterways, canals ,pipelines, and
terminals .Terminals may be used both for interchange of passengers and cargo and for maintenance.
Kerala holds a good transport system. The major development indicators of Transport and Communi-
cation Sector in the state since 2005 are given in Appendix 11.1.
Roads in Kerala
11.2 The roads in Kerala are maintained by National Highways / Public Works Department (R&B),
Local Bodies, Department of Irrigation, KSEB, Department of Forests, Railways etc. Other agencies
dealing with transport sector are National Transportation Planning and Research Centre (NATPAC),
Motor Vehicles Department, Kerala State Road Transport Corporation (KSRTC), Kerala Transport De-
velopment Finance Corporation (KTDFC) and Roads & Bridges Development Corporation of Kerala
(RBDCK).
11.3 In the State of Kerala the Public Works Department have a total road length of 33106 Kms of
State roads and 1542 Kms of National [Link] State roads includes 4342 Kms. of State High-
ways and 18900. 058 Kms of Major District Roads. Road improvements , repair and maintenance of
existing roads , development and up gradation are the major activities taken up in the sector during the
year . Budgetary support, private fnance and institutional supports are used for the purpose
Figure 11.1
Roads under PWD in Kerala (2010-11)
6%
18%
76%
National Highways
(6%)
State High Ways (18%)
Major District Roads
(76%)
Transport
Economic Review 2011
288
State Highways and Major District Roads
11.4 All major arterial roads which provide mobility are with the PWD (R&B) consist of 4342 Km State
Highways and 18900. 058 Km Major District Roads, which shows the length of SH &MDR during
the year. Districtwise details of Road length is shown in Appendix 11.2.
11.5 Of the 14 districts in the State Kottayam has the major share of PWD roads with the length of
3016.765 Km and Wayanad has the lowest share with 766.352 Km. The district wise, surface wise and
category wise length of road maintained by PWD (R&B) as on 31-3-2011 is given in Appendix 10.3.
The surface wise and category wise length of PWD Roads during 2010-11 is given in Appendix 11.4.
11.6 Analyzing the PWD roads it reveals that only 6.655Km is cement concrete, 22174.503 Km is
black topped and 447.238 Km water bound macadam. The black topped surface contributes 95.4
percentages. The district wise details are given in Appendix 11.5.
11.7 The number of bridges and culverts and number of unsafe bridges and culverts remained same.
There are 2179 bridges (627 on SH and 1552 on MDR) and 51422 culverts (11512 on SH and 39910
on MDR) in PWD. Of them 148 bridges and 1519 culverts are unsafe and need reconstruction /reno-
vation and details is shown in Appendix 11.6.
11.8 Grama Panchayats and Block Panchayats maintain lion share of State Roads which comes to
104257 Kms which constitutes 68.75% of the total road length in the State. Agency Wise Distribution
of road length during 2009-10 is given in table 11.1.
Table 11.1
Agency Wise Distribution of Road Length during 2010-11
Sl No Department State Road
Length(Kms)
Percentage
1 2 3 4
1 Panchayats 104257 68.748
2 PWD(R&B) 23242 15.32
3 Municipilaties 8917 5.88
4 Corporations 6644 4.381
5 Forest 4075 2.689
6 Irrigation 2664 1.757
7 PWD (NH) 1542 1.006
8 Others (Railway,KSEB) 328 0.216
Total 151652 100
Source; Various agencies
Railway Over Bridge (ROB) Projects
11.9 Out of 65 ROBs approved by Railways for Kerala on cost sharing basis 48 are to be con-
structed by Roads and Bridges Development Corporation of Kerala Ltd. (RBDCK).
11.10 The corporation was entrusted with the work of construction of 48 Railway Over Bridges
spread all over Kerala including one road namely Seaport Airport Road, and a river bridge at Pulam-
anthole. Corporation completed the construction of the frst phase of the road, a river bridge and 16
ROBs upto the year 2009-10.
11.11 During the year 2010-11 the Corporation completed 4 ROBs and opened for traffc. The work
Kerala State Planning Board
289
of Malampuzha Dam Ring Road was also completed. Works of 9 New ROBs have been started at
Anayara , Cheruvathur, Devadhar, Ponnurunni, Thirunavaya, Payannur, Parappanangadi, Kainatty,
and Mulamkunnathukavu apart from the ongoing construction of 2 ROBs. Land acquisition process
are in progress in respect of 8 new Railway Over Bridges. Construction of a River Bridge at Edappal-
lam- Moorkanad for Palakkad District Panchayat at an estimated cost of Rs.10 Crores is in progress.
Kerala State Transport Project (KSTP)
11.12 Kerala State Transport Project (KSTP) is an initiative of Public Works Department, Government
of Kerala, was offcially launched in June 2002 to improve 1600 Km of State Road network and 77 Km
of Inland Water. The total cost of the project is US $336 million (appx. ` 1612 crores). Out of this, the
World Bank Assistance is US$ 255 million (appx. ` 1224 crores) and the Government of Kerala share
is US$ 80.96 million (appx. ` 388 crores).The State PWD has received a loan amounting to US $ 255
million for implementing the KSTP, from World Bank (IBRD). The original scheduled date of completion
was 31st December 2007 and was subsequently extended to December [Link] Annual Plan Outlay
for KSTP during 2011-12 was ` 250 crores.
11.13 The project comprises of Highway upgradation in two phases of 255 Kms (Phase 1) and 367 Kms
(Phase II), Improvement to inland water canals in Alappuzha and Kottayam Districts (100 Kms),Road
Maintenance of 1000 Kms, Road Safety engineering and Institutional strengthening in PWD. All the
above components except road improvement works in (Phase II) were completed.
11.14 Road Maintenance, Road Safety works, Inland Water Transport works and Transport Corridor
Upgrading and Institutional Strengthening of PWD are the other major components initiated under
KSTP. The performance during 2011 is the following.
11.15 Road Maintenance-Of the heavy maintenance of 1000 km of State roads envisaged originally
has been completed. Consequent on removal of Phase II upgrading works from the scope of this proj-
ect 8 more road sections totaling 156 kms were taken up for heavy maintenance and the works were
completed by the end of 2010.
11.16 Road Safety Engineering- In addition to the 38 completed works, additional road safety works
were taken to develop the Muttam-Thodupuzha-Muvattupuzha-Angamali Road as Model Safe Road.
The improvements to Plamood Junction and narrow bridge treatment in Alappuzha-Changanassery
road, MC road and Main Central road were also completed during the review period.
11.17 Performance Based Maintenance Contract (PBMC)-One PBMC work comprising 85 km length
of road coming under Trivandrum Road Division was tendered and work awarded to Contractors in
12/2008. This work was partly completed and closed due to contractual problems.
11.18 Transport Corridor Upgrading (Roads and Canals) 600 km roads and 77 km of canals-Up grada-
tion of 600 km of State Highway and Major District Roads are taken up under phase I and II. But due
to delay in acquisition of required land for road widening work and cost escalation, phase II upgrada-
tion work has been taken out of this project as per government decision. Also upgradation of 77 km
of feeder canals has been taken up under this project and completed by reducing the scope of work.
11.19 Government have accorded Administrative Sanction for Rs. 1356 crores to take up works un-
der external funds. The proposals were submitted to Govt. of India seeking World Bank Assistance
and agreed the proposal. The major components are up-gradation of 367 km of road sections, Road
Safety, Institutional Strengthening in PWD and Sustainable Environmental and Social Management.
Economic Review 2011
290
Research and Development in Road Sector
11.20 Research and Development activities play a crucial role in meeting the challenges of moderniz-
ing road system, technology Upgradation, road safety, traffc control and fnding cost effective solution
to infrastructure problems in general. NATPAC, KHRI and DRIQ Board are the agencies engaged in
Research and Development of the Road Sector.
National Transportation Planning and Research Centre (NATPAC)
11.21 The broad area of activities of NATPAC includes Rural/Regional Transportation, Transportation
Planning and Road Safety, Highway Engineering, Traffc Engineering and Management, Project Plan-
ning, Training and Extension Programmes. The Centre undertakes R&D Programmes in these areas.
11.22 Major Achievements of NATPAC during the year 2010-2011 are : Integrated Development of
Transport Infrastructure for an emerging town- NATPAC conducted a study to understand the amount
of traffc generated at Kottarakkara, assessed various infrastructure facilities available, and identifed
defciencies in the existing system. NATPAC identifed the major traffc bottlenecks in the town and
suggested improvement proposals for the major roads as well as the problematic junctions in the town.
Data collection such as traffc volume at selected traffc corridors were carried out along with peak-
hour volume counts at major intersections.
11.23 Short-term Development Plan for Kottayam Town: Detailed surveys were conducted to iden-
tify the major traffc bottlenecks resulted in the slow movement of traffc, the problems faced by the pe-
destrians, the problems faced by the vehicle users to park their vehicles, etc. Suitable traffc circulation
plans were submitted which will, if implemented properly will ease the traffc movement through the
town. NATPAC also identifed unused roads, which if improved can be used by two wheelers and light
vehicles so that major roads can get rid of the ever increasing two-wheeler traffc. Suitable parking
locations and pedestrian crossings were identifed and recommended for implementation. As a long
term proposal, an outer ring road has recommended in which some missing links to be formed so that
traffc can be diverted through this ring road thereby relieving the traffc through the town.
11.24 Inventory of Roads for Grama Panchayaths: The spatial data base for the 16 Grama Pan-
chayaths in Kannur District was prepared. Detailed road network map for Rural Local Bodies using
GIS format were prepared which will enable to prepare an Integrated District Development Plan. The
maps generated were distributed to the respective grama panchayaths, which will help them to identify
roads for getting external funds such as PMGSY scheme and NABARD RIDF scheme and also the
panchayaths are getting a good scaled map with the features such as the latest ward boundaries, an
updated road network and also the locations of infrastructure facilities available in their panchayaths.
Mobility Plan for West Kallada Panchayath in Kollam District:
11.25 NATPAC prepared a mobility plan for the West Kallada Panchayath panchayath which is en-
gulfed on all the three sides with water bodies and thus the road connectivity is limited to only one
PWD road passing through the panchayath. The roads maintained by the panchayath are in very bad
condition and improving all these roads will be cost effective. Hence an index has been developed
to prioritize the roads and suggestions were submitted to the panchayath for improving the roads in a
phased manner.
11.26 Traffc and Transportation studies for 23 towns in Kerala state: Department of Town and Country
Planning has entrusted NATPAC to carry out Traffc and Transportation studies for selected 23 towns
in the State.
11.27 Elevated Road Corridor between Aroor and Edappally in Cochi: NATPAC assessed the traf-
fc demand and growth potentials of the study region and arrived at technical feasibility of developing
an Elevated Corridor (EC) between Aroor and Edappally in Kochi region. This would help to improve
the quality of service of the byepass and provide adequate buffer lanes to accommodate the future
growth of traffc. This can be the longterm solution to the traffc problems of Kochi city, with optimum
benefts to the traveling public and least-impact on the environment.
Kerala State Planning Board
291
11.28 Use of Waste Plastics in road construction:Disposal of waste plastics is a major environmen-
tal problem in the State. Roads laid with plastic wastes have demonstrated the application of waste
plastics in road construction.
11.29 Resource mapping of road construction materials: Resource Mapping of Road Construction
Materials has enabled to estimate the quantity and quality of different types of construction materials
based on the engineering properties. Database with the quantum of materials available in each quarry
is prepared.
11.30 Accident Abatement Measures: Accident-prone locations on State Highways of Northern Ker-
ala have been identifed and analysed the trends in accidents.
11.31 Inland Water Transport: The study to identify constraints in developing West-Coast Canal in
Kerala with respect to National Waterway III identifes the constraints for making NW-III fully opera-
tional and suggest measures to improve the traffc and to maintain sustainability of the canal.
11.32 Road Safety Measures: The study on characteristics of Para transit modes identifed distin-
guishing characteristics of para transit services like low speed and low fuel effciency, more depend-
able and easily available. A study on Traffc Medicine has enabled to review the emergency medical
care system in Kerala, with special reference to Thiruvananthapuram.
11.33 NATPAC prepared booklets and pamphlets for school children and driving manual for autorick-
shaw and truck drivers and produced two short documentary flms on Road Safety. Training pro-
grammes on Road Safety and Defensive Driving were conducted for all target groups which include
students, tipper lorry drivers, departmental drivers and general public
Kerala Highway Research Institute (KHRI)
11.34 KHRI, Kariavattom, Thiruvananthapuram is the only Research Institute under Kerala PWD.
The major objectives and functions of the Institutes are:
to impart quality control in PWD by carrying out laboratory and feld tests of all types of
building materials;
undertake applied research works (R&D works)
to function as a regular training institute
Economic Review 2011
292
11.35 The Institute functions under four divisions as follows.
Soil Mechanics and Foundation Division conduct subsoil investigations, feld studies, laboratory
testing of soil samples etc. During 2010 11, this division conducted 374 tests.
Flexible Pavement Division conduct feld studies for evaluation of fexible pavements, laboratory
tests to ascertain the properties of aggregates and bitumen, carrying out bituminous mix design,
pavement design etc. During 2010 11, this division conducted 86 tests
Concrete and structure division conduct mix design for concrete, testing concrete cubes, cement,
sand, bricks, hollow bricks and other construction materials. During 2010 11, this division con-
ducted 1771 tests.
Traffc Engineering Division carries out topographical surveys using total station, carries out in-
vestigations connected with road safety, accident analysis etc. Also conducted traffc counts, feasi-
bility studies and DPR preparation.
11.36 KHRI also conduct training programmes for technical and non-technical staff of PWD utilizing
the plan fund and also under the State Training Policy of IMG with the support of regional centres
at Ernakulam, Kozhikode, Kannur, Thrissur and Kottayam. During the review period an amount of
15,03,565/- was received as revenue by conducting 2231 tests.
Design, Research, Investigation and Quality Control Board (DRIQ Board)
11.37 Designing and construction of Bridges, Research and Project Preparation, Quality Control and
Computerisation are the major activities of DRIQ Board. The major achievements during 2010-11 are
given below.
The wing had complead 41 structural design amd 20 nos of partially completed work which cost
about `. 210 crores znd is expected to complete structural design of 80 works for an maount of `.
400 crores.
Structural design of 50 bridges ( Total cost ` 300 crores)were completed during the review year
and expected tom complete the design of 60 bridges( Total cost ` 450 crores)
DPR preparation of widening of 6/4 lane from Karamana to Kaliyikkavila of NH 47- Phase I from
Karamana to Vazhimukku alignment plan submitted and approved
The preliminary report along with alignment plans of Vizhinjam International Container Terminal 2
KM road connectivity forwarded to VISI
High Speed Rail Corridor
1.38 The Kerala Government has decided to develop and implement High - Speed rail corridor which
required relatively less land and connecting Thiruvananthapuram to Kasaragod. The total lengh of
the corridor was estimated as 570 kms. A company named KERALA HIGH SPEED RAIL CORPORA-
TION LTD has been incorporated on 13.09.2011 and KSIDC has been nominated as the nodal agency
and DMRC is assigned the task of conducting the pre feasibility study of the project and allotted an
amount of Rs. 50 crores for the purpose during the Annual Plan 2010-11.
Motor Vehicle Department
Motor Vehicles Population
11.39 Motor Vehicles Department is one of the major revenue earning departments of the Kerala
State. Towards the administration and enforcement of Motor Vehicle Laws, collection of tax on Motor
Vehicles under various categories, registration of vehicles, licensing of drivers and regulation of use
of motor vehicles in the State in accordance with the powers conferred on the Department, and has
achieved remarkable achievements. The revenue generated during the year 2009-10 was 1094.49
Crores. During 2010-11 it has been raised up to 1265.41 Crores which shows 15.61 % increase in the
review year.
Kerala State Planning Board
293
11.40 The number of motor vehicles having valid registration as on 31-3-2011 is 6072019. The District
wise and category wise details of motor vehicles having valid registration as on 31-3-2010 is given in
Appendix 11.7. The number of newly registered vehicles for the year 2010- 11 is 674367. The details
are given in Appendix 11.8.
11.41 In Kerala Wayanad has the lowest registered vehicles followed by Idukki. The highest vehicle
population is registered in Ernakulam district followed by Thiruvananthapuram. District wise growth
of motor vehicles in Kerala from 2002 to 2011 is given in Appendix 11.9 and category wise growth of
motor vehicles in Kerala from 2002 to 2011 is given in Appendix [Link] growth in the vehicle popu-
lation of the State for the last 3 years
Year Total vehicle population(in lakhs) Annual rate of growth in %
2008-09 48.80 9.80
2009-10 53.98 10.61
2010-2011 60.72 12.48
Total 151652
Source; Motor Vehicles Department
Fig. 11.1
0
10
20
30
40
50
60
70
2008-09 2009-10 2010-11
Total Vehicle Population (
lakhs )
Annual Rate of Growth in %
Trends of Road Accidents in Kerala
11.42 Tremendous increase in the volume of road traffc in recent years has caused increase of road ac-
cidents. Government of Kerala has initiated Road Safety Authority and various programmes to address
the alarming issues of increasing road accidents by coordinating all stakeholders of Road Safety name-
ly Public Works Department, Motor Vehicles Departments, Police Department, KSRTC, NATPAC etc.
11.43 As vehicle population increases road accidents also increases. Highest number of accidents
occurred in Thrissur and the lowest in Wayanad followed by Kasargod. District wise road accidents
in Kerala are given in Appendix 10.11. It is also observed that 97.7 percent of the accidents occured
due to the rash driving of motor vehicles. The district wise and category wise details of Motor Vehicle
accidents are given in Appendix 11.12.
Economic Review 2011
294
11.44 In Kerala almost 59 percent of the vehicles are two wheelers, which accounts to 65 percent
of the road accidents registered in the State. Details of Motor Vehicles involved in road accidents in
Kerala during 2010 - 11 are given in Appendix 11.13.
11.45 The total number of road accidents in Kerala during 2010-2011 is 30237 as against 26535 in
2009-2010 showing an increase of 14 percent. The trend of motor vehicles accidents in Kerala from
2004 onwards is shown in fg 10.2. Among the 30237 accidents occurred, 19275 accidents (63.7%)
occurred in daylight. The details are given in Appendix [Link] fgure 11.2
Fig 11.2
0
10000
20000
30000
40000
50000
Accidents
Accidents 42365 29316 27930 26424 26535 30237
2006 2007 2008 2009 2010 2011
11.46 As part of E-Governance programme, to provide better, speedy, transparent and user-friendly
services to the public, all services in all offces of the Department have been computerized. Regis-
tration Certifcates and Driving Licenses are being issued in laminated card form and Permits are in
security printed forms. Driving Licences are delivered by post to the holder. Closed User Group Mobile
phones are allotted to all Heads of Offces, Mobile Enforcement Squads and check posts. All Offces
of the Department is provided with E-mail facility.
11.47 The Department has launched the website [Link] through which the public
can access Departments database and know all the services rendered by the Department. All the ap-
plication forms can be downloaded from the site. The vehicle details and the driving licence details in
the entire State could be found in the site. Learners Licence could be registered through the site.
11.48 Most the Offces of the Department offces have been connected either through the Kerala
State Wide Area Network or leased line. This enables the speedy communication between the offces
which will be refected in the overall performance of the Department.
11.49 The Department has introduced a single window system in all [Link] called Any Service
Any Counter System. The important features of this system are: -
The fees for applications for all kinds of services, tax payments etc. can be remitted in any of the
counters set up in the offces.
All the applications could be submitted in the same counter and receipts would be issued simultaneously.
An extension counter is set up in the morning and evening in selected offces.
Facilities to approach the employees for getting services without any fear and without the help of
middle man.
11.50 Touch Screen Kiosks are installed in all offces. All details like fle status, vehicle details, licence
details, fees to be paid, forms to be used, procedure for applying, mock test of learners licence test,
change of test date etc. could be known through the Kiosks.
11.51 Fast Track Counters have been introduced in all the offces of the Department. Selected services
are being rendered through these counters when the applicant himself appears producing all the docu-
ments and the services would be done within 30 minutes of submitting the application. This is like a
single visit disposal scheme.
Kerala State Planning Board
295
11.52 A Road Safety Authority has been set up by the Department for implementing various road
safety initiatives and to create awareness among the drivers and public regarding safe driving. 153
Nos. of Road Safety Clubs have been formed in various schools and colleges throughout the State to
create awareness of road safety among students and to involve student community.
11.53 Most of the R.T. Offces is equipped with speed checking radars for trapping over speeding
vehicles. All the 4 D.T.C offces have been equipped with the Mobile Interceptors for the surveillance
and enforcement activities of the Department. A new scheme namely Driver Testing Yard has been
introduced during the last fnancial year and a pilot project is being implemented at Chevayur, Kozhik-
kode. Another yard would be launched in Kannur during the current fnancial year.
Motor Vehicles Population
11.54. Total number of Stage Carriages in the State comes to 46620. But KSRTC holds only 5741
buses. It shows lion the share of Passenger Transport Operation in Kerala is vested in the hands of
private operators. The percentage of the Stage Carriages of KSRTC and private sectors can be seenin
fg.11.3.
Fig 11.3
Passenger Transport Operation in Kerala(2010-11)
Private Sector
89%
KSRTC
11%
11.55 Out of the 5741 buses of KSRTC 1641 buses are aged above ten years. The age wise details
of KSRTC buses are given in Appendix 11.15.
11.56 The number of Schedules operated rose from 4691 in the previous year to 5249 in 2010-11
shows an increase of 288 operations. So also, the gross revenue collection of the Corporation in-
creased from 1164.22 crores in 2009-10 to 1309.21 crores in 2010-11 .The major indicators showing
operational effciency of KSRTC is given in Appendix 10.16. District wise details of KSRTC operational
statistics are given in Appendix 10.17. The fares charged by KSRTC ranged from 55 paise per Km in
ordinary and city buses, and 110 paise per Km in High-tech buses. The fare structure of KSRTC dur-
ing 2009-10 is given in Appendix 10.18. The major performance indicators such as average Kms run
per day per bus, average route length etc are given in Appendix 11.19.
11.57 During the review period, 705 new buses were put on road. Corresponding to the expansion of
feet the work force also got strengthened by adding 6003 recruits from PSC , and 126 dependents of
employees as dying inharness. The details of buses owned by KSRTC including new buses from 2006
to 2011 are given in Appendix 11.20.
11.58 Total computerization is in progress and Electronic Ticket Machine (ETMs) have been intro-
duced in all Depots with the implementation of Puthucaud operating centre on 10.5.2010. Online res-
ervation system facilitating anywhere to anywhere booking/cancellation has been implemented in all
the reservation counters in KSRTC. A part of m- Governance programme, an enquiry sytem facilitating
KSRTC bus timings through SMS was introduced w.e.f. 02.09.2011.
11.59 As part of mobilizing non operating revenue, it is decided to construct shopping complex-cum-
Bus Station in major towns of Kerala. The shopping complex at Ankamaly and Kasaragod and Kat-
KSRTC 11%
Private 89%
Economic Review 2011
296
takada has been inaugurated. The work at Kozhikode, Thiruvananthapuram Central (Thampanoor),
Thiruvalla are in progress. In addition, several construction works
11.60 Training was given to 6263 employees at the staff Training Centre, KSRTC, which includes all
the newly recruited drivers, conductors and other staff. 507 drivers were given corrective training to
the drivers with special emphasis on avoiding accidents.
Transport Finance
11.61 Kerala Transport Development Finance Corporation , formed with the aim of providing loans to
Kerala State Road Transport Corporation and the company has expanded its business by granting
loans to other Government / Quasi Government Organizations, individuals for purchase of new ve-
hicles from 1998 onwards.
11.62 Till date the Corporation has granted `1741.57 Crores to Kerala State Road Transport Corpora-
tion. The company is mobilizing the funds required for these business activities through the issue of
Bonds, Fixed Deposits, Bank borrowings [Link] authorized capital of the company is ` 50 crores and
the paid up share capital including share capital advance of ` 43.83 crores.
Water Transport
Port Sector
National Scenario
11.63 India has a long coastline extending over 7517 km with about 150 working ports including 12
major ports and 187 minor ports. Nearly 95 per cent of the countries transportation of goods is by sea,
making development of ports critical for nations progress. The major ports in India are maintained
by the Central government, while all the other ports come under the jurisdiction of respective state
government. Indias 12 major ports handle one third of countrys external trade with cargo handling
capacity of 575 MT.
11.64 Government of India targets to increasing the cargo handling capacity of major ports by two
folds to reach 1.5 billion metric tonnes (MT) by the year 2012. This will be achieved at an investment of
around USD 25 billion through public-private partnerships. A Crisil research on Indian ports and mari-
time transport estimates that ports will grow by 160 per cent over the 2011-12 period. Cargo handling
at the major ports is projected to grow at 7.7% per annum (CAGR) till 2011-12 and the cargo traffc
is estimated to reach 877 million tonnes by 2011-12, whereas the containerized cargo is expected to
grow at 15.5% (CAGR) over a period of 7 years. The New Foreign Trade Policy envisages doubling of
Indias share in global exports in next fve years to Rs.675000 crores (USD 150 billion). A large portion
of the foreign trade to be through the maritime route: 95% by volume and 70% by value.
11.65 The experience of operating berths through PPPs at some of the major ports in India has been
quite successful. It was, therefore, decided to expand the programme and allocate new berths to be
constructed through PPPs. Governments have also decided to empower and enable the 12 major
ports to attain world class standards. To this end, each port is preparing a Master Plan for 20 years
and an Action Plan for seven years. Recognizing that the shipping industry is moving towards large
vessels, a plan for capital dredging of channels in major ports has also been formulated.
11.66 Major ports in India handle nearly 75% of the total cargo traffc. 70% of the traffc at major
ports by volume is dry and liquid bulk, remaining 30% is general cargo including containers.
11.67 Container traffc at Indian Ports is growing rapidly and has increased by 102% in the last fve
years to 5.4 million Twenty-Foot-Equivalent Unit *(TEU) in 2006-07. It is expected that the growth
rate will continue to be dramatic and that by 2016-17, the country will handle 15.64 million TEU.
Kerala State Planning Board
297
Kerala Port Sector
11.67. The Kerala state lies in the south west corner of the Indian peninsula. It has a coastal length of
585 km and the state has an average width of about 60 km with one major port at Cochin and 17 non
major ports. The non major ports are under the administration of Government of Kerala. Government
of Kerala intends to provide a boost to coastal shipping with the development of ports. Kerala state
has got the Ghats in the east and the Arabian Sea on the west. The forest area in the east and coastal
area in the west are environmentally very sensitive areas. The midland and coastal lowland are thickly
populated. The physical and geographical features of Kerala and shortage of land causes man hard-
ships for port development and industrialization in Kerala. The geographical location of Kerala is very
close to international shipping route. There are seventeen minor ports in Kerala, out of which three are
considered as intermediate ports based on berthing, cargo handling and storage facilities available in
them. These have contributed much to the development of industry. trade, commerce and agriculture
in the country.
11.69 Presently cargo operations take place only in three ports i.e. in Vizhinjam, Beypore and Azhik-
kal ports. Vizhinjam handles about 1000 tonnes. Beypore 50,000 tonnes and Azhikkal about 5000
tonnes annually. The remaining minor ports in Kerala are now defunct due to various reasons. As
stated above the intermediate and minor ports are to be developed and modernized to meet the ex-
pected increase in traffc and also to tap the potential available. These developmental activities have
to be taken up and completed in the Eleventh Plan.
Advantage
11.70 The main advantages of moving from Road/Rail Transport to Costal Shipping are that coastal
shipping will ease the burden on the heavily congested highways in the State apart from savings in
transportation cost. Government, besides acting as a catalyst for establishment of ship repair and ship
building industries, would also encourage other port based industries contributing to the development
of ports.
Private Sector Participation
11.71 Recognizing the need to develop the ports in a time bound manner, on account of the paucity
of adequate resources, Government decided to encourage private sector participation in the sec-
tor. Government is committed to seek private sector investments into the port sector and to create a
framework for such participation; the Kerala Port Policy was announced in the year 2004.
Cochin Port
11.72 Cochin Port is the only major port in Kerala. It spreads over 827 hectares. It has a water frontage
of 7.5 Km. The port has connectivity to hinterland through NH 47, NH 17 and NH 49. Rail links to the
Konkan and Southern Railway also give key rail access to its hinterland. An inland waterway connecting
Kollam and Kottappuram on either side is being developed by the Inland Waterways Authority of India.
11.73 The total traffc handled by the Port during 2011 recorded an increase by 12.52%showing an
increase of 174.29 lakhs tonnes against 154.94 lakhs tonnes in the preceding year. During the year
foreign cargo traffc increased by 11.08 % to 118.81 lakhs tonnes from 106.96 lakhs tonnes in the
preceding year. Coastal cargo traffc increased by 15.63% to 55.48 lakhs tonnes from 47.98 lakhs
tonnes.
11.74 Total import traffc handled during the year recorded an increase by 8.21% to 138.33 lakhs
tonnes from 127.84 lakhs tonnes in the preceding year. Total export traffc handled during the year
showed increase of 32.69% to 35.96 lakhs tonnes from 27.10 lakhs tonnes in the preceding year.
11.75 During the year the tonnage of container cargo (excluding tare weight of containers) handled
recorded an increase of 11.38% to 32.88 lakhs tonnes from 29.52 lakhs tonnes in the preceding year.
Exports in containers showed an increase of 49.82% during the year to 16.48 lakhs tonnes from 11
Economic Review 2011
298
lakhs tonnes in the preceding year and import in containers showed a decrease by 11.45% during the
year to 16.40 lakhs tonnes from 18.52 lakhs tonnes in the preceding year. Total number of containers
handled also showed an increase to 289817 TEUs during the year from 260784 TEUs handled in the
preceding year indicating an increase by 11.13%.
11.76 During the year 2010-11, 1256 ships called at the Port as against 1278 ships in the preceding
year registering an decrease of 1.72% in shipping activity. The total NRT of ships called at the Port
showed an increase of 2% during the year over that of the preceding year which is shown in Appendix
11.21.
11.77 During the year 2011 total number of passengers arrived at and sailed from Cochin Port during
the year was 102371 and 110115 respectively as against 59899 and 62941 in the preceding year.
Vallarpadam International Container Transshipment Terminal
11.78 The Prime Minister of India laid the foundation stone for Vallarpadam International Container
Transshipment Terminal in 1995. Completion of this prestigious project would make the Cochin port a
major hub port in the Indian Ocean region.
11.79 At present containers from the Indian sub continent are being transshipped to Colombo. With the
development of Vallarpadam Mother Vessels will come to Kochi and consolidate and carry the containers
from other ports of India to the outside world.
11.80 All statutory clearances required for the Terminal construction were received. The frst stage
work of Capital Dredging for providing 12.5 m depth at the existing Rajiv Gandhi Container Terminal
was completed in 2006.
11.81 Regarding the construction of ICTT at Vallarpadam, Soil stabilization work with stone columns
and band drains commenced and is in progress. Supporting infrastructure project namely stage-II
capital dredging for providing 14.5 m draft at ICTT, National High Way connectivity at a route length of
17.2 kms and Rail connectivity with route length of 8.86 Km are at various stages of execution.
Kerala State Planning Board
299
Vizhinjam Deep Water International Container Transshipment Terminal
11.82 Vizhinjam International Deep Water multipurpose Seaport is a fagship project of Government of
Kerala being developed on a landlord port model. Vizhinjam Intermational Deep Water multipurpose Sea-
port limited ( VISL ) is a special purpose government company ( fully owned by government of Kerala ) that
would act as a implementing agency for the development of a Greenfeld port
11.83 Vizhinjam is a natural port, which is located close to the international ship route. So it is expected
that at least 50% of the (nearly 20,000) ships that pass through the Suez canal (per annum) will anchor
at Vizhinjam Port. It is expected that with the functioning of Vizhinjam port in its full swing, the ports of
Colombo, Singapore and Dubai might face serious competition from India. This will boost the trade and
commercial activities not only in Kerala but also to entire India. It is estimated that India could save more
than a 100 million U.S. dollars per year in terms of foreign exchange.
11.84 Studies conducted at Vizhinjam have shown that there is a natural depth of 23 metres. A port con-
structed here could easily accommodate ships with displacements of up to 300,000 tons, with little or no
dredging. Most of the current ports are not able to accommodate ships of even 200,000 tons even after
massive dredging. Basically this means that the Vizhinjam port can handle supertankers and the biggest
container mother ships with ease.
11.85 Government of Kerala decided to adopt Landlord model for the development of the port based on the
recommendations of International Finance Corporation ( IFC ) , the transaction advisor to the project. This
model is a combination of public and private partnership where the Government of Kerala would invest
in the infrastructural facilities like the breakwater, dredging ,reclamation ,utility and connectivity . The port
operatios and superstructure will be taken up by private operators.
11.86 As India now did not have ports that deep, goods were being transported on smaller ships to India.
The port is supposed to be 150 meters in width. About 250-275 hectares (600 to 700 acres) would be made
available through reclamation of the sea. The port would have two breakwaters of 1.5 km and 6 km with
Harbour basin and wharfs. There would be about 30 berths, most of which would be capable of handling
Mother Vessels. There was high potential for a new port as India needs additional capacity in the coming
years. Thus Vizhinjam port has very high importance form this point of view. The port handling capacity
is envisaged to be 4.1 million TEU/annum at the completion of the Project and would cater to 12000 TEU
vessels. An investment of at least `2500 crores will be required while overall project completion time will
take about 3 years.
Competitive Advantage of Vizhinjam
Located on Southern tip of Indian Peninsula
Only 10 nautical miles from the major international sea route and East-West shipping axis
Natural water depth of more than 20 m within a nautical mile from coast.
Minimal capital dredging (1 million cubic metres in Phase I).
Least Littoral transport.
Negligible maintenance dredging
Central to the eastern and western coast lines of India-can cater to the needs of both
west and east coast.
*Greenfeld nature- fexibility in design & connectivity.
No signifcant environmental/social issues
Proximity to rail (10 Km), road (3Km) network & airport
No tariff regulations
**Being Greenfeld Project no legacy of excess personnel.
Autonomy and freedom in operations to operate competitively
No acquisition of land needed for the Port itself
Nearer to State capital city, that has an International airport, the required human re-
sources and social infrastructure.
Scope for tourism infrastructure due to proximity to Kovalam (Cruise Terminal, Marina)
Economic Review 2011
300
Non Major Ports
11.87 The Non Major ports are under the direct control of State Government. The Government agencies
involved in the development of ports in the State are Port Department, Harbour Engineering Department,
Hydrographic Survey Wing
11.88 Commodity wise cargo handled in the non major ports during the year 2010-11 are shown in
appendix 10.22. Cargo handling during 2010-11 was confned mainly to Kozhikode, Kollam,Vizhinjam and
Azhikkal ports. The number and tonnage of steamers and sailing vessels that called at intermediate and
minor ports during 2011 are shown at appendix 10.23. During 2010-11, 549 steamers and sailing vessels
with registered tonnage of 141609 are called at non- major ports against 592 steamers and sailing ves-
sels with 156621.99 tonnage in the previous year. The number of crafts ( Cargo operations )owned by the
private parties registered at the intermediate and minor ports are shown in appendix 11.24
11.89 Statement showing the revenue collection at the non-major ports during 2010-11 is shown in Ap-
pendix 10.25. The revenue collected during the year 2010-11 is `791.37 lakhs as against the collection of
`429.59 lakh during 2009-10
Development of Beypore Cargo Harbour
11.90 The scheme was originally sanctioned for an amount of `325 lakhs during 3/1997. Construction
of 100 M wharf, transit shed, parking and loading area, internal road , water supply arrangements, are
completed. During 11/2002 Government sanctioned another wharf of 60 m length costing `123 lakhs in
between the old and new wharves. A passenger terminal costing `34 lakhs was also sanctioned by the
Government in 2005. During 2010-11construction of approach road, stack yards were completed.
Development of Azhikkal Cargo Harbour
11.91 Government have already issued administrative sanction for `825 lakhs for the phase I development
of Azhikkal port. The components of the scheme are 226.2 m long wharf , land acquisition , compound wall ,
transit shed, widening of port road , electrifcation ,navigational aids investigation etc. construction of wharf,
widening of port road were completed .Dredging ,power supply arrangements and navigational aids are
to be arranged
Cargo Berth at Kollam (Thangassery)
11.92 Thangassery harbour area is already a declared cargo port and there is ample scope for future
development. The sheltered fshery harbor basin available is very ideal to develop a cargo port, which can
accommodate cargo vessels as well as passenger liners. At the entrance the depth available is 8 m and
in the basin varies from 6 to 8m.
Development of Vizhinjam Cargo Harbour
11.93 Vizhinjam port is situated near the international sea route,which is having adequate natu-
ral depth and enough potential for economic development as a deep- water cargo harbor . The facili-
ties presently available at the port are quite insuffcient for the above purpose. Hence for the devel-
opment of Vizhinjam cargo port for larger draft vessels the required facilities are to be provided. As a
frst stage , it was decided to construct a second cargo berth with ancillary inside the basin by the side of
the seaward breakwater.
Kerala Maritime Institute
11.94 Port Department inaugurated on 3/05/2010 its frst Maritime Institute at Neendakara in an 11 acre
campus. The tender documents for campus development at Neendakara approved by Government Body
held on 7/7/2011, chaired by Honable minister for ports. A sub centre of the institute started functioning
on 3/09/2011 at Kodungalloor. A campus and buildings for Maritime Institutes in Neendakara And Kodun-
galloor is under the consideration of the Government.
Kerala State Planning Board
301
Hydrographic Survey Wing
11.95 The Hydrographic Survey Wing was constituted in 1968 as a component of the Kerala State Port
Department with a view to cater to the requirements of Hydrographic Investigation for the development of
the non major ports of Maritime State of Kerala. There is no similar establishment in India run by a State
Government.
11.96 Since its formation, the Wing has been conducting pre-dredging and post-dredging, pre-monsoon
and post-monsoon surveys to ascertain various aspects such as requirement of dredging, data required
for the construction of Fishing Harbours, Fish Lading Centers, Small ports etc. In addition to the routine
pre-monsoon and post-monsoon survey at 16 non-major ports they also undertakes survey work for oth-
er departments like Irrigation, Inland Navigation, PWD and Research Institutions like Kerala Engineering
Research Institute etc.
11.97 20 surveys were conducted during the year 2010-11 for Port Department . Dredging surveys of
Thankasserry , Beypore, Azhikal, Akkulam were also conducted during 2010-11. Hydrographic Surveys
of Neendakara, Muthlapozhy and Thenmala Dam were conducted by the Southern range of this Wing.
Pre Monsoon surveys of Beypore & Azhikal ports and post Monsoon surveys of Beypore port were
conducted.
Inland Water Transport
11.98 Inland Water Transport, is a fuel effcient and environment friendly mode of transportation. India
is richly endowed with navigable waterways, comprising rivers, canals, backwaters, creeks, etc. It is esti-
mated that a total of 14500 km of the waterways could be used for passenger and cargo movement. About
44 million tones of cargo is being moved annually by inland water transport. But, this means of transport
is important only in few States, namely, Assam, West Bengal, Bihar and Kerala. Also, it is operational only
in restricted stretches of Ganga-Bhagirathi-Hooghly river; the Brahmaputra river; the Barak river; the rivers
in Goa; the backwaters in Kerala; Inland waters in Mumbai and the deltaic region of the Godavari-Krishna
rivers.
10.99 Besides, the capacity of this sector is under-utilized, because most navigable waterways suffer
from hazards like shallow water and narrow width of channel during dry weather; silting of river beds and
erosion of banks; absence of adequate infrastructural facilities like terminals for loading and berthing and
surface road links.
11.100 As a part of the Governments policy to optimally develop and harness the potential of Inland
Waterways in the country, the Inland Waterways Authority of India (IWAI) was set up under the Inland
Waterways Authority of India Act, 1985. The IWAI has been established for the development and regu-
lation of Inland waterways for shipping and navigation and for matters connected therewith or incidental
thereto. The Inland Waterways Authority of India Act, 1985, empowers the Government to declare water-
ways with potential for development of shipping and navigation as National Waterways.
Currently, three waterways have been declared as National Waterways:-
1. National Waterway No.1:- The Ganga between Allahabad-Haldia (1629 km) in UP, Bihar, J harkhand and
West Bengal.
2. National Waterway No.2:- The Sadiya-Dhubri stretch of river Brahmaputra (891 km) in Assam; and
3. National Waterway No3:- The Kollam Kottapuram stretch of West Coast Canal along with Champakara
and Udyogmandal Canals (205 km) in Kerala.
11.101 Also, in order to provide an impetus to the development of Inland water transport modes, an Inland
Water Transport Policy has been announced. It includes several fscal concessions and guidelines for
encouraging private sector participation in development of infrastructure and ownership and operation of
Inland vessels. IWAI is also authorized for joint ventures and equity participation in BOT projects.
Economic Review 2011
302
Inland Water Transport in Kerala
11.102 The State of Kerala, with numerous backwaters, is one of the State in India, where waterways are
successfully used for commercial Inland Water Transport. The transportation is mainly done with country
craft and passenger vessels. There are 41 navigable rivers in Kerala. The total length of the Inland Water-
ways in the State is 1687 Kms.
11.103 The Government agencies engaged in the development of Inland Water Transport in the State are
Coastal Shipping and Inland Navigation Department (CSIND), State Water Transport Department (SWTD)
and Kerala Shipping and Inland Navigation Corporation Ltd. (KSINC).
State Water Transport Department
11.104 State Water Transport Department formed during 1968 with the objectives to provide Transport
facilities to the people residing in the water logged areas at cheaper rates and Cargo transportation. Con-
struction of roads, bridges and speedy transportation-roadways shortened the operation of the Department
to passenger transport only-in the backwaters and ferries. But in the world of speed and hurry the advan-
tage of this pollution free, accident free and cheaper transport system beckons least preferences.
11.105 During 2010-11 the department took stringent action to replace most of the old wooden boats above
25 years old with new steel boats and timely repair were made to rest of the wooden boats by purchasing
timber from the Forest Department . As such steel boats of 90 & 100 passenger capacity were purchased.
The existing workshop at Alappuzha was equipped with technically advanced instruments.
11.106 Procedures were started to construct new station offce building at Kollam and fuelling jetty at Er-
nakulam .All boats were equipped with life saving equipments including life jackets prescribed in Inland
Vessel Rule 2010. Supply order were made for the purchase of out board engine ,power steening assem-
bly , Ashok Leyland engine Chemical toilet etc.
Kerala Shipping and Inland Navigation Corporation Ltd.
11.107 The Corporation was formed in 1989 by the statutory amalgamation of Kerala Inland Navigation
Corporation Ltd. (KINCO) and Kerala Shipping Corporation Limited (KSC) are two Government of Kerala
Companies. The main objective of the company is to develop passenger and cargo transportation through
Inland Waterways of Kerala, docking and repair of marine vessels, construction of boats, conducting navi-
gation training programmes, conducting tourist cruises, providing navigational aids and maintenance in
National Waterway-III.
11.108 The Corporation at present has 9 barges 9 tourist boats and 2 J hankars. During 2010-11 KSINC
has commissioned one new 600 MT Dry bulk cargo barge . Construction and repair of boats, barges and
other marine vessels of the Corporation and customers in the public and private sector are carried out by
the corporation by leasing a slipway complex from Cochin Port Trust since 1991.
11.109 The Corporation had also started a Marine Training Institute for giving training for operating Inland
Vessels and Crafts. Three batches have completed training. The volume of cargo carried by the Corpo-
ration during 2010-11 is 288.35 (000 tonnes) as against 295.81(000 tonnes) during 2009-10 showing a
decrease of 2.5 percent. The Corporation is employing 205 persons during the period.
Railways in Kerala
11.110 Railways are essentially the cause for Industrial upsurge in the nation and it still remained the larg-
est employment provider for the huge population of the country. The total length of track used by Indian
Railways is about 111599 Km and the total route length is 64215 kms. The State total Railway route has a
length of 1257 Km and covers 13 Railway routes. The Railway Divisions at Thiruvananthapuram, Palak-
kad and Madurai jointly carry out Railway Operations in Kerala. The following six new Train services were
started from Kerala during 2010-11
Kerala State Planning Board
303
1. 15905/15906 Kanniyakumari-Thiruvananthapuram-Dibrugarh Vivek Exp.(weekly)
2. 22852/22851 Manglore-Santragachi Superfast Vivek Exp.(weekly)
3. 16350/16349 Nilambur Road-Thiruvananthapuram Rajya Rani Exp.(daily)
4. 19259/19260 Kochuveli-Bhavanagar Exp.(weekly)
5. 22816/22815 Ernakulam Bilaspur Exp.(weekly)
6. 22609/22610 Mangalore-Palakkad Superfast Intercity Exp.(daily)
Rail Coach Factory, Palakkad
11.111 Honble Union Minister of Railways made an announcement in the Railway Budget for 2008-2009,
that a Rail Coach Factory would be set up at Palakkad in the State of [Link] conducted a detailed
study on this project.
11.112 Govt. of Kerala after discussions with the Southern Railway, notifed that 239 acres of land would
be handed over to the Ministry of Railways at a cost of Rs.33.70 crores for setting up the proposed Rail
Coach Factory at Kanjikode near Palakkad. The land acquisition process by the railway and the Kerala
State is now in [Link] adequacy of the land for setting up of Rail Coach Factory has been reviewed
and found that 239 acres of plain land is suffcient for setting up of the Rail Coach Factory with can produce
upto 400 coaches a [Link] project is estimated at a cost of Rs.550 crores and will be undertaken as a
joint venture in which Railway shall contribute 26% of the equity.
11.113 The State government has allotted 426 acres of land at Kanjikode for the Rail Coach Factory. The
work on the Coach factory in Palakkad is progressing. The project is being taken up as a Public Private
Participation (PPP) project for which token provision has to be provided in the Railway budget. The Coach
Factory will also bring more than 100 ancillary industrial units to the area .
11.114 The coach factory entailed an investment of `5000 crore in the frst phase and the coaches were
also meant to be exported. Once the process are over and the land is handed over by the State Govern-
ment, funds could be earmarked in the Railway Budget for the factory.
Air Transport
11.115 Kerala has three Air Ports at Thiruvananthapuram, Kochi and Kozhicode handling both Interna-
tional and Domestic fights. Thiruvananthapuram and Kozhicode Air Ports are owned by Government of
India and Kochi Air Port is owned by Kochin International Air Port Ltd (CIAL), a company set up by Gov-
ernment of Kerala with Public Private Participation. The Details of the Flights operated during 2010-11 by
various agencies at these three airports are given in Appendices Appendices 11.27 (A), (B) and (C).
11.116 The major achievements of Cochin International Airport Limited during the review year is as follows
The passenger Traffc during March- 2011 is 43,45,179 against to 39,46,103 in the last last year
registering growth of 10.11%
Air Asia and Sri Lankan Airlines have commenced their fights operations to/from Cochin
International Airport.
Cochin International Airport Limited has declared dividend of 215% to their shareholders
The construction work of air-conditioned Trade fair Centre is nearing completion
The work of Air Port Museum is nearing completion
The work of Hanger Facility is almost completed and same will be operational shortly
The work of First Phase of Golf Course ( 9 Holes ) has been completed
Commenced the construction of Duty Free Godown
11.117 The following are the major achievements of Kozhicode International Air Port during 2010-11.
LS commissioned for Runway 10 (Now both the Runways is with ILS)
Procured new advanced Airfeld Crash Fire Tenders at a cost of Rs.14 crores.
Augmentation of Power supply by providing 750 KVA DG sets.
Administrative approval issued for Rs.121 crores to construct new Arrival Block
& Apron expansion.
Hajj operations were conducted smoothly.
Economic Review 2011
304
Kannur Air port
11.118 The States prestigious greenfeld airport project named KANNUR INTERNATIONAL AIRPORT
will be coming up close to Mattannur in Kannur district of Kerala State. It is only 20 kms away from Kan-
nur city, and 2 kms from Mattannur on Kannur Mattannur Mysore road. The Airport will have a runway
length of 3400 meters. The orientation of the runway is 07/25, which permits obstacle free approach. The
airport is expected to have an annual traffc of more than 1 million international passengers and above 0.3
million domestic passengers as per 2009-2010 estimate.
Objectives
To provide an international gateway with state-of-the art facilities to support safe, effcient and cost
effective travel for foreign tourists and non-resident Indians from Kerala, as well as domestic passen-
gers.
To act as air cargo hub for perishable cargo like cut-fowers, vegetables, fruits, seafood etc.
To provide a host of commercial, trade promotion and industrial activities that can generate employ-
ment opportunities, provide avenues for the trade in traditional products to affuent markets in the Gulf
and Europe and to open new vistas in the feld of IT & ICT.
To promote beach, pilgrimage and health tourism.
To transform the North Malabar region into a highly developed growth centre for travel, tourism and
industries.
11.119 The major achievements of Kannur International Airport during the review year is as follows
192.18 acres of land acquired during the Phase I for the Airport project transferred to KIAL .
1085 acres of land has been acquired during Phase II under the Fast Track Scheme and compen-
sation paid to the land owners. Land required for rehabilitation has also been taken over and plots
to be given to each of the 126 families have been selected through lottery in the presence of the
families and representatives of Mattannur Municipality and Keezhallur Panchayat.
In the Third Phase, 783 acres more has been notifed and is expected to be taken over in 6 months.
MOU signed for transferring 453 acres of land towards Kerala Govt. Equity. Balance land will be
transferred on lease basis to KIAL.
Equity allotted to Kerala Tourism Development Corporation Ltd, M/s Kerala State Beverage (Manu-
facturing & Marketing) Corporation Ltd, M/S Kerala State Industrial Enterprises Ltd and The Kerala
Minerals & Metals Limited
Foundation stone laid on 17th December 2010 and preliminary works commenced
Consultancy for Kannur Airport Project has been assigned to Cochin International Airport Ltd. (CIAL)
and the work is in progress
Centre for Earth Science Studies (CESS) has been engaged for obtaining environmental clearance
for the project.
Techno economic feasibility study completed by EMA Unihorn (P) Ltd and Techno-Economic Fea-
sibility Report (TEFR) submitted in the year 2005. CIAL would be revising this TEFR and a Detailed
Project Report (DPR) will be given by CIAL as part of their consultancy work.
Cargo Traffc
11.120 Kerala State Industrial Enterprises Ltd, a PSU under the industries department is the management
of the two Air Cargo Complexes at Thiruvananthapuram and Calicut Airport. The Company is the custodian
of these tow Air Cargo Complexes as appointed by the respective commissioners of customs. KSIE pro-
vides necessary infrastructural facilities for the promotion of exports through these Air Cargo Complexes.
The company is also engaged in trading activities through the 3 business centres at Thiruvananthapurma,
Ernaklulam and Kozhikode and also through its e-com site Keralarcade. Com. KSIE also continues to act
as the virtual offce in Kerala for agricultural and processed Food Products Export Development Authority
(APEDA), Ministry of commerce, Govt, of India. Last year KSIE had commissioned the Kerala Soaps
unit at Kozhikode by spending around [Link] crores and had re-launched the branded soaps items
Kerala State Planning Board
305
like Kerala Sandal, Vep, Thrill, Washwell etc of the erstwhile Kerala Soaps and Oils Ltd. KSIE is currently
concentrating on the commissioning of its Freight Station at Kalamassery at an estimated project cost of
Rs. 3223 lakhs.
11.121 During the year 2009-10, the company earned a total income of ` 1187 lakhs as compared to `
1855.75 lakhs during the previous year. Major portion of the income was earned from the operation of Air
Cargo Complexes followed by income from trading activities. During 2009-10 the company has made a
gross proft before tax of ` 6.2 crores as against ` 5.6 crores during the previous year. During the year under
report 20466 MT of import Cargo and 35635 MT of export Cargo were handled by the Air Cargo Complexes
which were operated by KSIE compared to 16280 MT of import cargo and 30774 MT of export cargo han-
dled during the previous year. Both the Air Cargo Complexes maintain a high standard of quality justifying
their status as ISO 9001 certifed cargo terminals. Board of Directors has recommended a dividend @ 35%
on the Equity Share Capital i.e. ` 42 lakhs for the year 2009-10. Details of export and import through air
cargo complex at Thiruvananthapuram and Kozhicode from 2003-04 to 2009-10 is given in Table. 11.3.
Table - 11.3
Details of Export and Import through Air Cargo Complex
Year Export (MT) Import (MT) Income(Rs. lakh)
2006-07 28336 18896 880.61
2007-08 28481 17822 941.1
2008-09 30773 16262 852.27
2009-10 35635 20466 1130
2010-11 41083 27726 1371
Source; KSIE
Passport and Emigration
11.122 The three passport offces at Thiruvananthapuram, Kochi and Kozhikode together received about
553786 passport application and issued about 553425 passports during 2008-09. Number of passports
issued from the three passport offces from 2001 onwards is given in Appendix 11.28.
11.123 The work relating to emigration of Indian citizens from India to other countries for employment and
return of emigrants is the responsibility of the Ministry of Overseas Indian Affairs. Offce of the Protector of
Emigrants, Cochin is under the supervision and control of the Protector General of Emigrants, Ministry of
Overseas Indian Affairs, New Delhi. During 2009-10 ,18069 clearances were granted from the offce of the
Protector of Emigrants, Kochi.
Passport and Emigration
11.124The three passport offces at Thiruvananthapuram, Kochi and Kozhikode together received about
553786 passport application and issued about 553425 passports during 2008-09. Number of passports
issued from the three passport offces from 2001 onwards is given in Appendix 11.28.
11.125 The work relating to emigration of Indian citizens from India to other countries for employment and
return of emigrants is the responsibility of the Ministry of Overseas Indian Affairs. Offce of the Protector of
Emigrants, Cochin is under the supervision and control of the Protector General of Emigrants, Ministry of
Overseas Indian Affairs, New Delhi. During 2009-10 ,18069 clearances were granted from the offce of the
Protector of Emigrants, Kochi.
Postal Network of Kerala
11.126 Kerala Postal Circle includes the entire state of Kerala, the Union Territory of Lakshadweep islands
and Mahe under the Union Territory of Pondicherry, Kerala is the only postal circle where every village has
at least one post offce. During 2010-11 there are 5067 Post Offces in Kerala, 10 post offces in Union Terri-
Economic Review 2011
306
tory of Lakshadweep and 4 in Union Territory of Pondicherry (Mahe). These include 1506 are Departmental
post offces and the remaining 3661 are Extra Departmental post offces (which function for at least mini-
mum of 3 hours depending on the work load). On an average each post offce in the state serves an area
of 7.68 [Link] and a population of 6587 as against the national average of [Link] and a population of
7175 people. 83 % of these post offces are in rural areas. District Wise Distribution of the post offces is as
under Table - 11.4
Table - 11.4
Sl. No Name of District/ Union Terri-
tory
Post offce Sl. No Name of District/
Union Territory
Post of-
fce
1 Kasargod 234 9 UT of Lakshadweep 10
2 Kannur 381 10 Ernakulam 392
3 Wayanad 163 11 Idukki 294
4 UT of Podichery (Mahe only) 4 12 Kottayam 409
5 Kozhikode 412 13 Alappuzha 300
6 Malappuram 435 14 Pathanamthitta 317
7 Palakkad 455 15 Kollam 362
8 Trissur 485 16 Thiruvananthapuram 414
Total 5067
Source: Chief Post master General
11.127 Given the vast reach of the network in the state, currently efforts are being made to increase ac-
cess to postal facilities in newly developed urban/rural areas by opening new post offces or by upgrading
existing Extra Departmental Post Offces (EDBOs) to full time post offces by reallocating the existing post
offces which do not fulfll the distance norms. During 2010-11, 6 Post Offces are opened in this manner
and the process is continuing in the current fnancial year. In 2010-11 speed post hubs has been increased
in Thiruvananthapuram, Ernakulam and Kozhikode. An exercise has also been taken at the national level
to revamp the mail network. As part of this initiative , in Kerala 14 speed post processing centres have been
consolidated under 6 national hubs and the entire speed post mail routing and processing streamlined to
enable technology induction for purpose of monitoring, and to increase assuredness in the quality service.
11.128 As part of the initiative to induct technology in to the network, 1436 Departmental post offces have
been computerized by March 2011 and remaining 70 will be covered by the end of the current year. As part
of the E- service, the department has introduced e-post service which enables the customers to send a
communication speedily to the destination avoiding physical transmission but retaining the last mile reach
through the postman. During the reporting year the department has introduced the corporate e-post with
the offce of the Honble Chief Minister of Kerala being the frst customer for this service in the country.
Today majority of the Ministers in Kerala have begun to use it to acknowledge all the petitions that they
receive from the public
11.129 Another important initiative that has been introduced from the point of view of customers is the track
and trace facility available for registered, insured, speed post, eMO and foreign accountable articles. This
facility can be availed through the web address the India Post at [Link] and it enables cus-
tomers to track their articles from the time of booking to the point of delivery.
11.130 Kerala is the only postal circle in the country where speed post facility is available in every post of-
fce linked to a mail offce on the same day. Facilities to book speed posts in bulk are available in the 14
National Speed Post Centers and all Head Post Offces. Many of the RMS offces in the State offer speed
post booking facility at their counters both day and night. This service is available at 14 NSPCs in the State
even in holidays.
11.131 To reduce transit delay and multiple handling while providing the facility for stage by stage tracking
of speed post articles the entire mode of processing speed post has been revamped, whereby process-
Kerala State Planning Board
307
ing is concentrated in six National Hubs functioning at Thiruvananthapuram, Thiruvalla, Kochi, Thrissur,
Kozhikode and Kannur. Track and trace facility is available from the point of booking till the point of delivery.
Today tracking details are available for 95% of articles booked and 97% of articles delivered in the circle.
11.132 World Net Express Service [WNX] has also been introduced during the last 2 years to connect
220 countries. This service is now available from 18 Post Offces and 3 RMS offces at Thiruvanantha-
puram GPO, Medical College, Manacaud, Thycaud, Kawdiar, Sasthamangalam, TVM Fort, Pattom Palace,
Kochi Head Post Offce, Thrissur, Aluva, Alappuzha, Kottayam, Thodupuzha, Kakkanadu, [Link] Ko-
chi, Kozhikode and Kannur post offces and at Thiruvananthapuram RMS, Speed Post Centre Thiruvana-
nthapuram, and at Speed Post Centre Kochi.
11.133 Through the Business Post service, total mailing solutions are made available to bulk customers.
There are 27 Business Post centers in the State located independently in places like Thiruvananthapuram,
Ernakulam and Kozhikode and in Head Post Offces in other places.
11.134 eMO ( Electronic Money Order) service was introduced in the year 2008 for remitting money to
and from addressees within the country from any computerized post offce. This service has been extended
to 1074 Post Offces s in Kerala
11.135 International Money Transfer Service [IMTS] is the facility to remit funds to India from 185 coun-
tries abroad and Kerala is the second largest market for this service within the postal system. 628 post
offces in the state provide this service. In the year 2011 this facility has been extended to 13 more post of-
fces. The introduction of an additional, alternate channel for remittance through post offces in collaboration
with Money Gram will also be implemented in the year 2011.
11.136 Express Parcel Post, a variant of the registered parcel service with the value addition of track and
trace facility and direct dispatch by train to destination with no handling enroute, is available from 43 centers
for bulk customers. In 2010-11, Retail EPP service was extended to retail customers also through all HOs
and 68 Pos and a domestic version of this service has also been introduced for the same weight slabs from
51 Head Post Offces in the State.
11.137 In Kerala Circle Savings Bank facility is available in all the 5067 Post Offces. Schemes under
SB include the Monthly Income Scheme, the Senior Citizens Savings Scheme, Time Deposit, the Public
Provident Fund, 5 Year Recurring Deposit Scheme and the 5 and 10 Year National Savings Certifcates
extended by the Ministry of Finance, Government of India. As on 31.03.2011, the Circle has nearly One
Crore live accounts.
11.138 Banking facilities in 1136 Departmental Post Offces have been computerized and by the end of the
fnancial year, this will be extended to all the Departmental Post [Link] part of a national level initiative
to promote fnancial inclusion, a special drive was organized from August 2011 to open exclusive Savings
Bank accounts by persons identifed in the Below Poverty Line [BPL] category. 1.57 lakh accounts were
opened in the State by September 2011.
11.139 Collection of contributions towards the pension for Kerala Madrasa Teachers Welfare fund: This
scheme provides for the convenient collection of contributions from Madrasa teachers through their Postal
Savings Bank accounts towards the welfare pension scheme launched by the Government of Kerala in
J une/2010.
11.140 Distribution of fnancial assistance to the benefciaries belonging to SC category for construction of
house under e-housing scheme was launched on 28/1/2011. Under this scheme, the fnancial assistance
for house construction is distributed through the post offce savings bank account of the benefciaries.
11.141 The New Pension System (NPS) initially introduced by Union Government for its new recruits,
except Defence forces, from 1st J anuary 2004 was subsequently extended to the general public w.e.f.
01.04.2009. Department of Posts is a point of presence for the scheme, and all Head Post Offces under-
take the registration and collection of contributions for it under e-Payment. In Kerala all the 51 Head Post
Offces provide the NPS facility for any customer w.e.f. 30.04.2010.
Economic Review 2011
308
11.143 India Post is one of the Registrars for the enrolment for the issue of UID- Aadhaar. Post Offce Aad-
haar enrolment was launched in Kerala on 04.07.2011 by Sri. Oommen Chandy, Honble Chief Minister
of Kerala who distributed the frst fve PO-Aadhaar enrolment receipts on that occasion. So far 56 such
stations have been set up. It is proposed to extend this facility to more post offces assessing the public
demand for this facility.
11.144 Category wise offces in postal and other postal services in Kerala is given in Appendix 11.30 Divi-
sion wise and category wise post offces under Kerala circle is given in Appendix 11.31. Urban / Rural split
of post offces as on 31.03.11 is given in Appendix 11.32. District wise details of area and population served
by one post offce during 2009-10 are given in Appendix 11.33.
Bharat Sanchar Nigam Limited (BSNL)
11.145. Kerala Telecom circle serves the whole of Kerala State, the Union Territory of Lakshadweep and
part of Union Territory of Pondicherry (Mahe). The Circle has 11 major SSAs and one minor SSA of
Lakshadweep. Out of 11 major Secondary Switching Areas, 4 (at Trivandrum, Ernakulam, Kottayam and
Trichur) are headed by Principal General Managers and 7 are headed by General Managers. Lakshad-
weep minor SSA is headed by a Telecom District Manager.
11.146 Kerala has an impressive record of performance in Telecom Sector. It was in this State that all
the telephone exchanges were made automatic for the frst time in the whole country, way back in 1990.
In 1992, we become the frst state to provide Public Telephone facilities in all panchayat Head Quarters.
Kerala is also the frst State to provide public telephone in every village, by 1995. Again it has the unique
status of providing STD facility to all telephone exchanges.
11.147 There are 573683 internet customers and 739606 Broadband customers available in the circle as
on 30.09.2011. Public Grievance Cell is working at Circle level with 12727 and District Level with 12728
other than computerized 198 fault repair services. Call Centre with 1500 is fully functioning for Kerala. Call
Centre for Mobile service is 9447024365. Internet helpline is also working at 12678 for Kerala Circle.
Achievements during 2010-11 are :
144210 new Wireless connections and 1823535 Mobile connections
have been provided.
113303 3G connections provided.
1391.312 RKM OF cable laid.
5440 Internet connections provided.
200420 Broadband connections provided.
3098 WiMax connections provided
Broadband service is On demand in almost all exchanges
About 1000 broadband connections have been provided in colleges under NME
(National Mission for Education) project.
3500 combined VPN connections provided to Forest Department
BB connectivity to 1236 Akshaya Centres are provided
BB Kiosks have been provided at 191 locations under USOF
About 4300 broadband connections have been provided in schools under
IT at school project.
Urban Development
11.148 Urbanization is a global economical phenomenon. It is an index of transformation from traditional
rural economies to modern industrial one. It is a long term process. Urbanization is the physical growth of
urban areas as a result of global changes. Urbanization may be used to mean migration of people from
rural to urban areas for several reasons. Urbanization is closely linked to modernization, industrialization
Kerala State Planning Board
309
and the sociological process of rationalization. In fact all the developed countries in the world are generally
urbanized. Growth of population is more prevalent in urban areas and it provided better economic opportu-
nities. Urbanization in India has occurred more slowly than in other developing countries and the proportion
of population in urban areas has been only 28 per cent based on the 2001 census. The pace of urbaniza-
tion is now set to accelerate as the country sets to a more rapid growth.
11.149 The trend of urbanization in the state of Kerala shows marked peculiarities. Generally, increase
in the growth rate of urban population is the result of over concentration in the existing cities especially in
metropolitan cities. But in Kerala, the main reason for the growth of urban population is the increase in the
number of urban areas and also urbanization of the peripheral areas of the existing major urban centers.
With high population densities and the composite primary and tertiary occupational structure in the rural
area, the urban characteristics are present even in the rural areas.
11.150 The urban sector of Kerala consists of 5 Municipal Corporations and 60 Municipalities . More than
one fourth of the total population of Kerala live in urban areas (25.96%) and this is little less than the na-
tional average. Compared to other states the urban- rural system in Kerala have many distinct and peculiar
characteristics. The urbanization in Kerala is not limited to the designated cities and towns. Barring a few
panchayats in the Hilly tracks and a few isolated areas here and there, the entire state depicts the picture
of an urban-rural continuum. In Kerala, it is very diffcult to demarcate the urban and rural areas since the
features in rural and urban areas are almost alike. Urbanization trend in the state shows slow progress and
it is presented in Table-11.5
Table - 11.5
Trends in Urbanization of Kerala 1901-2011 (2011 Census Provisional Figures)
Sl.
No.
Census
Year
Total
number
of Urban
Towns
Total
Popula-
tion
(in crores)
Total
Urban
Popula-
tion
(in
crores)
Percent-
age of
Urban
Population
Decennial
growth
(%)
(1) (2) (3) (4) (5) (6) (7)
1 1901 21(9) 0.64 0.04 7.11
2 1911 27(14) 0.71 0.05 7.34 +15.44
3 1921 44(23) 0.78 0.07 8.73 +29.78
4 1931 53(23) 0.95 0.09 9.64 +34.58
5 1941 62(23) 1.10 0.12 10.84 +30.47
6 1951 94(25) 1.35 0.18 13.48 +52.72
7 1961 92(30) 1.69 0.25 15.11 +39.89
8 1971 88(32) 2.13 0.35 16.24 +35.72
9 1981 106(48) 2.55 0.48 18.74 +37.64
10 1991 197(65) 2.91 0.77 26.39 +60.97
11 2001 159(60) 3.18 0.83 25.96 +7.64
12 2011 520 3.34 1.59 47.72 +92.72
Source: Census 2001 and 2011 provisional fgures Government of India, New Delhi
Note: Number of statutory towns are given within brackets
11.151 This table shows that the number of urban agglomerations /towns has increased over the period
from 1901 to 2001, but the change from 1991 to 2001 is only marginal. There were 197 census urban
Economic Review 2011
310
towns (65 statutory towns and 132 census towns) in the state in 1991 which decreased to 159 (60 statu-
tory towns and 99 census towns) in 2001. The urban content of the total population of the state has been
18.74% in 1981, 26.4% in 1991 (76.76 lakhs) and 26% in 2001. There are 19 Urban Agglomeration in the
State of Kerala, as per 2011 census, which are continuous urban spreads constituting a town and its adjoin-
ing urban out-growths, or two or more physically contiguous towns together and any adjoining urban out-
growths of such towns. Ottappalam (UA), Chalakkudy (UA), Kothamangalam (UA), Changanassery (UA)
and Kayamkulam (UA) are the fve new Urban Agglomerations for 2011 census. The Urban Agglomeration
of Vadakara (UA), 2001 census has been merged with Kozhikode (UA) for 2011 census. Similarly Kodun-
gallur (UA) and Guruvayoor (UA) are merged with Thrissur (UA) for 2011 census.
11.152 The population of Kerala has increased from 64 lakh in 1901 to 318 lakh in 2001. This growth
marks an increase of 10.93 per cent during 1901 to 1911 and 9.28 percent during 1991 to 2001. As per
provisional census fgures of 2011 the increase in population during the period from 2001 to 2011 is only
5.03% which shows that the rate of growth of population is decreasing. The density of population was 747
persons per sq km in 1991, which increased to 819 persons per sq km in 2001. The density of population
varies from the coastal plains to the highland regions, the highest in the coastal land and the lowest in the
highland. The share of urban population in Kerala recorded steady growth from 7.11% in 1901 to 26.39%
in 1991, but then declined to 25.96% in 2001. But during the last decade the urban population recorded
a sharp growth from 25.96% to 47.72% of the population according to provisional census fgures of 2011.
11.153 In Kerala, urban content has been increasing from 7.11% in 1901 to 26.39% in 1991, but a slight
decline seen in the decade 1991 to 2001. This is partially due to the declassifcation of Pandalam, Pira-
vom, Koothattukulam and Mannarkad municipalities during 1991-2001. The declassifcation of Eloor and
Earattupetta municipalities has not affected urbanization due to classifcation of the area contained in these
municipalities as census towns in 2001 census.
11.154 Declassifcation of a few census towns in 2001 as rural has also contributed to the lower proportion
of urban population in the state. Among the districts, the percentage of urbanization has varied from 3.8%
in Wayanad to 50.4% in Kannur. Ernakulam district follows Kannur with 47.6% urban population. In six
Kerala State Planning Board
311
districts of Kannur, Ernakulam, Kozhikode, Thiruvananthapuram, Alappuzha and Thrissur, the percentage
of urban population is higher than the state average. In three districts namely Wayanad, Malappuram and
Idukki, the urban population is 10% or less.
11.155 In Kerala the population has got settled all along the transportation routes in non-nucleated settle-
ments with the conjuration points wherever community facilities such as schools, administration and market
centers etc. have been created. The geographical features, availability of subsoil water, climatic factors,
easy access to transportation corridors and the socio-economic factors etc. have contributed to the de-
velopment of a dispersed settlement pattern spread all over the State. The effectiveness of investments
in infrastructure development and social services is considerably reduced since the scarce resources are
spread too thinly throughout Kerala and the accruing beneft is only marginal.
11.156 It is seen that more urban centres are concentrated along the main transportation routes with
about 75% by the side of National Highway or the railway line. The average distance between these urban
centres is about 15 Km. The settlement pattern is characterized by scattered settlements of varying sizes.
The overall development presents a rural urban continuum or rurban character. This has led to the devel-
opment of evenly spaced urban centres. Due to the nearness of the urban centres and the easy availability
of infrastructure facilities even in rural areas, there is practically no push factor to urban areas from rural
areas. The fast urbanization trend noticed in Kerala is not due to the rural to urban migration, but rather due
to the transformation of the rural areas due to occupational shift.
Urban Slum Population
11.157 Depending upon the socio-economic conditions or local perceptions prevailing in the society of
Kerala the nature and concept of slums and its defnition vary considerably across the state. There are
regional differences in the names of slums but physical characteristics in most of these are essentially
the same. As per 2001 census, a total of 425.8 lakh population live in slums of 640 cities/towns across
26 states and union territories, which constitutes 4% of the total population of the country. In terms of per-
centage of slum population to the total population of cities/towns having reported slums, Meghalaya has
the highest proportion of slum population (65%) followed by Maharashtra (33.3%) and Andhra Pradesh
(32.2%). Kerala has the lowest proportion of slum population (2%) as compared to the total population of
13 cities/towns having reported slums.
11.158 The slum population constitutes nearly 15% of the total urban population of the country. Among
the states, Maharashtra has the highest proportion of slum population (27.3%) followed by Andhra Pradesh
(24.9%) and Haryana(23.2%). Kerala has the lowest percentage of slum population in the urban area
(0.8%) while Goa (2.2%) and Assam (2.4%) have also a very low proportion of slum population. The details
of slum population as compared to the urban population of Kerala are given in Table 11.6 and the details of
slum population of Kerala are given in Appendix 11.34.
Table - 11.6
Details of slum population as compared to the urban population in Kerala 2001
[Link] Items Urban Population
(2001 census)
Slum Population (2001
census fgures)
(1) (2) (3) (4)
1 Total Population (Nos.) 8266925 64556
Male 4017332 31699
Female 4249593 32857
2 Child (0-6) Population 935460 8645
3 Sex Ratio (000 Males) 1058 1037
4 Child (0-6) Sex Ratio 958 935
5 Literacy rate 93.2 83.9
Source: Census of India fgures.
Economic Review 2011
312
Urbanization Policy for Kerala
11.159 Urbanization is an important aspect in the process of economic and social development and
is associated with many problems such as migration from villages to towns, relative cost of providing
economic and social services in the towns of varying sizes, provision of housing for different sections
of the people, provision of facilities like water supply, sanitation, transport and power, pattern of eco-
nomic development, location and dispersal of industries, civic administration etc. The main objective
of Urban Development Policy as envisaged by the National Commission on Urbanization included the
following:
i) Saving the super-metros and national cities and also reviving their economies
ii) Development of fast growing intermediary level urban centres by ensuring fnancial invest-
ment for maintaining the existing infrastructure and augmenting it to a level wherein there will be
more effcient urban entities and
iii) Development of stagnating towns by providing gainful employment opportunities
11.160 In Kerala situation, the development of tertiary sector is the main cause of urbanization. It is not
the outcome of accelerated industrialization and urbanization, as seen in Tamil Nadu, Maharashtra,
Andhra Pradesh and Karnataka. Kannur district, with an urban population of 50.4% is ranked frst in urban
content, but 11th in per capita income. This is mainly due to the prevalence of low-income generating
small-scale industries. Ernakulam District with an urban content of 47.6 % ranked second in urban
content and frst in per capita income. This is due to production specialization in industrial activities
and port induced service sector development. Idukki district though ranks 13th in urban content, is
second in per capita income. This is the outcome of production specialization in plantation crops.
Urban Development Strategy
11.161 The National Commission on Urbanization suggested that urbanization strategy should be a part
of the major strategy of generating economic growth. Urbanization and Economic Development have long
been recognized as concomitant factors. The State Government also accept the special economics inter-
related to urban development. The State Urban development Strategy prepared in 1996 states that the
frst priority in the strategy for urban development shall be given for Kochi Urban Agglomeration. Second
priority is for Thiruvananthapuram Urban Agglomeration and the third for Kozhikode Urban Agglomeration.
Major parameters considered in evolving the State Urban Development Strategy were:
Density of population
Functional linkage with parent settlement
Functional dependency of the surrounding panchayats
Corridor development along major arterial roads
Transportation and land use
Functional category of town in the region
Urban Development Programmes
11.162 The major Urban Development Programmes implemented at the state level are given below.
1. Urban Infrastructure Development Scheme for Small and Medium Towns (UIDSSMT)
10.163 The Urban Infrastructure Development Scheme for Small and Medium Towns (UIDSSMT) is a
centrally sponsored scheme launched by GOI during the year 2005-06 to improve the infrastructure in
small and medium towns in the country in a planned manner. The scheme is for a period of seven years. In
Kerala, 61 urban local bodies (excluding Thiruvananthapuram and Kochi Corporations, Thrippunithura and
Kalamasseri Municipalities) are eligible for getting fnancial assistance under the scheme. The objectives
of this Scheme are:
Improving infrastructural facilities and helping in the creation of durable public assets in small
and medium towns having potential to emerge as regional centres of economic growth and employ-
Kerala State Planning Board
313
ment, thereby reducing the inclination of the people belonging to rural and smaller urban areas to
migrate to bigger cities and towns for jobs or settlement.
Decentralising economic growth and employment opportunities and promoting dispersed urban-
ization while taking due advantage of the functional interlinkages between villages, towns and cities
through a regional planning approach.
Increasing the availability of sites for housing, commercial and industrial uses and promoting the
principles of planned and orderly spatial development.
Integrating spatial and socio-economic planning as envisaged in the Constitution (74th Amend-
ment) Act, 1992 and preparing and implementing Town/City Development Plans.
Promoting resource-generating schemes for the urban local bodies to improve their overall fnan-
cial position and ability to undertake long-term infrastructure development programmes on their
own as well as to repay the borrowed capital and usher in necessary municipal reforms.
Enhance Public-Private partnership in Infrastructural Developments and promote planned inte-
grated development of towns and cities.
11.164 The funding pattern is 80:20 shared by the central and state governments. The State Share
(20%) would be equally shared (ie.10% each) by state government and the participating urban local
self governments. Details of projects approved under UIDSSMT are given in Table-11.7.
Table -11.7
Details of projects sanctioned under UIDSSMT
[Link] Name of Towns Component Approved Cost
2006-07
1 Attingal
Solid Waste
Management
306.00
2 Punalur 482.00
3 Neyyattinkara 349.00
4 Changanacherry 390.00
5 Pathanamthitta 380.00
6 Perinthalmanna 522.00
7 Payyannur Water Supply 4019.00
8 Alappuzha 9194.00
9 Chalakkudy Sewerage 4978.00
2007-08
1 Koilandy
Solid Waste
Management
208.00
2 Alappuzha 423.00
3 Nedumangad 229.00
4 North Paravoor 183.00
5 Aluva 185.00
Economic Review 2011
314
[Link] Name of Towns Component Approved Cost
6 Guruvayoor
Water Supply
3144.33
7 Chavakkadu 1900.67
8 Thalasserry 4120.00
9 Vadakara 2291.75
10 Kalpatta 3217.00
11 Perinthalmanna 811.00
12 Chittur-Thathamangalam 650.00
13 Changanacherry 391.90
14 Thiruvalla 627.90
15 Ottappalam 1800.00
16 Malappuram 1976.00
Source: KSUDP
2. Capital Region Development Project
11.165 The Capital Region Development Project (CRDP) was introduced in 2002 to improve the
quality of life of people in the capital city by strengthening and improving the critical infrastructures
like roads, water supply, solid waste management, surface water drainage, city beautifcation and bus
terminals. Details of projects under taken by Capital Region Development Programme are given in
Appendix.11.35
3. Development Authorities
(i) Thiruvananthapuram Development Authority (TRIDA)
11.166 Thiruvananthapuram Development Authority (TRIDA) was constituted for the implementation
of planned and scientifc development for Thiruvananthapuram city and adjoining areas. The jurisdic-
tion of TRIDA extends to Thiruvananthapuram Corporation and 10 grama panchayaths covering an
area of 293.65 square kms. TRIDA has been appointed as the nodal agency for the land acquisition
related works as a part of the Capital Region Development Programme. Under this programme, 12
roads totaling to a distance of 42.6 Km have been taken up for improvements. The land acquisition of
the project, widening of roads, has been completed and the land was handed over to the Kerala Road
Fund Board (KRFB) for road widening works. The construction of a fyover at Bakery Junction was
completed. Details of major projects under taken by TRIDA are given in Appendix 11.36
(ii) Greater Cochin Development Authority (GCDA)
11.167 Greater Cochin Development Authority (GCDA) is an autonomous body constituted under
the Local Self Government Department of the Government of Kerala. The GCDA aims at formulating
and implementing various urban development schemes and projects for the welfare of the general
public in the area coming under its jurisdiction. The jurisdiction of this authority covers an area of 732
[Link] consisting of Cochin Corporation, 9 Municipalities and 29 Panchayaths. GCDA activities are
generally non-remunerative and welfare oriented public utility services benefting the urban residents
and neighbouring population. The details of major programmes under taken by GCDA are given in
Appendix 11.37
4. Kerala Sustainable Urban Development Project (KSUDP) (EAP)
11.168 The Kerala Sustainable Urban Development Project is an externally aided project funded by
the ADB for addressing the challenges thrown up by urbanistion. KSUDP involve the improvements,
Kerala State Planning Board
315
upgradation and expansion of existing urban infrastructure facilities and basic urban environmental
services in fve Municipal Corporations of the state viz; Thiruvananthapuram, Kollam, Kochi, Thrissur
and Kozhikode.
11.169 Improvement of urban environment, economy and living conditions for urban people in the fve
project cities are the main objective of this project. These objectives are to be achieved by (1) improving
and expanding urban infrastructure and services (2) enhancing livelihood of urban poor and (3) improving
urban management, planning and fnancing capacity of the sector institutions especially the Municipal
Corporations for sustainable provision of urban infrastructure and services in the fve project cities.
The project components are:
Promote good governance in municipal management.
Develop and expand urban infrastructure like urban road transport, water supply, sewerage and
sanitation, strom water drainage and solid waste management.
Formulate, support programmes for improving urban social services for the elderly, destitute,
women and street children.
11.170 Details of major projects included under KSUDP are given in Appendix 11.38
5. Jawaharlal Nehru National Urban Renewal Mission (JNNURM)
11.171 Cities and towns of India constitute the worlds second largest urban system. Government
of India has approved a mission mode approach for implementation of urban infrastructure improve-
ment programme in a time bound manner in selected cities. The mission entrusted with this task is
known as the J awaharlal Nehru Urban Renewal Mission. The mission was launched in 2005 and will
continue until 2012. Corporations of Thiruvananthapuram and Kochi were selected as mission cities
from Kerala [Link] Mission objectives are:
Focused attention to integrated development of infrastructure services in the cities covered under
the Mission.
Secure effective linkages between asset creation and asset management so that the infrastru-
cture and services created in the cities are not only maintained effciently, but also become self-
sustaining over time.
Ensure adequate investment of funds to fulfll defciencies in the urban infrastructure services.
To take up urban renewal programme, ie. Redevelopment of inner city areas to reduce
congestion.
For providing basic service to urban poor.
11.172 Admissible components included in the mission are redevelopment of inner city areas, wa-
ter supply and sanitation, sewerage and solid waste management, construction and improvement
of drains/storm water drains, urban transport including roads, highways/expressways/MRTS/metro
projects, parking lots/spaces on Public Private Partnership basis, development of heritage areas, pre-
vention and rehabilitation of soil erosion/landslides only in case of special category states where such
problems are common and preservation of water bodies. Details of projects approved for implementa-
tion under J NNURM are given in Table 11.8
Table - 11.8
Projects approved for implementation under JNNURM
(` in lakh)
[Link] Name of project Approved cost
Thiruvananthapuram
1 Improvement of Water Supply Scheme 8716.00
2 Improvements to Sewerage Scheme 21541.00
3 Improvements to Sewerage Scheme Phase II 12115.00
Economic Review 2011
316
[Link] Name of project Approved cost
4 Strom Water Drainage 4039.00
5 Solid Waste Management 2456.00
6 Purchase of Buses 5340.00
Sub Total 54207.00
Kochi
7 Improvements of Water Supply Scheme 20117.00
8 Improvements to Sewerage Scheme 7841.00
9 Upgrading Surface Water Drainage 978.00
10 Solid Waste management 8812.00
11 Purchase of Buses 7100.00
12 Traffc& Transportation 10964.00
13 E-Governance 870.50
14 Broadway and Ernakulam Market Heritage and Urban
Renewal Project
2210.00
Sub Total 58892.50
Total 113099.50
Source: KSUDP
6. Ayyankali Urban Employment Guarantee Scheme
11.173 Ayyankali Urban Employment Guarantee Scheme proposed during 2009-10 in the state is
considered as a unique initiative in the State. It is intended to address the unemployment and under-
employment problems in the urban society. The objective of the scheme is to enhance livelihood secu-
rity in urban areas by providing at least 100 days of guaranteed wage employment to every household
whose adult members are willing to do unskilled manual labour. Creation of durable community assets
and strengthening the livelihood resource base of the urban poor is also envisaged in the scheme.
The scheme is structured in the pattern of Mahathma Gandhi National Rural Employment Guarantee
Scheme. While providing employment, priority shall be given to women in such a way that at least 50%
of the benefciaries shall be women who have registered and requested for work under the scheme.
Kerala State Planning Board
Education
C
H
A
P
T
E
R
320
Kerala State Planning Board
321
Education in the present day context is perhaps the single most important means for indi-
viduals to improve personal endowments, build capacity levels, overcome constrain, and in the
process enlarge their available set of opportunities and choices for a sustained improvement
in wellbeing. It is not only a means to enhance human capital, productivity and hence, com-
pensation to labour, but it is equally importance for enabling the process of acquisition, as-
similation and communication of information and knowledge, all of which augments a persons
quality of life. Education is important not merely as means to other ends, but it is an attribute
that is valued in itself, by most individuals. The education system has achieved the objective
of providing access, but we need to take determined steps to align the overall system to the
national system, requiring some structural changes.
12.2 Public spending on education has been more or less equitably distributed between the
sexes and among different social groups and regions in the state. The state is making con-
certed efforts in sustaining the achievements in the elementary education sector and improv-
ing the quality of secondary, higher, technical education and research.
Literacy
12.3 Literacy is a basic step towards education, which is a process of life learning and an entry
point to the world of communication and information. Traditionally literacy has been commonly
defned as the ability to read and write at an adequate level of profciency that is necessary for
communication. More recently however, literacy has taken on several meanings.
12.4 As literacy development is concerned; Kerala has the distinction of being a historic state
in India so far. Keralas literacy rate is comparable to the most advanced regions of the world.
Keralas literacy rate which was only 47.18% in 1951 has almost doubled to 93.91% in 2011.
The male, female literacy gap which was 21.92% in 1951 has narrowed down to 4.04% in 2011.
Keralas literacy rate from 1951-2011 is given in Appendix.12.1.
12.5 District wise analysis of Keralas literacy rate according to 2011 census shows that
Pathanamthitta district (96.93) has the highest literacy rate in the state followed by Kottayam
(96.40) and Alappuzha(96.26) districts. Palakkad district has the lowest literacy rate in the state
(88.49). Literacy rate by sex for districts in 2001 and 2011 census are given in Appendix 12.2.
12.6 Kerala State Literacy Mission is implementing the literacy and equivalency programmes
by appointing Preraks. 31472 people were newly literated during 2010-11 of which 21012 are
women literates.52838 people were benifted in the equivalency programme in 2010-11. In the
7th batch class IV equivalency programme 27608 people have registered and 12324 partici-
Education
Economic Review 2011
322
pated in the examination and 10592 people passed in the examination. Details of the number
of people benefted from Equivalency programme of Literacy Mission from 2001-02 to 2010-11
are given in Appendix 12.3.
Right to Education Act
12.7 From April 1, 2010 the Right to Education has come into force ensuring free education to
more than 92 lakh out-of-school children in India. This Act gives every child the right to a qual-
ity elementary education. The main features of the Act are summarized in box 12.1
BOX 12.1
The Right of Children to Free and Compulsory Education
All children aged 6-14 shall have the right to free and compulsory education at
a neighbourhood school.
No direct (school fees) or indirect cost on uniforms, textbooks, mid-day meals,
transportation etc need to be borne by the child or parents to obtain elementary
education.
The govt will provide schooling free of cost until the childs elementary
education is completed.
All schools must comply with certain infrastructure and teacher norms. Two
trained teachers will be provided for every 60 students at the primary level.
Schools shall constitute School Management Committees comprising local
offcials, parents, guardians and teachers. The SMCs will monitor utilization
of govt grants and the school environment.
RTE mandates inclusion of 50% women and parents of children from
disadvantaged groups in SMCs.
12.8 Teachers will be at the core of implementation of RTE that seeks to work towards a het-
erogeneous and democratic class room where all children participate as equal partners. To en-
sure 25% reservation for children from disadvantaged and weaker sections schools will have
to disclose the lists of children taken in this category and ensure that diversity is maintained
.The state governments will undertake household school mapping to ensure that all children
are sent to school. State governments and local bodies will have to establish primary schools
within one km of the neighbourhood. For the children of Class VI to VIII the school should be
within 3 km of the neighbourhood. In the absence of a school in small hamlets the state govern-
ment shall make adequate arrangement like free transportation and residential facilities.
School Education
12.9 There were 12644 schools in Kerala during 2010-11. Out of these 4504 were government
schools, 7277 aided schools and 863 unaided schools. In the state, during 2010-11, 57.55% of
total schools were aided schools, 35.62% government schools and 6.83% unaided schools.
Compared to government upper primary and high schools more number of LP schools are
functioning under government sector. Aided schools outnumber government schools in all
sections.
12.10 Malappuram District has the largest number of schools (1472nos) in the state followed by
Kannur (1293nos) and Kozhikode Districts (1237nos). Malappuram District has also the larg-
Kerala State Planning Board
323
est number of government ( 543 nos) and unaided schools (145 nos) in the state. But largest
number of aided schools is functioning in Kannur district (967 nos). Details of district-wise,
management wise and stage-wise number of schools in Kerala during 2010-11 are given in Ap-
pendix 12.4. Stage-wise and District wise number of schools in the state in 2010-11 is given in
Table 12.1&12.2.
Table 12.1
Stage wise number of schools -2010-11
High
schools
UP schools LP schools Total
Government 1066 899 2539 4504
Private Aided 1429 1870 3978 7277
Unaided 379 217 267 863
Total 2874 2986 6784 12644
Source: Directorate of Public Instructions
Table 12.2
District-wise number of Schools in Kerala:2010-11
Sl. No District No of schools
1 2 3
1 Thiruvananthapuram 989
2 Kollam 927
3 Pathanamthitta 736
4 Alappuzha 763
5 Kottayam 911
6 Idukki 478
7 Ernakulam 1011
8 Thrissur 1009
9 Palakkad 972
10 Malappuram 1472
11 Kozhikode 1237
12 Wayanad 292
13 Kannur 1293
14 Kasargod 554
Total 12644
Source : Directorate of Public Instructions
12.11 946 schools in the state are offering syllabus other than the one prescribed by the state
government. These include 797 CBSE schools, 108 ICSE schools, 27 Kendriya Vidhyalaya and
14 Jawahar Navodayas. Compared to 2009-10, 33 CBSE schools have newly started function-
ing during 2010-11. One Jawahar Navodaya Vidhyalaya each is functioning in all the districts.
District-wise details of schools with syllabus other than state syllabus in the year 2010-11 are
given in Appendix 12.5.
Economic Review 2011
324
Physical infrastructure and facilities in Government Schools
12.12 Most of Government Schools in Kerala are functioning in pucca buildings. All L.P gov-
ernment schools in the state are functioning in pucca buildings. There is no LP/UP school
having thatched sheds in 2011 in the state. Six high schools are in thatched and they are situ-
ated in Thiruvananthapuram District. Own buildings have to be constructed for 167 govern-
ment schools which are now working in rented buildings. District-wise details of government
schools having building facilities are given in
12.13 Local Self Government Institutions and programmes like SSA have contributed much
to the overall development and improvement of physical infrastructure and common facilities
in government schools in the state. Data available in 2011 shows that 98.40% of government
schools have access to drinking water and 99.49% of government schools in the state have
urinals/latrine facilities. District wise details of government schools having drinking water/
latrines/urinal facilities in Kerala in 2011 are given in Appendix 12.7.
Enrolment of Students
12.14 Enrolment of students in the state has been showing a slight decline in the recent years.
In 2008-09, 45.46 lakh students were enrolled in schools in the state. In 2009-10 this has got re-
duced to 44.58 lakh students and during 2010-11 it has further reduced to 43.51 lakh students.
Enrolment of students in 2011-12 has again reduced to 42.35 lakh and has decreased 2.67%
over the previous year. Change in demographic pattern of the state due to low birth rate is the
main reason attributed for this phenomenon. The decline of students in LP section has 73925
numbers in 2011-12 from 2010-11. While the decline in UP section is 32888 numbers 2011-12,
and in the high school section shows a decrease of enrolment of 9552 students over the
previous year. The stage-wise enrolment of students in schools in Kerala from 2007-08 to
2011-12 are given in Table12.3.
Table-12.3
Enrolment of Students in Schools in Kerala stage-wise 2008-09 to 2011-12 (`. in lakhs)
Year LPS UPS HS TOTAL
2008-09 16.66 14.53 14.27 45.46
2009-10 15.91 14.24 14.43 44.58
2010-11 15.04 13.93 14.54 43.51
2011-12 14.30 13.59 14.45 42.35
Source: Directorate of Public Instructions
12.15 In 2010-11 enrolment of students in lower primary, upper primary and high school sections are 33.77%, 32.09% and
34.12% respectively. 29.86% of total students are studying in Government schools. 61.33% of students are enrolled in
aided schools and the remaining 8.81% in unaided schools. Details of management-wise and standard wise enrolment of
students in schools in Kerala during 2011-12 are given in Appendix 12.8. District-wise and stage-wise enrolment of students
in schools in the state during 2011-12 is given in Appendix 12.9.
Enrolment of Girl students
12.16 Girl students constitute 49.26% of the total student enrolment in schools. Boys outnumbered girl students in all the
districts except Thiruvananthapuram. Generally, in Kerala there is a more or less uniform pattern in the enrolment of girl
students across districts.
SC/ST Enrolment
12.17 As per the fgures of 2011-12, SC students constitute 11.04% of total students in the state. The percentage of SC students,
government schools, private aided schools and private unaided schools are 13.82%, 10.73% and 3.73% respectively.
Kerala State Planning Board
325
12.18 ST students constitute 1.86% of total enrolment in schools in the year 2011-12. The percentage of ST students in gov-
ernment schools, private aided schools and private unaided schools are 3.37%, 1.33% and 0.37% respectively in 2011-12.
The standard-wise strength of SC/ST students in the state in 2011-12is given in Appendix 12.10.
Drop-out rate
12.19 Kerala has achieved the distinction of having the lowest dropout rate of school students among the Indian states. In
the year 2009-10 dropout ratio among school students in Kerala was 0.51%. The drop-out ratio in Lower Primary Section,
Upper Primary Section and High School Section were 0.38%, 0.32% and 0.85% respectively.
12.20 Among the Districts, Wayanad has the highest drop out ratio in the lower primary section (0.88%), upper primary
section (0.94%) and high school section (1.64%). District-wise/stage-wise dropout ratio in schools in 2009-10 is given in
Appendix 12.11. Drop-out ratio among SC students in Kerala as per the fgures of 2009-10 was 0.58% and that of ST stu-
dents was 2.33%. Standard wise details of drop out among SC and ST students in Kerala for the year 2009-10 are given in
Appendices 12.12 and 12.13.
Number of Teachers
12.21 The number of school teachers in Kerala including TTI teachers during 2010-11 was 168062. Out of this 101965
teachers are working in aided schools and 13692 teachers working in private unaided schools. This means that 68.81% of
total teachers in the state are working in private management schools. The remaining 31.19% of teachers are working in
government schools.
12.22 50.49% of total teachers in the state are teaching in high schools, 25.65% in upper primary schools, 23.40% in lower
primary schools and the remaining 0.46% in TTIs. 71.48% of total teachers in the state are women. The teacher pupil ratio
during 2010-11 works out to be around 1:26. Stage-wise and management-wise number of teachers in Kerala during 2010-
11 is given in Appendix 12.14.
Protected Teachers
12.23 There are 2957 protected teachers in Kerala during 2010-11. Out of this 1282 teachers are deployed in Government
schools, 826 are retained in parent school and 412 are deployed in other aided schools. The remaining 437 protected
teachers are undeployed. Kozhikode district ( 482 nos) has the largest number of protected teachers in the state followed
by Kannur ( 480 nos) and Kollam( 382 nos) districts. The details of protected teachers in the state in 2010-11 are given in
Appendix 12.15.
12.24 Govt. have approved a teachers package for setting up of a teachers bank for managing the transition and introducing
a scientifc method of recruitment for teachers in aided sector. The bank is a temporary arrangement for retaining excess
teachers for suitable deployment to schools and ensures payment of their salary without any hindrance. The bank will also
provide the services of teachers to schools for flling up of leave vacancies.
Uneconomic Schools
12.25 There are 4280 uneconomic schools in Kerala as per the fgures of 2010-11. Out of these 2147 are government
schools and 2133 are in the aided sector. District-wise analysis shows that highest number of uneconomic schools is in
Kannur district (635nos). 23.86% of uneconomic aided schools in the state are in Kannur district. In government sector
Ernakulam district has the largest (257nos) number of uneconomic schools followed by Kottayam district (237 nos). Among
the government uneconomic schools, 76.11% are of lower primary schools. In the aided sector also 85.56% of uneconomic
schools are lower primary schools. District wise details of uneconomic schools in the state in 2010-11 are given in Appendix
12.16.
Sarva Shiksha Abhiyan
12.26The Sarva Shiksha Abhiyaan is also known as the Education for All movement or Each One Teach One. It was intro-
duced in 2000-2001 as the fagship programme run by the Government of India. This scheme is framed to provide useful
and relevant elementary education for all children in the age group of 6 to 14 by 2010 irrespective of any social, regional,
Economic Review 2011
326
economic and gender barriers, with the active participation of the community in the management schools. It encompasses
all activities of school education-providing physical infrastructure, free text book for children, encouraging enrolment of girls
and teacher training. The fund sharing between the central and the states was 75:25 in the Tenth Plan. The funding pattern
for the Eleventh Plan was modifed to 65:[Link] implementation of the programme to the real essence is extra emphasised
in the event of the constitution of the Right to education act in the country.
12.27 Major goals of SSA are
All children are enrolled in schools.
Bridging all gender and social category gaps in primary stage and at elementary education level.
Focus on elementary education of satisfactory quality with emphasis on education for life.
Universal retention by 2010
The fnancial progress of the scheme during the frst four years of the Eleventh Plan is given in table 12.4
Table-12.4
The outlay and expenditure of SSA from 2007-08 to 2010-11
Allocation and
Expenditure(Rs
in Crore)
2007-08 2008-09 2009-10 2010-11 Total(2007-11)
GOI Release 103.23 108.54 119.89 196.60 528.26
GOK(including
LSG) Release
48.20 61.43 68.81 133.66 312.10
Total Expendi-
ture
137.60 176.95 192.33 251.26 758.14
Source: Sarva Shiksha Abhiyaan
12.28 There are 159 Block Resource Centres (BRC)/URCs functioning in all districts in Kerala. On an average every BRC
has 84 schools. There are 954 Block Resource Persons approved by Government of India. More over MHRD has approved
159 computer programmers ,159 data entry operators and 159 accountants in all BRCs. SSA has a special focus on girls
education and children with special needs. About 1.22 lakh children were identifed as children with special needs. SSA also
seeks to provide computer education to bridge the digital divide. SSA is earmarking considerable amount of money for the
construction of Block Resource Centres, Cluster Resource Centres, boundary walls for the schools, drinking water facilities
in schools, construction of toilets etc. Free text books/ work books/evaluation tools are supplied to all children from standard
II-VIII. At present 1385 cluster resource centres and 793 cluster resource persons were approved by GOI.
Higher Secondary Education
12.29 Education after the frst 10 years was a part of the higher education system for many decades. Higher Secondary
courses were introduced in the state during 1990-91 to reorganize the secondary level of education in accordance with
National Education Policy. Higher Secondary Course is the turning point in the entire school education in our state. The
department serves as a professional institution in formulating and maintaining the standards of Higher Secondary Education
and in providing need based timely, scientifc, effective and sustainable services to the students and teachers at the Higher
Secondary level.
12.30 1907 Higher Secondary schools were there in 2011 in the state. Out of these 760 (39.86%) are Government schools,
686 (35.97%) are Aided schools and the remaining 461 (24.17%) are Unaided schools. Among the districts Malappuram has
the largest number of Higher Secondary schools (233 nos) in the state followed by Thrissur (190 nos) and Ernakulam (179
nos) districts respectively.
12.31 There are 6449 batches for higher secondary courses in 2011. The total number of sanctioned seat in 1907 Higher
Secondary Schools was 361440. Malappuram district had the largest no of batches (904nos) with an enrolment capacity of
44834 students. District wise/Management-wise number of higher secondary schools and number of batches are given in
Appendix-12.17.
12.32. 323560 students are admitted to the higher secondary schools in the state during the year 2010-11. Out of these
Kerala State Planning Board
327
150231 (46.43%) are studying in government schools, 143665(44.40%) students are studying in aided schools and the
remaining 29664(9.17%) are studying in unaided schools. District wise enrolments of students in higher secondary schools
are given in Appendix 12.18.
12.33 The pass percentage of students in higher secondary courses has increased to 82.25% in 2010-11 from 74.93% in
[Link] pass percentage of SC and ST students in Higher Secondary schools also increased in 2010-11 compared to
2009-10. During 2011, 2821 students got A+ for all subjects and 227112 students were eligible for higher studies. The de-
tails are given in Appendices 12.19 & 12.20. . The pass percentage of SC students also increased from 50.80% to 60.46%
and ST students from 41.16% to 52.31% during 2010-11. Details are given in Appendices 12.21 and 12.22
Vocational Higher Secondary Education
12.34 Vocational Higher Secondary Education was introduced in the state in 1983-84 Vocational Higher Secondary Edu-
cation in the state impart education at plus two level with the objective to achieve self/wages/direct employment as well as
vertical mobility. The course is designed to prepare skilled work force at middle level in one group or more of occupations,
trade or job after matriculation at 10+2 stage of education. 389 Vocational Higher Secondary Schools are there in the state
with a total of 1100 batches .
12.35 Out of the 389 Vocational Higher Secondary Schools 261 are in the Government sector and 128 in the Aided sector.
Kollam District( 52 nos) has the largest number of Vocational Higher Secondary Schools in the state. District wise details of
Vocational Higher Secondary Schools and courses during 2010-11 is given in Appendix.12.23.
12.36 The percentage of school going students eligible for higher education in Vocational Higher Secondary examination
in 2011 March is 77.26%, while the pass percentage in 2010 March was 75.56%. The number of students who appeared
and those who passed Vocational Higher Secondary examination from the year 2001 to 2011 and the results of school going
students are given in Appendices 12.24 & 12.25.
State Institute of Educational Management and Training
(SIEMAT)- Kerala
12.37 SIEMAT Kerala was established in July 2005. Major functions of SIEMAT include developing network of institutions
engaged in identical task and playing supportive and collaborative role, acting as a clearing house of ideas and information
on research, training and extension activities in educational planning and administration. SIEMAT undertook large number
of management development programmes and training. SIEMAT has also published many handbooks, bulletins and reports.
SIEMAT- Kerala has given 244 training programme for 9656 participants during [Link] the frst three years of the
XIth plan period 682 training programme were given to 20807 participants.
University and Higher Education
12.38 There are a total of 9 universities functioning in the state. Out of these four universities viz. Kerala, Mahatma Gandhi,
Calicut and Kannur are general in nature and are offering various courses. Sree Sankaracharya University of Sanskrit,
Cochin University of Science and Technology and Kerala Agricultural University offer specialized courses in specifed subject
areas. Besides these, the National University of Advanced Legal Studies (NUALS) established in 2005 and the Central Uni-
versity established in Kasargode district are also functioning.
12.39 The various programmes that have been included in the state plan have a signifcant impact in the overall perfor-
mances of the universities. Programmes such as the Erudite, Aspire (scholarship to researchers and PG students to under-
take short term research programmes within research institutions and universities in India), and Acquire for social science
have been implemented in the universities. The presence of Nobel laureates and other eminent academies as scholars in
residence for longer periods (up to 15 days) has a signifcant impact in the university community Several scholars have
expressed their willingness to further collaborate with the universities in this regard. The Nobel Laureate, Zhores Alferov dur-
ing his visit has signed an MOU with CUSAT as he is the Vice President of the Russian Academy of Science and President
of its [Link] Scientifc Center. Nobel Laureate Robert Huber has agreed to intervene to establish a centre of Max
Plank Institute in Kerala. Several scholars have agreed to take students from universities here as post doctoral students in
Economic Review 2011
328
their research groups. The various scholarships for fostering excellence in studies also have a signifcant impact among the
student community.
12.40 Inter University Centres within the universities in Kerala were established in 2009. These centres provide academic
support to the faculties and students of various universities and co-ordinate major projects undertaken in their respective
felds. The Inter University Centre has the objective of developing post graduate programmes in the relevant discipline and
serving as an Inter University Centre for research in the relevant discipline and strengthening the ongoing Ph.D programmes
and research activity in the concerned areas of advanced study. The establishment of the Inter University Centres has a
signifcant impact. The Inter University Centres are interdisciplinary centres for conducting cutting edge research pro-
grammes synergizing available academic expertise in the universities. Several scholars have expressed their willingness
to work in these centres (Pawan Dhar, former researcher in RIKEN University headed by Nobel Laureate Ryoji Noyori, has
joined the Inter University Centre in Bioinformatics) and the researchers of the various research institutions with in Kerala are
invited as adjunct professors in these centres. A cluster of such centres has been established in the feld of Bio Sciences.
The centres are Centre for Bio - Informatics (Kerala University), Centre for Bio Science (Kannur University), Centre for Plant
Biotechnology (Calicut University), Centre for Marine Biotechnology (CUSAT),Centre for Genomics and Gene Technology
(Kerala University) and Centre for Bio Medical Science (MG University)
Grant to Universities
12.41 The State Government provides Plan and Non plan grants to universities which are a major source of their revenue.
`313.06 crore is earmarked as grant to universities in the year 2011-12. Out of this, `246.06 crore (78.59%) is provided under
non plan head. ` 67 crore is earmarked under plan head in the year 2011-12. Kerala University has received the maximum
assistance from state government in the year 2011-12. In the current year, 17.08% increase is registered in fnancial assis-
tance to Universities over 2010-11 Revised Estimate. Details are given in Table. 12.5
Table 12.5
Plan and Non plan grant to Universities in Kerala (`. Crore)
Name of
University
2009-10 Accounts 2010-11 Revised Estimate 2011-12 Budget
Estimate
Plan Non
Plan
Total Plan Non
Plan
Total Plan Non
Plan
Total
Kerala 6.50 74.81 81.31 14.75 74.45 89.20 12.00 89.34 101.34
Calicut 6.50 49.16 55.66 8.00 54.08 62.08 10.00 64.89 74.89
Mahatma
Gandhi
9.50 28.16 37.66 8.00 30.99 38.99 10.00 37.17 47.17
Sree San-
karacharya
2.3 12.89 15.19 5.00 14.18 19.18 8.00 17.01 25.01
Kannur 5.34 6.12 11.46 12.00 9.72 21.72 12.00 8.40 20.40
Cochin
University
of Science
and Tech-
nology
(CUSAT)
14.00 22.16 36.16 10.83 24.38 35.21 12.00 29.25 41.25
National
Univer-
sity of
Advanced
Legal
Studies
0 0 0 1.00 0 1.00 3.00 0 3.00
Total 44.14 193.30 237.44 59.58 207.80 267.38 67.00 246.06 313.06
Source: Detailed Budget Estimates 2010-11, Vol .1 Government of Kerala
Kerala State Planning Board
329
Arts and Science Colleges
12.42 Including 150 Private Aided Colleges and 39 Government Colleges there are 189 Arts and Science Colleges in the
State. Ernakulam district (25nos) has the largest number of Arts and Science colleges in the state followed by Kottayam (22
nos), Thiruvananthapuram (20 nos) and Thrissur (20 nos) districts. A new Govt. Arts and Science college has started func-
tioning in Ambalapuzha, Alappuzha district with BSc. Maths, BA Economics, and [Link] during the academic year 2010-11.
Thiruvananthapuram district has the largest number of Government colleges (8 nos) in the state. District-wise number of Arts
and Science colleges in the state in 2010 is given in Appendix 12.26.
Enrolment of Students
12.43 The total number of students enrolled in various Arts and Science colleges (excluding unaided colleges) under the four
general universities in Kerala during 2010-11 is 1.82 lakh. Of this 1.27 lakh (69.78%) are girls.
12.44 Out of the total 1.65 lakh students enrolled for degree courses, 45.10% are enrolled for BA degree courses, 39.63 %
enrolled for BSc degree courses and 15.55% enrolled for [Link] degree courses. Girls constitute 69.05% of total enrolment
for degree courses. 27 subjects are offered for BA degree courses. Among the subjects, Economics has the largest number
of enrolment of students. 31 subjects are offered for BSc course and Mathematics has the largest number of student enrol-
ment. Details of enrolment of students in Arts and Science colleges for BA, BSc and [Link] are given in Appendices 12.27
to 12.29. 15601 students are admitted to post graduate course in the state in 2010-11. 79.28% of those enrolled in PG
courses are girls. Details of enrolment of students in Arts and Science colleges for MA, MSc and [Link] courses are given
in Appendiices.12.30 to 12.32.
SC, ST Students
12.45The enrolment of SC students in degree and post graduate courses is 23622 and 1716respectively. SC students con-
stitute 13.92% of total students in 2010-11. Girls constitute 65.58% of total SC students in Arts and Science colleges.
12.46 2882 Scheduled Tribe students were enrolled for courses in arts and science colleges in 2010-11. The enrolment of
ST students in degree and post graduate courses are 2528 and 354 respectively. Girls constitute 60% of total ST students
in Arts and Science colleges. Enrolment of SC and ST students in Arts and Science Colleges in Kerala during 2010-11 is
given in Appendix.12.33.
Scholarships
12.47 About 16 type of central and state sector scholarships are given to students. Various scholarships including merit cum
means scholarships (1592 nos) and post metric scholarships (59116 nos) are given during 2010-11. The Directorate of Col-
legiate Education has erected LED display board giving the details of scholarships offered by the Government of Kerala and
India. The details of number of scholarships given from 2008-09 to 2010-11 is given in Appendix 12.34
Teachers
12.48 The number of teachers in Arts and Science colleges in 2010-11 is 8880. Out of this 47.52% are women. University-
wise number of teachers in Arts and Science colleges in the year 2008-09,2009-10 and 2010-11 is given in Appendix.12.35
12.49 4285 teachers in Arts and Science colleges in the state have Ph.D degree. Details are given in Appendix 12.36. A total
of 1693 Guest Lecturers are working in Arts and Science colleges of the state in 2011. Details are given in Appendix.12.37.
Kerala State Higher Education Council
12.50 On the basis of Kerala State Higher Education Council Ordinance 2006, Kerala State Higher Education Council was
set up on 16th March 2007. The Higher Education council is responsible for providing policy advice to the Government on
Higher Education in general and on specifc issues referred to the council by the government The Council has a three tier
structure consisting of Advisory Council, Governing Council and an Executive Council. The major functions of the council
are:
Economic Review 2011
330
12.51 a) Render advice to the Government, universities and other institutions of higher education in the state.
b) Co-ordinate the roles of the Government, universities and apex regulatory agencies in higher education
within the state.
c) Initiate new concepts and programmes in higher education.
d) Provide common facilities in higher education without impinging upon the autonomy of other institutions of
higher education.
12.52 In accordance with the above mandate, Council has been undertaking activities like setting up a data bank on higher
education, framing state policy on higher education, restructuring of undergraduate education and setting up of clusters of
colleges, setting up of a higher education scholarship fund, teacher exchange programme, scholars in residence programme
and a journal for convergence studies. During 2007-08, a comprehensive database of higher education in the state was
published and its digitized version was put online for public access. During 2008-09 more elaborate data and educational
statistics were collected and compiled from 884 higher education institutions and the data are available in the Council website
in the search software EDUSEARCH
Centre for Continuing Education
12.53 Kerala State Civil Service Academy under Centre for Continuing education is offering free coaching for Civil Service
mains and interview for all Keralites who cleared the preliminary examination and mains examination respectively. The
Centre has given free coaching to all SC/ST students and BPL category students for the state level Engineering/ Medical
entrance examinations. During 2011, 86 candidates were undergoing the free coaching programme for the Civil Service main
examination.
Kerala Council for Historical Research (KCHR)
12.54 Kerala Council for Historical Research is an autonomous academic institution committed to scientifc research in His-
tory and Social Sciences. It is a recognized research centre of the University of Kerala and has academic affliations with
leading research institutions and universities inside and outside the country. Major activities which are undertaken by KCHR
in the past include creating and maintaining peoples archives of Kerala, writing local/micro histories, life histories and institu-
tional histories, archives on family histories ,biographies etc. KCHR has planned to publish a comprehensive volume on the
scientifc history of Kerala from pre-historic to the present times.
12.55 A sustainable/historical tourism project is conceived in the Kodungallur-Parur zone and KCHR is identifed as the nodal
agency to provide technical assistance. From 2006-07 onwards KCHR has successfully undertaken the multi disciplinary
excavation at Pattanam. The excavation has yielded signifcant evidences for re-conceptualizing the early history of Kerala.
12.56 Scholars in residence fellowship is a unique research support instituted by KCHR and is meant to support senior
scholars who wish to complete some of their ongoing projects.
Technical Education
12.57 Directorate of Technical Education is the nodal department for Technical Education in the state. The details of technical
institutions under the administrative and fnancial control of Directorate of Technical Education is given in Table-12.6
Table 12.6
Technical Institutions under Directorate of Technical Education-2011
Sl. No. Institutions Nos
1 Government Engineering Colleges 9
2 Private Aided Engineering Colleges 3
3 Government Polytechnic Colleges 36
4 Government Women's Polytechnic Colleges 7
5 Private Aided Polytechnics 6
Kerala State Planning Board
331
Sl. No. Institutions Nos
6 Fine Arts Colleges 3
7 Government Technical High Schools 39
8 Government Commercial Institutes 17
9 Tailoring and Garment making training centres 42
10 Vocational Training Centres 4
Total 166
Source: Directorate of Technical Education
12.58 Some of the major activities undertaken by the department during 2011 are
Implementation of DDFS system in the directorate
Quality improvement programme centres in two engineering colleges at Thiruvananthapuram and Thrissur
through which the faculty all over India has the opportunity to undergo PhD programmes in these institutions
All the engineering colleges and polytechnic under the control of directorate were provided with broad band
connectivity of512 kbps
Initiatives are taken for the upgradation of 30 polytechnics with the fnancial assistance of MHRD
Initiatives are taken for the construction of womens hostel in 31 polytechnics with the fnancial assistance
of MHRD
Engineering Colleges
12.59 There are 142engineering colleges in the state with a total sanctioned intake of 45147 in 2011. Out of these en-
gineering colleges, 128(90.14%) are self fnancing colleges, 11 (7.7%) are government colleges and 3 (2.11%) are private
aided colleges. Mahathma Gandhi University has the largest number of engineering colleges affliated to it. During 2011,
23 self fnancing engineering colleges started in the state. Comparing to 2010, the percentage of increase in the number
of engineering colleges is 19.32% and the percentage increase of sanctioned intake is 18.8%. The University wise and
Districtwise details of colleges are given in Table. 12.7&12.8
Table-12.7
University wise Engineering Colleges in Kerala 2011
Sl. No. Name of University No. of Colleges
1 Kerala University 39
2 Mahatma Gandhi University 40
3 Calicut University 33
4 Kannur University 8
5 CUSAT 20
6 Agricultural University 2
Total 142
Source: Directorate of Technical Education
Table-12.8
District wise Engineering Colleges in Kerala 2011
Sl. No Name of District No of colleges
1 2 3
1 Thiruvananthapuram 24
2 Kollam 15
3 Pathanamthitta 8
4 Alappuzha 9
Economic Review 2011
332
Sl. No Name of District No of colleges
5 Kottayam 9
6 Idukki 5
7 Ernakulam 26
8 Thrissur 15
9 Palakkad 8
10 Malappuram 7
11 Kozhikode 6
12 Wayanad 1
13 Kannur 6
14 Kasargod 3
Total 142
Source: Directorate of Technical Education
12.60 Among the 11 government engineering colleges in the state, 2 Colleges are under the control of Kerala Agricultural
University. These colleges are college of Dairy Science and Technology, Mannuthy and Kelappaji College of Agricultural
Engineering and Technology, Thavanur, Malappuram.
12.61 Ernakulam district has the largest number of engineering colleges in the state followed by Thriuvanathapuram, Kollam
and Thrissur districts with an intake capacity of 9568, 7523, 4440 and 4795 respectively. Kollam, Pathanamthitta, Alappu-
zha, Ernakulam and Kasargode districts do not have Government engineering colleges. District-wise and management wise
number of engineering colleges and sanctioned intake are given in Appendix-11.38. The sanctioned intake during 2011 of
Govt. colleges was 2894 (6.4%), aided colleges 1550 (3.43%) and unaided colleges 40703(90.16%). The sanctioned intake
of unaided colleges has increased by 21.12% during 2011compared to the previous year.
12.62 Of the engineering colleges in Kerala, the largest number of branch wise seats was in Electronics and Communica-
tion (10200) followed by Computer science (8280) and Electrical and Electronics (6900). Branch-wise distribution of
seats in engineering colleges in 2010-11 is given in Appendix. 11.39. 4564students were studying in government and aided
engineering colleges for graduate courses in the year 2011-12. Out of these 40% are girls. 906 students were studying in
government and aided engineering colleges for post graduate courses in the year 2011-12. Girl students constitute 55.3%
of total students in government and aided engineering colleges studying for post graduate courses. Details are given in Ap-
pendix 12.40&12.41.
12.63 The visiting faculty programme enables the teachers and students of the institution to share the experience and exper-
tise of the eminent faculty from premier engineering institutions. Lectures were arranged in 9 Govt. Engineering colleges as
part of this programme during 2010-11. Also 30 short term training programmes were organized in various Govt. Engineering
Colleges for the knowledge enrichment of engineering college teachers.
12.64 Under capacity development 42 training programmes were organized through various agencies for the teaching and
non- teaching staff and more than 250 staff members participated in the programme. During 2011-12, 13 faculty members
were deputed for [Link] and 26 were deputed for Ph.D programme.
12.65 More than 850 smart class rooms with all advanced teaching aids were established in all Govt. Engineering Colleges
and polytechnics. Job oriented short term courses of 2 to 10 months for SC/ST students through Engineering colleges,
polytechnics and technical high schools were conducted and 3190 students benefted through the programme.
12.66 Merit Cum Means Scholarships is given to fnancially weaker students belonging to the minority community. During
2010-11 scholarship were given to 2883 students. The central release for the scholarships was `786.29 lakhs.
Polytechnics and Technical High Schools
12.67 43 government polytechnics and 6 private aided polytechnics were functioning in Kerala during 2011. The annual
intake of students in government polytechnics and private aided polytechnics are 10378 and 1617 respectively. The total
number of students in government polytechnics during the year 2011 was 26583 and that of private aided polytechnics
Kerala State Planning Board
333
4400. The female percentage in polytechnics in 2011 has increased to 32.59% from 27.34 % in 2010. Details of annual in-
take and students strength in polytechnics from the year 2009-10 to 2011-12 are given in Appendices 12.42 & 12.43. Details
of trade-wise annual intake of students in polytechnics of the state in 2011-12 are given in Appendix 12.44 6.3% of total
students in polytechnics belong to SC community and 1.00 % belongs to ST community.
12.68 Total number of teachers working in polytechnics of the state is 1879. Women teachers constitute 27.94% of the
total teachers in polytechnics. SC/ST teachers constitute 8.41% of teachers. Details of number of students and teachers in
polytechnics are given in Appendix12.45. Number of SC/ST students and SC/ST teachers in polytechnics in the report year
are given in Appendix.12.46.
12.69 Finishing schools were established in 17 polytechnics including three womens polytechnics to make the polytechnic
pass outs competent to meet the need of the industries in the country and develop their employment schemes.
12.70 39 government technical high schools are functioning in the state. Total number of students in technical high schools
in the year 2010-11 was 7488, out of which girls share has increased to 8.03% in 2011 from 7.77% in 2010. There are 905
teachers working in technical high schools of the state. Women teachers constitute 19.90% of teachers in technical high
schools. Number of students and teachers in technical high schools from 2009-10 to 2011-12 are given in Appendix.12.47.
SC students in technical high schools accounted for 13.64% of total students. ST students in technical high schools consti-
tute 0.60% of total students. Details are given in Appendices. 12.48 and 12.49.
Institute of Human Resource Development (IHRD)
12.71 IHRD is an autonomous institution fully owned and controlled by Government of Kerala. IHRD was established in 1987
for imparting quality education especially in the technical education sector for development of manpower of the required level
of competence to match the growing demand of the industry in the feld of Electronics, Computer, IT and other emerging
technologies. IHRD has a network of 94 institutions which include 9 Engineering Colleges, 7 Model Polytechnics, 35 College
of Applied Science, 4 model colleges, 26 Technical Higher Secondary Schools, 6 extension/ study centres, 2 model fnishing
schools, 1 skill development centre,1 academic staff college, 1 information technology division and 2 regional centers. The
college of applied science at Mananthavady in Wayanad has been set up to bring up the educational standards of the SCs
and STs. 50% of the total seats have been reserved for ST students and 30% for SC students.
Kerala State Science and Technology Museum and Priyadarsini
Planetarium
12.72 Government of Kerala established the Kerala State Science and Technology Museum in 1984. The institution was
registered under Travancore-Cochin Literary Scientifc and Charitable Societies Act with a view to create scientifc temper
among all sections of the society with emphasis in taking science and technology to the common man. Many developmen-
tal activities are undertaken by the Museum. The Science and Technology museum has plans to work in collaboration
with other Museums, industrial organizations, research centres, professional institutions, educational institutions and other
suitable agencies in India and abroad for mutual beneft in general and for updating the museum in particular. Science
and Technology museum has started many new ventures such as second mobile exhibition unit, astronomy van with most
modern telescope, modifcation of galleries etc. In 2009 Museum has implemented Inculcate scholarship programme with
the objective of nurturing the inborn talents of students for scientifc learning and research. In the frst year there were about
6500 applicants, out of which 260 students from general category and 25 students from SC/ST category were selected for
the 1st phase of the programme.
Kerala State Centre for Advanced Printing and Training(C-apt)
12.73 Kerala State Centre for Advanced Printing and Training(C-apt) formerly known as Kerala State Audio Visual and
Reprographic Centre was established in the year 1992. The main objective of the centre is to undertake printing and repro-
graphic works for the Government Departments/Autonomous Bodies/public as per the rate approved by the Governing Body
of the centre from time to time. Centre has the head offce complex at Vattiyoorkavu, Thiruvananthapuram and city centre at
Punnapuram, Thiruvananthapuram. In addition, centre has sub centers at 9 places in the state. The Centre has undertaken
and executed printing works of highly confdential nature. Centre has launched C-apt Multi Media Academy for imparting
training in the feld of animation and multimedia through out the state on franchisee basis. The centre has generated income
to the tune of `28.28 crore by a way of printing, reprographic works and training during 2010-11 and made a provisional proft
of `2.74crore
Economic Review 2011
334
LBS Centre for Science and Technology
12.74 LBS Centre for Science and Technology was constituted in 1976 with the main objective of acting as a link between
technical institutions, universities and other professional bodies in the state and industry including public utility undertakings.
For the last three decades, the centre is actively involved in consultancy services and its core capacity is civil engineering
with emphasis on site surveying, preparation of architectural design, geo-technical investigation, foundation design, struc-
tural design, quantity survey and preparation of tender [Link] Engineering Colleges one at Thiruvananthapuram
and the other at Kasargode are functioning under the LBS.
Expenditure on Education
12.75 `. 9662.62 crore is earmarked for Education under plan and non plan heads in 2011-12. 78.9% of total outlay on
education is earmarked for Elementary and Secondary Education. 94.03% of total assistance under education in 2011-12 is
given as Non-plan assistance. `. 5767.18 crore is the total expenditure reported in the Education sector in 2009-10. Though
the expenditure during 2008-09 for Education sector in the second year of the XI th Five Year Plan period is `5293.67 crore,
the budget estimate during 2011-12 is `. 9662.62 crore which shows an increase of 83%. The details are given in Table 12.9
Table: 12.9
Budget Estimate and Expenditure on Education (`. Crore)
Sl.
No
Stage
Accounts 2009-10 Revised Budget
Estimate 2010-11
Budget Estimate
2011-12
Plan Non
plan
Total Plan Non
plan
Total Plan Non
plan
Total
1 El-
emen-
tary
Educa-
tion
19.52 2302.87 2322.39 95.91 2502.08 2597.99 93.22 3588.35 3681.57
2 Sec-
ondary
Educa-
tion
165.43 2146.50 2311.93 119.73 2559.56 2679.29 223.06 3719.40 3942.46
3 Univer-
sity and
Higher
Educa-
tion
72.36 710.17 782.53 106.98 891.96 998.94 122.33 1418.84 1541.17
4 Adult
Educa-
tion
4.00 0 4.00 8.90 0.00 8.9 8.80 0 8.80
5 Lan-
guage
Devel-
opment
3.54 25.49 29.03 4.16 27.32 31.48 3.70 6.37 10.07
6 Gen-
eral
35.89 6.64 42.53 12.21 18.66 30.87 50.75 31.44 82.19
Kerala State Planning Board
335
Sl.
No
Stage
Accounts 2009-10 Revised Budget
Estimate 2010-11
Budget Estimate
2011-12
Plan Non
plan
Total Plan Non
plan
Total Plan Non
plan
Total
Sub
Total
Gen-
eral
Educa-
tion
300.76 5191.69 5492.41 347.89 5999.58 6347.47 501.86 8764.42 9266.28
7 Tech-
nical
Educa-
tion
58.00 216.77 274.77 61.97 243.61 305.58 74.58 321.76 396.34
Total
Educa-
tion
358.76 5408.46 5767.18 409.86 6243.19 6653.05 576.44 9086.18 9662.62
Source: - Demand for Grants and Detailed Budget Estimates 2010-11 vol. 1. Government of Kerala
Sports and Youth Services
12.76 Kerala is a state renowned for its commendable achievement in sports both at national and international levels. Kerala
is one of the few states in the country which has legislated a bill (Kerala Sports Act 2000) and thus provided an impetus to the
growth of sports and games in the state. In Kerala, sports and games are today seen as a way of life. Sports and its related
activities is helping the state to emerge as a dominant sporting power in our country.
12.77 The Kerala State Sports Commission had recommended the integration of sports and physical education into the
school curriculum from the academic year 2009-10 onwards. The syllabus for introducing Physical Education as a part of
school curriculum has been approved. The books and other materials are being prepared by the experts. The programme
has been initiated in the academic year 2010-11. The introduction of physical education and sports as a subject of study in
schools is certainly to add another feather to Keralas achievements across various sectors dealing with the day-to-day life
of the people.
35th National Games
12.78 Government of Kerala is hosting the 35th National Games. There will be 36 medal events and two demonstration
events. National Games Secretariat has been constituted as a charitable society to carry out all the works needed for the
successful conduct of the games. As the time available is limited, it has been decided to conduct the games in stadia which
are to be renovated. About 24 stadia are selected for upgradation/renovation package. Four Greenfeld stadiums are also
proposed at Karyavattom, Vattiyoorkavu, Central Stadium in Thiruvananthapuram and Kozhikode and the project is envis-
aged to be taken up under Design Built Operate and Transfer mechanism with the participation of private entrepreneurs. A
Games village is also to be made available, where all the athletes and team offcials are to stay during the games, as agreed
in the Host City Contract. It was decided to construct a Games village accommodating about 5000 persons. Roads lead-
ing to the stadium have to be upgraded and other facilities like water supply, games equipments has to be ensured. All the
works are progressing.
12.79 National Games will certainly improve the sports infrastructure in the State. National Games will boost the sports ethos
of the people of the state, especially the younger generation and it will be a boon for further development of sports in Kerala
in the coming years.
Economic Review 2011
336
Kerala State Sports Council
12.80 Kerala State Sports Council is an autonomous body formed in 1954. It has been made a statutory body with the enact-
ment of Kerala Sports Act 2000 which extends the concept of sports for all. There are District Sports Councils to look after
the affairs at district level. In accordance with the objectives of the Act, the entire spectrum of sports promotion and allied
activities in the state has been brought under the purview of Kerala State Sports Council.
12.81 Kerala State Sports Council is the apex agency for the promotion and development of sports and games and allied
activities. The council currently has 59 administrative staff and 172 coaches in its roll. There are 25 centralized sports hos-
tels, 32 sports hostels in colleges and 15 sports hostels in schools which are fnancially supported by KSSC. The centralized
sports hostels are directly maintained by KSSC and the school and college hostels are maintained by respective manage-
ments. There are about 1600 students in these hostels. The Council has been organizing coaching camps and tournaments,
upgrading sports infrastructural facilities and assisting District Sports Councils for the conduct of district level tournaments.
12.82 In order to popularize football in Asian Countries, a project named Vision India has been introduced by Asian Football
Confederation. As part of this, State Sports Council and State Football Association have jointly undertaken a project named
Vision India with the help of Education Department. As an initial step it was implemented in seven selected districts. The
scheme intends identifcation of talented school students at the age of 11 years and imparts advance training in football for
moulding them into players of international standard. Altogether there are 91 schools and 2225 students are getting training
under the scheme. The scheme was extended in 2009-10 to the remaining districts.
12.83 Medal winners in the national and international sports events were given cash awards. State Championship Tourna-
ment 2010-11, district and state level rural sports tournaments were conducted. Sports events were also organized for
women, from block to state level. Kerala State Sports Council have conducted refresher course for coaches and deputed
coaches/offcials as observers to National and International meets, mini games, etc.
12.84 The KSSC is also the nodal agency for the implementation of the centrally sponsored PYKKA (Panchayath Yuva Krida
Aur Khel Abhiyan) in the state. Sanction has been received for the implementation of the project in 300 panchayaths and 43
block panchayaths. It is a 75% centrally sponsored scheme. The scheme is intended to promote sports and games among
youths, especially in rural areas by providing basic infrastructure and equipments at grass root level.
Kerala State Planning Board
337
Directorate of Sports and Youth Affairs
12.85Directorate of Sports and Youth Affairs was established in 1986 for the development of proper and quality infrastructure
for sports and games, imparting awareness on sports and games among public, providing facilities for proper training for
grooming sports persons of international standards.
12.86 The Directorate fnancially supports sports infrastructural development activities and maintenance of sports assets in
the state. Financial assistance is given to recognized sports associations for conducting tournaments, training and coach-
ing camps to sports persons for participation in international tournaments, to facilitate treatment of injured sports persons
, for purchase of sports equipments, providing facilities/ assistance to talented sportspersons to participate in tournaments
abroad and giving cash awards in having won tournaments.
12.87 Under the scheme for the maintenance/ development of play felds in the state an amount of `150.00 lakh was sanc-
tioned for maintenance/development of play felds of 43 institutions.
12.88 Government has implemented a scheme for providing pension to circus artists in indigent circumstances. The rate
of monthly pension is fxed as `525 (` 500 pension + `25 money order charges). During the period under review an amount
of Rs. 45.70 lakh was sanctioned to circus artists. The monthly income of `1500 is fxed as the eligibility of an applicant for
the pension.
12.89 Taekwondo is a Korean martial art which has gained worldwide acceptance to be included as a competitive sports
item for Olympics as well. A training programme to school children below the age of 18 years was started for boys & girls.
The training programme has been conducted in 55 schools in the State and in each training centres 25 children were trained
during the period. During 2010-11, the Taekwondo trainees won 7 gold,6 silver and 13 bronze medals in the national school
Taekwondo championship held at Bombay.
12.90 Similar other sports disciplines which are being promoted in Kerala include Karate, Judo etc. Karate is a martial art
to achieve physical ftness, improve mental discipline and emotional equanimity, learn self defense skills and develop sense
of responsibility for oneself and others. During 2010-11, Directorate of Sports sanctioned `6 lakh for the implementation
of Karate training for 200 students. Judo adopted from traditional Japanese martial art is an item of Olympic Games. The
Directorate of Sports & Youth Affairs launched a scheme for imparting Judo training by starting 14 district training centers,
by identifying a school in each District for this purpose and an amount of `9.06 lakh has been utilized during [Link]
trainees won 1 gold, 3 silver and 4 bronze medals in the national school Judo championship held at New Delhi.
12.91 As part of the development and promotion of ancient martial arts of Kerala a festival on Kalarippayattu is conducted
every year and arranged as a joint venture of Kerala Kalarippayattu Association and the Directorate of Sports and Youth
Affairs. About 380 participants including women from different districts of Kerala participated in the festival. During the year
2010-11 an amount of 0.25 lakh rupees was sanctioned for the conduct of the state festival.
12.92 Rajiv Gandhi Sports Medicine Centre at the Directorate of Sports is the only sports medicine centre in the state to pro-
mote excellence in sports by lending scientifc and prompt medical assistance and rehabilitation therapy to sports persons.
Under the period the centre has given medical treatment to 1400 sports persons. Financial assistance to 449 institutions
was given for the purchase of sports equipment under the report period.
Kerala State Youth Welfare Board
12.93 Kerala State Youth Welfare Board is an autonomous body constituted in 1985 to function as an apex body for co-ordi-
nation and implementation of all youth welfare schemes in the state. Kerala State Youth Welfare Board with its headquarters
at Thiruvananthapuram have a state youth centre and 14 district youth centres, a National Adventure Academy at Devikulam,
Idukki district and a sub centre of the Academy at Muzhuppilangadu, Kannur district.
12.94 As part of spreading Boards activities into youths it has established youth centres in all districts and these are working
as youth development centres. Through these centres youth can get information about carrier guidance, self employment
training and various other activities. These centres are very active in ensuring the involvement of various clubs and NGOs.
Youth centres have organized youth leadership camp, exhibition for youth, adventure activities etc.
12.95 Keralotsavam a unique festival for the rural as well as urban youth of Kerala enables them to participate in the cultural,
artistic, sports and games competitions. This mega fest is conducted through local self government departments at four
Economic Review 2011
338
levels .The primary level is at Grama Panchayat/ Municipality/ Corporation level. The second phase is at Block level. The
third level is at District level and the fourth is at State level. The winners of district level and state level Keralotsavam are
given prize money in addition to the certifcates. About 15 lakh youths are participating in this festival every year. During the
report year Keralotsavam was held at Thiruvananthapuram district from 2011 January2nd to [Link] 5000 youngsters
participated in the mega programme. The winners of the state level Keralotsavam programme were selected to participate in
the 16th national youth festival held in Rajasthan from 12th to 16th of January 2011.
12.96 Board has launched the Yuvasakthi project to involve the rural and urban youth for its developmental activities through
the panchayathraj and nagarapalika system. The project has started in 978 grama panchayaths, 60 municipalities and 5 cor-
porations of Kerala. A state level training for the panchayath youth co-ordinators were conducted. Various self employment
trainings, agricultural club activities, awareness programmes etc. are continuing under the scheme. Youth coordinators are
appointed for coordinating the day to day activities of the youth centres and conducting various activities in the youth centres.
12.97As part of the yuvasakthi project,a new project viz;Yuvakarmasena has started functioning. The main objective of the
scheme is to channelize youth resource for rural development. This sena was formed in all districts through district youth
centres which provide the youth groups training on disaster management, frst aid application, community work etc. to ex-
tend voluntary service in periods of emergency .As part of 100 days programmes of Govt., Yuvakarmasena regional training
camps were conducted at Kozhikkode and Kottayam.
12.98 For encouraging spirit of adventure among youth, training in various adventure sports like trekking, paragliding etc are
conducted. Financial assistance to adventure clubs for conducting adventure activities was also provided.
12.99 The youth clubs play a vital role in organizing and implementing various environment awareness programmes, social
forestry programmes and formation of nature clubs at local levels. Board has formulated several awareness building pro-
grammes such as seminars, workshops and publicity through media against substance abuse, HIV/AIDS, social evils like
dowry, child marriage, gender injustice etc.
12.100 Kerala State Youth Welfare Board has given fnancial assistance to youth clubs. The scheme provides training to
unemployed youth for promoting self employment in the areas like DTP, mobile phone servicing, computerized fnancial ac-
counting, auto driving, electrical and electronic equipment maintenance, agriculture production, processing marketing etc.
The expenditure on training cost of materials and trainers cost are met by the Board. During 2010-11 an amount of `25.79
lakh was utilized under the scheme. District wise details of fnancial assistance to youth clubs for conducting self employment
training are given in Table12.10
Table 12.10
District wise Details of Financial Assistance to Youth Clubs during 2010-11
Sl. No. District Number of Clubs allotted
Financial Assistance
Sanctioned Amount
(`. lakh)
1 Thiruvananthapuram 20 3.44
2 Kollam 20 1.97
3 Pathanamthitta 18 1.111 1.47
4 Alappuzha 17 1.88
5 Kottayam 33 1.65
6 Idukki 15 1.65
7 Ernakulam 11 1.17
8 Thrissur 19 2.23
9 Palakkad 13 2.97
10 Malappuram 18 1.67
11 Kozhikode 16 2.24
12 Wayanad 16 1.60
13 Kannur 18 1.25
14 Kasargod 10 0.60
Total 244 25.79
Source: Kerala State Youth Welfare Board
Kerala State Planning Board
339
12.101 Information and guidance centers named Jalakam are functioning in the district youth centres with computer internet
facilities, services of counselors etc. Information and guidance for higher studies, employment etc, are available from the
District Youth Centers at Thiruvananthapuram, Ernakulam, Pathanamthitta, Kozhikode and Malappuram.
Outlay and Expenditure of Sports and Youth Affairs
sector during 2010-11
12.102 The outlay and expenditure of various schemes implemented in Sports and Youth Affairs sector is shown in Table
12.11 .The total expenditure of the sector up to March 2011 is ` 3248.90 lakh.
Table.12.11
Outlay and expenditure during 2009-10 and 2010-11 (`. lakh)
Sl
No
Name of Scheme 2009-10 2010-11
Budgeted
outlay
Expenditure Budgeted
outlay
Expenditure
1 Kerala State Sports Coun-
cil
1000 1000 1200 800
2 Directorate of Sports and
Youth Affairs
421 2612.99 450 969.28
3 Kerala State Youth Welfare
Board
420 420.00 800 800
4 National Games 300 5800.00 6700 500
5 Other schemes 64 62.84 300 179.62
Total 2205 9895.83 9450 3248.90
Source: Budget Estimates 2010-11, Govt. of Kerala
Art And Culture
Economic Review 2011
340
Keralas culture is distinct and unique with an enviable tradition of numerous art forms. The cultural heritage of Kerala is
revealed in its varied dance forms, martial arts and cuisine. Preservation of our rich heritage is possible only through the
popularization of ancient art forms, which are deeply rooted in our culture. Kerala society is nurtured to a considerable extent,
through the enrichment of local art forms. There are many institutions solely set apart for the promotion and encouragement
of these art forms.
12.104 Academies, publishing houses, cultural centres, institutions of fne arts and folk arts, research centres and director-
ates like Museums and Zoos, Archives, Archaeology etc., are some of these institutions. During 2010-11, an amount of Rs
3405 lakh has been provided as plan assistance to this sector and an amount of Rs 2887 lakh has been utilized for the
development of the sector. The following section presents a brief summary of activities carried out by the institutions during
the year 2010-11.
1. Kerala Sahitya Academy
12.105 The Kerala Sahitya Academy is an autonomous institution established for the promotion and development of Malay-
alam language and literature. The Academy organizes literary programmes, publishes books, honours writers and partici-
pates in literary exhibitions.
12.106 The periodicals like Sahitya Chakravalam, Sahitya Lokam and Malayalam Literary Survey were published by the
Academy. Also books published in Malayalam before 1950 are preserved in micro flm in the library. Academy also has
an audio cassette library of 700 audio cassettes. This includes recorded sounds of cultural personalities. The Academy is
recognized as an apprentice training centre for library graduates by Central Human Resources Development Department
.The academy also functions as a research centre. Forty research scholars are undergoing research activities in the centre
and 210 research scholars are utilizing the reference facilities in the Academy library. Academy published 44 books during
2010-11.
12.107 During 2010-11 awards were given to eminent writers who contributed to language and literature. The Academy also
conducted many cultural exchange programmes and book exhibitions.
2. Kerala Sangeetha Nataka Academy
12.108The Academy is the nucleus of all amateur arts clubs and training institutions in the state and it always stands for the
betterment of art forms. The Academy is affliating all cultural institutions in the state. The Academy conducts festivals, com-
petitions and seminars for promoting dance, drama and music. The Academy conducted the International Drama festival
2011 during the year. Dance festival, Swathi Sangeetha Festival , State professional drama competition and other cultural
events were organized during the year.
3. Kerala Lalithakala Academy
12.109 The Academy promotes the talents of painters and sculptures through camps, demonstrations and exhibitions. Dur-
ing 2010-11, the academy organized many national and state level camps and exhibitions on drawing, sculpture, photogra-
phy etc in which renowned artists took part.
12.110 As an attempt to search the roots of the pictorial art of Kerala, Academy has organized the 16-day Kalamezhuthu
programme. The Academy has organized exhibitions, video flm melas, kalari programmes for children and speeches dur-
ing 2010-11. The Academy assisted many artists during the year for exhibiting their paintings and drawings.
4. Kerala State Chalachitra Academy
12.111 The Kerala State Chalachitra Academy is the only academy for motion pictures in India. During 2010-11, the Academy
organized many programmes for promoting flm and TV media. The Academy organized 15th International flm festival in De-
cember 2010. About 220 movies were screened in the festival. The Academy also conducted Documentary-Short Film Festi-
val, National Film Festival of Kerala; Touring Talkies programme Visual Appreciation Camps for Children etc., during the year.
5. Kerala Folklore Academy
12.112 The Kerala Folklore Academy is an autonomous institution closely associated with folklore subjects. The objectives
of the Academy are promotion of traditional folk arts of Kerala, dissemination of folk performing arts, welfare of the folk artists
Kerala State Planning Board
341
and scientifc documentation of these arts and their classifcation and publication of books, journals promoting culture and
traditional art forms.
12.113 During 2010-11 the Academy carried out many programmes for popularizing folk art forms. Stipends to students were
given for imparting training in folk arts. Awards/fellowships were given to outstanding artists. Artists were given fnancial as-
sistance for treatment. Various programmes were held in collaboration with art clubs in the different parts of Kerala. Two
issues of Poli, journal of the Academy were released.
6. State Institute of Childrens Literature
12.114 The Institute was established with the ultimate aim of all-round literary and cultural prospects of the children of the
state. With a view to promote the creative and cultural growth of the children belonging to the different strata of the society,
the Institute organises programmes, literary competitions and publishes childrens books and periodicals. The Institute pro-
vides good quality reading material for children in Kerala
12.115 The childrens monthly magazine Thaliru has been brought out in new form since June [Link] Institute organizes
Thaliru vayana matsaram,possibly the largest reading promotion campaign in the country. One of the main objectives of the
Institute was the publication of an Encyclopaedia in eight volumes.
7. The State Institute of Languages
12.116 The State Institute of Languages Kerala has been publishing academic books in pursuit of knowledge. The Institute
during the year 2010-2011 published 105 books on informatics literature as part of its objective of strengthening Malayalam
language. The Institute has organized book fairs in all parts of the State including an International Book Fair in Kozhikode
in 2011.
12.117 A new book shop of the Institute has been opened in Trivandrum city during the year 2010-2011. 18 volumes of the
Collected Works of Dr. [Link] were published during the year. The royalties to the authors have been increased from
10 per cent to 15 per cent of the face value of books. Sales division of the Institute has been computerized and the Institute
has become the frst in computerizing the book fairs with the application of open source software.
12.118 A series of subject based glossaries have been published in association with the Commission for Scientifc and
Technical Terminology, working under the Department of Higher Education, Ministry of Human Resource Development, and
Government of India. An amount of Rs 1.165/- crore has been utilized during 2010-2011 of which Rs.1 Crore is of plan as-
sistance and the balance expended from the revolving fund.
8. Kerala Book Marketing Society
12.119 Kerala Book Marketing Society is an agency for selling publications of Government Institutions, Kerala Sahitya
Academy and National Book Trust. Books are sold through their eleven branches and one mobile sales counter. Two new
branches were opened at Thrissur &Thodupuzha and two new mobile sales counters started during 2010-11. The society
participates in exhibitions and organized 46 bookfairs for promoting sales. During 2010-11, books worth `7.1 crore were
distributed to 1001 schools.
9. Kerala State Library Council
12.120 Kerala State Library Council is the apex body of the libraries in the State. There are 7191 libraries affliated to State
Library Council. Library Council is collecting the library cess. The Council undertakes projects to increase the infrastructure
facilities of the libraries and for the activities in the cultural and information felds. The projects are implemented through the
District Library Councils.
12.121 Balavedi , Vanitha Vedi, Students corner, Akila Kerala Vayana Matsaram etc were implemented through libraries to
enhance reading habits and to strengthen the library service.
12.122 A model village library has been started in all the 14 districts function as social and cultural development centres with
separate wings for women, children, youths, farmers etc. The Council has started academic study centres in one selected
library from each district. Reference facilities are provided for college students and researchers in these centres. Financial
assistance was provided to jail/juvenile libraries, seven hospital libraries and six orphanage libraries.
Economic Review 2011
342
10. State Central Library
12.123 State Central Library is functioning under the Higher Education Department. The Library is the frst one of its kind in
the nation which is fully computerized and provided with most modern technology of Radio Frequency Identifcation System
and Digital Wing. The library has 42812 members. Upto October 2011, the number of documents available in various
branches of the library is 367243. The library is now subscribing to all leading dailies in English, Malayalam, and Tamil along
with 544 periodicals of different nature.
12.124 The library is fully computerized and books and periodicals are issued through Libsys software. Online book reserva-
tion and renewal system has been introduced in the library. Radio Frequency Identifcation System enables self check in and
check out system, stock verifcation of the books and prevention of theft. The digitization of old Government Gazettes from
1904 to 1954 has been initiated during 2010-11. 700 students participated in the summer school programme
12.125 The library has also taken charge of the British Library collections and it is functioning as a separate section. More
than 5000 books are being issued every month from this section. The library has converted its computerized catalogue into
an Online Public Access Catalogue (OPAC) and intends to provide access to its digital library globally by creating an internet
portal.
11. The Centre for Heritage Studies (CHS, Thrippunithura)
12.126 Centre for Heritage Studies was incepted in the year 2000 as an autonomous academic and research centre for
promoting heritage and cultural studies. The centre conducts P.G. diploma in three subjects viz. Archaeology & Museology,
Archival Studies and Conservation. PG diploma course in Heritage Ship Technology was also started during the year. It is
also a training centre for teachers and demonstrators in theoretical and practical subjects like primitive, ancient, medieval
and modern art.
The centre has conducted work shop on Muziris Heritage Project ,one day seminar on Accessibility to the Museums and
Hortus Malabaricus Project Awareness programme during the year. The CHS has set up a conservation laboratory for the
Muziris Heritage Project at North Paravur
12. Margi
12.127 Margi is a cultural centre for promoting Kathakali and Koodiyattam. Koodiyattam has been proclaimed as a World
Heritage art by UNESCO in 2001. Margi has a permanent group of fourty traditionally trained senior artists of which 28 are
for Kathakali and 12 for Koodiyattam. Margi staged 84 Kathakali and 39 Koodiyattam during the year 2010-11.
12.128 Part time training in Kathakali is given to school students without fees to promote interest in youngsters in traditional
arts. Special training is given with stipends in Koodiyattam under a special programme of the Kendra Sangeetha Nataka
Academy, New Delhi.
13. Kerala Kalamandalam
12.129 Kerala Kalamandalam is an institution for training and research in classical art forms such as Kathakali, Mohiniyat-
tam, Chakyarkoothu, Thullal and Kalari arts. Kalamandalam gained the status of a Deemed University in 2007. Kalaman-
dalam has initiated several measures for upgrading the institution to the standard of a Deemed University. The institution has
introduced PG and research courses, initiated infrastructural developmental activities, enhanced the library referral unit etc
by adhering to UGC norms.
12.130 Mohiniyattam was staged in the commonwealth games inauguration ceremony, 50 students from Kalamandalam
participated in the prestigious ceremony. Renovation works of Vallathol museum and Koothambalam was completed during
2010-11.
14. Vasthu Vidya Gurukulam
12.131 Vasthu Vidya Gurukulam in Aranmula is a unique institution under the Department of Culture to promote and pre-
serve the traditional architecture, mural painting and other related subjects. In the absence of a statutory council for Vasthu
Sasthra, Human Resource Department, Ministry of India declared Vasthuvidya Gurukulam as a nodal agency for Vasthu and
Kerala State Planning Board
343
other related subjects. University recognized Vasthuvidya course is being conducted by Vasthuvidya Gurukulam. Consultan-
cy service in Vasthu principles is rendered for constructing houses and other buildings. Gurukulam has so far completed the
renovation work at Sree Padmnabhaswami temple and Aranmula Parthasaradhi temple and renovation work at Tali temple
is going on. Around 461 registrations have been done in the consultancy wing during this period. Vasthuvidya Gurukulam is
conducting four academic courses in vasthuvidya and mural painting based on the basic texts of [Link] is
also documenting important Traditional architectural structures in Kerala.
15. Guru Gopinath Natana Gramam
12.132 Guru Gopinath Natana Gramam is a cultural institution for imparting training in classical dance and music with spe-
cial focus on popularising Kerala Natanam which is a combination of Kathakali and Koodiyattam. The institution provides
necessary facilities for imparting art education to children and training to talented youths.
Natana Gramam conducts regular and vacation classes in dance, music and other performing arts. The construction of
National Museum is in progress. Documentation works of Kerala Natanam was completed during this period.
16. Kumaranasan National Institute of Culture
12.133 Kumaranasan National Institute of Culture is the frst memorial constituted by the Govt. of Kerala in the name of the
great poet [Link] Asan. It started functioning in the year 1966 with the main mission of spreading Kumaranasans
works and his messages among the public. In order to achieve this objective Kumaranasan National Institute has promul-
gated a Comprehensive Development project of construction of an International convention centre, International Library, Na-
tional Heritage Museum, Institute for Research and development, Eco Garden, Cultural Tourism etc. The land now available
with the Institute is not suffcient to construct all the above projects and hence procedure for acquiring 1.1 Hectares of land is
nearing completion. For this purpose the institute has remitted Rs. 1.80 Crores to the Revenue Department.
12.134 During the year 2010 the Institute has published complete works of Kumaran Asan containing 4000 pages in four vol-
umes. The construction of the four statues by the noted sculpturer Sri. Kanayikunhiraman is going on. The present research
institute being recognized by the Kerala University has been advantageous to the students with new books and new research
and study materials. In addition the functioning of the medicinal garden has been expanded with more rare medicinal plants
and high quality seeds. Arrangements have also been made to start the works of construction of the projects.
17. Multipurpose Cultural Complex Society
(Vyloppilly Samskrithi Bhavan), Thiruvananthapuram.
12.135 Vyloppilly Samskrithi Bhavan is an institution built with the support of Government of India to function as a research,
documentation and performance centre of traditional and classical cultural traditions. It is one of the few institutions of its
kind in India and is a UNESCO approved centre for cultural heritage preservation. The Mudra Fest is an important annual
programme of Samskrithi Bhavan. It is conceived as a forum to study and appreciate the value of classical dances from
the great masters of the country. Classical dances and lecture demonstrations were conducted in which renowned artists
performed. Weekly programmes on Kathakali, Nangiarkoothu, Ottanthullal, Vilpattu, Classical dances.
18. Jawahar Balabhavan
12.136 Balabhavan imparts training in arts and crafts for children between the age of four and sixteen. Classes are held
after school hours and during vacations. Training is imparted in all forms of creative arts and crafts, general knowledge,
yoga, electronics, spoken English, personality development, aero modeling, kalaripayattu etc. Nearly 1994 children attended
the vacation classes in Thiruvananthapuram. During 2010-11, 36 women were trained in self employment under the scheme
Pratheeksha in Thiruvananthapuram Balabhavan.
19. Archives Department
12.137 Collection, management and preservation of records are the major functions of the State Archives Department.
The records transferred from various departments / institutions are scrutinized and arranged as per archival principles.
Economic Review 2011
344
Department follows scientifc methods for the preservation of paper and palm leaf records kept in the department. Records
from Secretariat and Health Department were transferred to the State Archives Department. A conservation lab at Central
Archives, Thiruvananthapuram, has been set up. The Kerala State Archives is a A Category member in the International
Council on Archives which is an International body of about 170 member countries in the world which is aimed to promote the
Archival Heritage in the world. The basic function of the Department is the Preservation of the Archival wealth of the State.
This includes collection conservation, publication, research and preservation of public records, semi public records and
private records of the State. Exhibitions, Seminar etc are organized to arouse archival consciousness. Training programmes
are organized to those working in record rooms to increase the effciency.
12.138 Archival exhibitions and national level seminars are organized to arouse archival consciousness among the public
and the academic community in particular Archives Week Celebrations are organized in the month of November every year
as part of the International Archives Week Celebrations of the International Council on Archives. As a part of arising archival
awareness among the public, the Department had conducted exhibitions, seminars and workshops. A Journal Thaliyola of
historical records has been published trimonthly. Also three training programmes were conducted for the staff of the depart-
ment.
20. Archaeology Department
12.139 Scientifc conservation of cultural heritage of the state is the prime function of Archaeology Department. The Depart-
ment is having 150 protected monuments, 10 archaeological museums and one regional conservation laboratory. Periodi-
cal explorations and excavations are conducted in search of archaeological remains. Ancient monuments and traditional
structures like forts, bridges, caves, buildings etc are protected and maintained. Mural paintings in temples and churches, oil
paintings in palaces etc are also scientifcally conserved.
21. Museums and Zoos Department
12.140 Museums and Zoos have been functioning as tourist spots except the Thiruvananthapuram Zoological Park which is
for conservation of wildlife and promotion of research in the feld of animal behaviour, nutrition etc. In the year the Director-
ate carried out many modernizing and maintenance activities in the Museum and Zoo institutions at Thiruvananthapuram,
Thrissur and Kozhikode.
12.141 Regular classes are organised for the school/college students and public. The target groups are given half a day
class followed by a free visit to the Zoo. Wildlife and its importance, Nature and Wildlife Conservation etc. are the core
subjects covered. Film shows and slide shows are also conducted as part of it. Interactive sessions are organised in once
every fortnight in the newly renovated Museum auditorium. Topics related to Wildlife Conservation, Environmental health,
Cultivation of ornamental and medicinal plants, Museum display etc. are selected. Departmental staffs in Museums, Zoo,
Botanical Garden, members of NGOs and Nature Clubs participated in the sessions. Wildlife Week, World Environment Day,
Animal Welfare Fortnight etc. were celebrated with various programmes. Competitions in Quiz, Elocution, Painting and Essay
writing, etc. related to Wildlife for school/college students are being held as part of it.
22. Kerala State Film Development Corporation, Thiruvananthapuram
12.142 KSFDC (a public limited company) has been providing support facilities for the production of theatre flms and docu-
mentaries since 1975. The Corporation owns ten theatres and the Chitranjali Studio.
12.143 KSFDC has successfully launched several modernizing works and evolved new programmes for raising its revenue
during the year. Chitranjali Studio has been modernized by equipping it with modern lights, track, trolley and other latest flm
equipments..
[Link] Institute of Encyclopaedic Publications, Thiruvananthapuram
12.144 The State Institute of Encyclopaedic Publications is an institution established for publishing Encyclopaedias and
other similar reference books in the Malayalam language keeping a high standard comparable to that of renowned Encyclo-
paedias like Encyclopaedia Britannica and Americana. After the formation of the Institute in 1976 different schemes were
Kerala State Planning Board
345
introduced with a view to enlarge its sphere of activities. The most important ones were the publication of subject Encyclo-
paedias on World Literature and Environment.
12.145 The Institute has so far published 15 volumes of the General Encyclopaedia and seven volumes of the Encyclopae-
dia World Literature. As such, fve volumes of the General Encyclopaedia and three volumes of the Encyclopaedia World
Literature still remain to be published. The revised edition of General Encyclopaedia Vol 3 and General Encyclopaedia Vol
6 were published during the period.
Information Technology Education
Indian Institute of Information Technology and Management Kerala
(IIITM K)
7.144 Indian Institute of Information Technology and Management Kerala (IIITM_K) was set up by Government of
Kerala in the year 2000, as a premier institute of excellence in post graduate education and research in the area of Infor-
mation Technology and allied areas. The Institution is a non-proft making autonomous institution and is registered under
Section 25 of the Companies Act. All the shares of the Company is held by Government of Kerala and the management of
the Institute is vested in a Board of Directors.
7.145 IIIITM-Ks Mission is to be an institution of excellence in education, research, development, and training in basic and
applied Information Technology and Management and to be a leader in educational networking and services provider for
higher education and professions. The institute is helping the regions development through its education, expertise and
services and thereby make it an attractive destination for hi-tech industry . Since 2001, the Institute has been offering a
Post Graduate Diploma in Information Technology, abbreviated PGD-IT. The graduated students have been getting impres-
sive placements in top IT companies through campus interviews so far. More than 200 students have so far been placed in
reputed companies across the country.
7.146 IIITM-K continued to function from leased premises in the Technopark campus and only post Graduate Diploma in IT
course was being conducted. By the year 2007-08, the students admitted for the course reduced drastically, which promoted
IIITM-K to obtain recognition from CUSAT to start postgraduate courses. During 2008-09, one acre land was allotted in
Technopark and around Rs. 7.15 crores was provided for construction of a building measuring 3500 sq. m. which is already
completed and made fully functional.
7.147 The facilities available for higher learning at post graduate / doctoral levels currently in the State are insignifcant. It is
an acknowledged fact that even at national level, only a limited number of seats are available for post graduate level stud-
ies in Information Technology and allied areas. Around 5% of the students passing out of the engineering colleges in the
State have facilities available for postgraduate studies. Thus there is an urgent need to increase the seats available for post
graduate studies in the State and it is essential to attract mainstream postgraduate students and promote both academic and
research activities of great depth and meaning to ensure technological strength of Kerala.
7.148 The Institute currently offers a Master of Science programme in Information Technology, [Link] programme in Eco-
Informatics and a Post Graduate Diploma programme in e-Governance. Students who have Bachelors degree in any branch
of Engineering / Technology or Masters Degree in Computer Science / Applications with minimum of 60 percentage marks
are admitted to the Master of Science in IT programme and for Master of Philosophy in Ecological Informatics programme,
students who have passed [Link] with First Class in Natural /physical Science with minimum of 60 percentage marks are
admitted. PGDeG is a Government sponsored programme, and 15 seats are reserved for nominated Government offcials
and the remaining seats are for open candidates. Entry level requirement for admission to the PGDeG programme is a
Bachelors degree in any discipline with working knowledge of computer systems. Diploma / Certifcation in computer ap-
plication will be an added advantage. Preference is given to [Link]/MBA/ MCA degree holders. Since 2001, the institute
has been offering a Post Graduate Diploma in Information Technology, abbreviated PGD IT. The graduated students have
been getting impressive placements in top IT companies through campus interviews so far. Institute has also been offering
PhD programme under core computer Science and ICT areas.
IIITM-K is focusing in the following areas and emerging as an engine for promoting growth by using IT in inclusive develop-
ment programms. To drive the stated vision of IIITM- K, the institute has post graduate and doctoral programmes through
the following schools. These schools shall also cater to the needs of the IT Industry by means of offering programmes
Economic Review 2011
346
(workshops, short courses, short term training etc.) in specifc skill development
a) School of Computer Science and IT
7.149 This school covers the core areas of Computer Science and IT. The subject areas covered include Computer Sci-
ence. Software engineering, IT, Systems Programming, Telecommunication and Networking, Embedded Systems, Database
Management Systems, Artifcial Intelligence, VLSI, Web technologies, Information Security, Mobile technologies and their
integration with applications and services, etc.
b) School of Computational Sciences
7.150 The subject areas include constructing mathematical model and numerical solution techniques and using computers
to analyse and solve scientifc, social scientifc and engineering problems. It also covers scientifc databases, visualization,
computational and physical modeling, scientifc computing, computational chemistry, computational biology, algorithems and
their applications over distributed systems and high performance computing.
c) School of Informatics
7.151 The real value of IT comes when it is adapted and tuned to applications in different domains of social relevance. The
areas to be covered are informatics systems in Education, Agriculture, Ecological Informatics, Health Informatics in E-Gov-
ernance, domain specifc Scientifc Databases and their management, enterprise integration, Community Information and
Collaboration systems etc. Information management, Library and Information Sciences, Multimedia content developments,
Information management are all the areas in Informatics.
School of Humanities and Management
7.152 The subject areas include entrepreneurial Development & Management, Human Resource Management & Industrial
Relations, logistics, Marketing Management, Knowledge Management, organizational behavior, cognitive sciences, systems
of management for emerging virtual enterprises, linguistics, E-Governance, management of education, transactional analy-
sis, community knowledge empowerment and IT enterprise management.
Kerala State Council for Science, Technology and Environment
7.153 The Kerala State Council for Science, Technology and Environment (KSCSTE) was established in 2003 to promote
excellence in science and technology through learning, research and development with the involvement of academia, indus-
try, research organizations and to beneft the society through science and technology interventions with the involvement of
user agencies and benefciaries. Kerala State Council for Science, Technology and Environment (KSCSTE) was constituted
as an autonomous body of the Govt. of Kerala by restructuring the erstwhile State Committee on Science, Technology and
Environment . The primary objective of the Council is to implement Science and Technology Programmes to enhance the
socio- economic development as well as quality of life and environment of the State. The Council also intends to revamp and
streamline the science and technology programmes to make them more responsive to the development needs of the State,
and help in the transformation of Kerala as a knowledge economy.
7.154 There are six Research & Development Centers functioning under the umbrella of the Council viz., Centre for Earth
Science Studies (CESS), Centre for Water Resource Management and Development (CWRDM), Kerala Forest Research
Institute (KFRI), National Transportation Planning and Research Centre (NATPAC), Jawaharlal Nehru Tropical Botanic Gar-
den and Research Institute (TBGRI), and Kerala School of Mathematics (KSM).The Council also supports three grant-in-aid
institutions namely, Sophisticated Test and Instrumentation Centre (STIC), Integrated Rural Technology Centre (IRTC) and
Malabar Botanical Garden Society (MBGS). The council also undertakes co-ordinates and oversees many research pro-
grammes through the Universities and other R&D facilities established by the State and Central Governments.
Activities and Achievements of the Council HQ
7.155 During the review period the Council has organised and implemented various scientifc activities through their support-
ing institutions. The major activities are the following.
Kerala State Planning Board
347
(a) The Coastal and Environmental Division
7.156 The Costal and Environmental division was implementing Ecology and Environment scheme for the purpose of provid-
ing assistance to scientists and technologists for doing scientifc/research work on the environmental problems and issues.
One such project was on climate change and another project was on cadastral scale CRZ maps for urban areas which was
implemented through CESS. The water quality monitoring and soil quality monitoring programmes also achieved consider-
able progress. The Division also provided technical inputs in 222 CRZ cases for discharging the functions of KCZMA.
b) Science & Technology Promotion Division operated the following
schemes:
(i) Science Research Scheme (SRS)-
7.157 Science Research Scheme (SRS) aims at promotion of Research & Development activities in the state both in fun-
damental and applied research. Under the scheme, research projects in emerging areas of science and engineering are
supported by providing fnancial support for implementation. Among 42 new projects considered by the RCSE Committee,
21 projects were approved during 2011.
(ii) KSCSTE Research Fellowships
7.158 KSCSTE started Research Fellowship Programme in the year 2002, to promote research work leading to Ph.D in
the eleven disciplines-Agricultural Science, Chemical Science, Physical Science, Environmental Science, Earth System Sci-
ences, Engineering Sciences, Life Sciences, Taxonomy (Botany & Zoology), Bioinformatics and Mathematical Sciences A
total of 24 new fellowships were offered in 11 disciplines of science,
(iii) Selective Augmentation of R&D Activities (SARD) Scheme
7.159 Selective Augmentation of Research and Development Activities (SARD) is a scheme initiated by the Council with a
view to strengthen science and technology infrastructure primarily in the University Departments, Colleges and R&D Institu-
tions . SARD envisages modernization of laboratories by way of procurement of essential equipments and upgrading of
existing facilities for teaching as well as R&D activities. Funds for 5 SARD projects were sanctioned, comprising of 3 new
and 2 ongoing projects;
(iv) Sastraposhini Council Scheme
7.160 Sastraposhini is a scheme launched by the Council for strengthening Science education among High Schools of
the State. By this programmes model laboratories in Physics, Chemistry and Biology were established in selected Schools
in the stateThe monitoring committee visited 53 Govt High Schools of the State and selected 14 schools for establishing
Sastraposhini Model Labs;
(v) Sastraposhini MRS Scheme
7.161 Work for establishing Model Science laboratories in 20 Model Residential Schools of the State was completed;
(vi) Student Project Scheme
7.162 This programme envisages providing fnancial assistances to the students of University Departments and Colleges in
Kerala for the conduct of Scientifc Projects as part of their curriculum. During the year 2011, 63 projects were sanctioned;
(vii) Sastrabodhini Programme
7.163 Monthly scientifc programme was continuing in all the 27 Model Residential Schools (MRS) which are being regularly
monitored.
Economic Review 2011
348
(viii) Scheme for Promoting Young Talents in Science (SPYTIS)
7.164 science projects were selected for funding for promoting young talents in science.
c) Engineering and Technology Programme
7.165 This Scheme is aimed at promoting research in newly emerging and challenging areas of engineering and technology.
Sanction was accorded for 6 new project proposals. Financial support was offered to academic institutions, research orga-
nizations, etc. towards organization of conference, workshop, etc. Science Literature Awards were conferred on individuals
who have made substantial contributions in promoting science through Science Literature in Malayalam.
d) Patent Information Centre Kerala (PIC-K
7.166 KSCSTE has established Patent Information Centre-Kerala (PIC) functioning as the Satellite Centre for Patent Fa-
cilitating Centre for Technology Information Forecasting and Assessment Council (TIFAC), Government of India. It aims to
promote the Intellectual property output and to protect the traditional knowledge output of the State. The major objectives of
PIC are to generate awareness among Public on Intellectual Property Rights (IPR) through seminar, workshop, exhibition,
etc, to facilitate patent database search and access to patent related documents and to offer technical, legal and fnancial
assistance to institutions for flling patent.
PIC-K has organized 42 IPR awareness programmes in the State and as a result 54 patent applications were received. 5
patent applications from institutions were forwarded to PFC/TIFAC for fling. PIC-K established 12 IPR Cells in 12 Govt. and
Aided Engineering Colleges in the State. Intellectual Property Facilitation Centre for MSME (IPFC for MSME) organized 8
IPR awareness programmes for the Industrial Enterprises and Clusters and visited 22 Enterprises and Clusters in different
parts of the State.
e) Kerala Biotechnology Commission (KBC)
7.167 Kerala Biotechnology Commission is responsible for the implementation of the BT policy and related guidelines laid
down by the Biotechnology Board. It provided fnancial assistance to 7 young investigators under the Young Investigators
Programme in Biotechnology. Under the International Biotech Regulatory Services (IBRS) scheme four projects was sup-
ported during the period. KBC also started a new programme to organize training programme in selected emerging areas of
Biotechnology and two programmes were supported under the scheme. The Commission also initiated steps for the estab-
lishment of a Translational Research and development Centre in collaboration with Kannur University.
Activities of R & D Centres
The Centre for Earth Science Studies (CESS)
7.168 CESS has been instituted as a Centre of Excellence in Earth Sciences by the Government of Kerala in 1978 and
amalgamated under Kerala State Council for Science, Technology and Environment with the objective to promote modern
scientifc and technological research and development studies in the domain of Earth Sciences. The Centre for Earth
Science Studies has carried out multidisciplinary studies in the feld of earth sciences, with special emphasis on societal
needs. Research programmes of CESS were broadly grouped under the themes- crustal evolution and geodynamics, natural
hazards, coastal processes and management, atmospheric dynamics, natural resources and environmental management.
CESS has undertaken 43 externally funded R & D projects including one international project, 40 plan R & D projects, 11
plan Infrastructure projects and 38 consultancy projects. Under the academic activities 21 students worked for PhD and 36
did their PG dissertation.
Centre for Water Resources Development and Management(CWRDM)
7.169 Centre for Water Resources Development and Management, functions with eight divisions and six units/sections
and four sub centres carrying out research, development and extension activities on various aspects of water resources,
development and management. CWRDM has its mandate in carrying out research, development and extension activities
in various aspects of water resources development and management. CWRDM completed 14 R & D projects and had 46
Kerala State Planning Board
349
ongoing projects and 11 consultancy projects. CWRDM has conducted 8 seminar/symposia/conferences. It has organized
and conducted 16 training programmes and 6 farmer leaders training programmes. The centre has brought out 35 papers
and 20 reports The scientists of the centre have rendered their technical expertise in various national, regional and local level
technical committees of the Govt. and other bodies.
Kerala Forest Research Institute (KFRI)
7.170 Kerala forest Research Institute is one of the leading forestry research institutes dedicated to tropical forestry re-
search. KFRI had 50 R & D projects and 8 consultancy programmes. It conducted 14 training programmes. An important
achievement was the establishment of 32 km long coastal bio-shield at Vadanappalli under the coastal bio-shield programme.
KFRI also studied the distribution, species and population dynamics of mikenia micrantha and succeeded in developing a
biologic control using a natural fungal pathogen. The important research projects consisted of improving productivity of
plantation, preparation of management plan for high value biodiversity area, biodiversity conservation and nature education
programmes. KFRI has published 11 books, 21 research reports and 24 research papers.
National Transportation Planning and Research Institute (NATPAC)
7.171 Natpac is a centre of excellence concerned with all areas of transportation planning, research and development,
training and consultancy to meet the safe transportation needs of the public. NATPAC has undertaken 14 plan project and
10 sponsored projects. The important achievements consist of preparation of Integrated Development of Transport Infra-
structure for an emerging town (Kottarakkara), preparation of inventory of roads for Grama Panchayath, road connectivity
to the proposed Kannur airport, traffc and transportation studies for 23 towns in Kerala State, use of waste plastics in road
construction, resource mapping for road construction materials, inland water transport of west-coast canal in Kerala, road
safety measures, etc. NATPAC has published a handbook on transport and road accident statistics and 5 research papers.
Jawaharlal Nehru Tropical Botanical Garden and Research Institute (TBGRI)
7.172 Jawaharlal Nehru Tropical Botanical Garden and Research Institute was founded with the main objectives of conser-
vation of the tropical plant genetic resources and development of improved scientifc methods for their sustainable use to
the maximum extent for human welfare. TBGRI has 50 plan projects, 36 externally funded projects along with 2 consultancy
Economic Review 2011
350
projects. It has published 88 papers on various subjects and a book Bamboos at TBGRI. 14 rare endemic tree species were
added to arboretum and 19 palms to palmetum. A programme for greening state highway was initiated. A virtual herbarium
database application package was developed for digitalizing TBGRI herbarium. A comprehensive account on the current
status of the fowering plants of the Western Ghats was successfully completed.
Kerala School of Mathematics (KSOM):
7.173 The Kerala School of Mathematics has been setup at Kozhikode as a joint venture of KSCSTE and National Board of
Higher Mathematics (NBHM), under the Department of Atomic Energy, Government of India. The main objective of the insti-
tute is to promote Mathematical research in the country and particularly in Kerala. During 2011, 5 seminars and 4 colloquium
and 2 international seminars were conducted.
The Grant-in-aid Institutions
7.174 The Grant-in-aid Institutions of the KSCSTE viz. Sophisticated Test and Instrumentation Centre (STIC), Malabar Bo-
tanic Garden Society (MBGS), Integrated Rural Technology Centre (IRTC) have carried out various activities in their respec-
tive felds.
7.175 Apart from the above activities , the Council has also organized A high-level meeting on Centre-State Technology
Partnership jointly with the Department of Science of Science and Technology (DST), Government of India on November 6,
2010. More than 70 senior offcials, scientists and activists of the Central and State Governments and governmental and
non-governmental institutions attended the meeting. A panel consisting of eminent persons placed the user perspective on
current state of technologies and technology application in the state as well as the future demands in various sectors
7.176 The 23rd Kerala Science Congress was organised at CESS during 29 to 31 January 2011. The theme of the Congress
was Science and technology for transforming Kerala as a green economy.
7.177 Recognising the role of KSCSTE/ CESS in dealing with coastal zone management issues, MoEF has identifed CESS
as the nodal organization for the preparation of the World Bank funded Integrated Coastal Zone Management Project.
Regional Cancer Centre, Thiruvananthapuram
7.178 Regional Cancer Centre, Thiruvananthapuram (RCC), is an autonomous scientifc institution sponsored jointly by
the Government of Kerala and the Government of India. The centre was established in the year 1980 as a tertiary referral
centre for the diagnosis and treatment of cancer. RCC rated amongst the top three of the 28 Regional Cancer Centres in the
country. It is the only comprehensive, dedicated centre for diagnosis, treatment and control of cancer in Kerala. In average
32,000 new patients occur every year in the state and out of this more than one third comes to RCC for treatment.
Kerala State Planning Board
351
Major Achievements of RCC during the period 2010-11
Infrastructure Development
A new Blood Irradiator machine aimed at minimizing transfusion reations in bone marrow trans
plant patients is purchased as a part of infrastructure upgradation.
An underground water storage facility of 15 lakh litres capacity was commissioned
to tackle the long standing water scarcity.
Social Services
Free treatment were provided to tribal people, BPL families and children less than 18 years of age
through different schemes such as Tribal Project, Cancer Suraksha Mission, Rashtriya
Suraksha Scheme and Thalolam.
Conducted several campaigns for the the promotion of our Cancer Care for Life.
Clinical Services
Radiation Oncology
Surgical Oncology
Medical Oncology
Paediatric Oncology
Pathology
Imageology
Nuclear Medicine
Pain and Palliative Care
Community Oriented Programmes
Conducting trainer-trainee Programmes, cancer detection camps, cancer awareness
education programmes and tobacco cessation clinic.
Work Pattern in RCC
13230 new cancer patients in 2010-11
180858 patients reviewed in 2010-11
604 patient visits every day
450 patients given radiotherapy every day
200 patients administered chemotherapy every day
125 procedures performed every day
Regular research activities and publications
Economic Review 2011
352
Fee Treatment to Poor Cancer Patients
7.179 Free treatment to poor cancer patients is a policy of the State Government. Data regarding free treatment to the
cancer patients belong to BPL families for the last four years are given below.
Table 23.1
Free Cancer Treatment to the BPL families for the last four years
SL.
No
Particulars 2007-08 2008-09 2009-10 2010-11
1 [Link] New Partients registered 11327 12123 13040 13230
2 Existing number of patients 139818 163837 167628 180858
3 [Link] free category patients 5550 5455 5868 5987
4 No. of patients got Chemotherapy
free of cost
197 148 181
5 [Link] Chemotherapy free of cost 3575 4267 4300 3327
6 [Link] free Radiation treatment 2918 3717 3940 3205
7 [Link] free surgeries 2113 2886 2994 1953
8 Total cost of free treatment (`.In lakh) 1188 1060 1135 1193
Kerala State Planning Board
Health
C
H
A
P
T
E
R
356
Kerala State Planning Board
357
13.1 Health Services have emerged as the largest and fastest growing sector in the world economy.
Health sector is one of Indias largest sectors in terms of revenue and employment. During 1990s
Indian Healthcare sector grew at a compound annual rate of 16%. Health sector today contributes to
5.2% of GDP in India. There have been signifcant developments in the health sector in India in recent
years. The Rashtriya Swasthya Yojana (RSBY) has emerged as an effective instrument for providing
basic health cover to poor and marginal workers. The Central Governments in association with state
Government is initiating various National programmes for the control of communicable and non- com-
municable diseases
13.2 Kerala enjoys a unique position in the health map of India. The health indicators in Kerala are
at par with the Western world. We have the lowest infant mortality and maternal mortality rate with
the highest life expectancy in the country. However, the spread of modern disease has become major
crisis in Kerala. Higher prevalence of mental health problems, suicide rates, death due to road traffc
accidents and other traumas are other dimensions of the health problems in Kerala. Kerala is facing
an alarmingly high mortality rate at the most productive ages of people. Human Development Report
2005 adduces increase in life expectancy as one of the reasons for high levels of morbidity in Kerala
and emphasize on better nutrition, environmental sanitation and preventive health care, enhanced
role for the public sector and greater regulation of the private sector. The major problems in the health
sector of Kerala are
1. Prevalence of diseases associated with lifestyle and ageing.
2. Prevalence of environment related diseases owing to problems of community hygiene and pollution.
[Link] of infrastructural facilities and trained personnel
13.3 The success of Kerala health indicators is more due to the investment in the social capital rather
than only in the public health care, resulting in a more accountable and integrated primary health care
system .The public sector is unable to meet the demands for health care and people have responded
to these inadequacies by increased use of the emerging private sector. This has led to the growth of
the private medical care set up in the State and the dependence on private health care is quite high
even among the lower income groups and rural areas. Health sector has to be improved considerably
in terms of availability and quality of its physical infrastructure, human resources and services so as to
fulfl the growing demand for health services. The present Health delivery system has to be improved
with by increasing effciency, effectiveness and accountability. The health policy of the State will focus
on the requirements of elders, people residing in remote areas, tribal people, vulnerable groups etc.
Similarly, mental health including psychological care and counselling will give priority.
Health
Economic Review 2011
358
Health Care Infra structure in Government sector
13.4 The Health Care system in Kerala comprises mainly under three heads namely Alopathy, Ayurve-
da and Homoeopathy. The Health infrastructure consists of 2724 institutions with 52893 beds.
Besides there are 5403 sub centres under Directorate of Health Services .Out of the total institutions
46.44% are under Allopathy, 32.2 % under Ayurveda and 21.36 % under Homoeopathy department.
Medical services are also provided through the co-operative sector and the Private sector. There are
74 hospitals with 6767 beds under the Co-operative sector in the State. The Health Infrastructure in
Government sector during 2011 is given in Table 13.1
Table 13.1
Health Infrastructure in Government Sector during 2011
( No)
Sl No. System of medicine Insttutons Beds Patents treated during 2011
IP OP
1 Allopathy(DHS) 1255 37750 1831724 53057551
2 Alopathy (DME) 10 10079 347334 3341592
3 Ayurveda(ISM) 874 2860 41102 10481288
4 Ayurveda Medical
Education
3 1259 9072 386721
5 Homoeopathy 582 945 53442 11839811
Total 2724 52893 2282674 79106963
Source: Alopathy, Medical Education, Ayurveda and Homoeo departments
13.5 Table 13.2 below shows the basic health indicators of both Kerala and India during 2011
Table 13. 2
Basic health indicators 2011
[Link]. Health Indicators Kerala India
1 Birth rate (000 population) 14.7 22.5
2 Death rate (000 population) 6.8 7.3
3 Infant mortality rate(000 popu-
lation)
12 50
4 Child mortality rate 0-4 years
(000 population)
14 69
5 Maternal mortality rate (per
lakh live birth)
81 212
6 Total fertility rate (children per
woman)
1.7 2.6
7 Couple protection rate (in
percent)
62.3 52
8 Life at birth Male 71.4 62.6
Female 76.3 64.2
Source: Directorate of Health Services
Kerala State Planning Board
359
Fig:13.1
Basic health indicators 2011
Department of Health Services
13.6 The department of Health Service is formed mainly for the establishment and maintenance
of medical institutions with necessary infrastructure. It offers services such as control of commu-
nicable diseases, Family Welfare services including maternal and child health services, imple-
mentation of National control / eradication programmes, providing curative services and admin-
istration. There are 1255 institutions and 37750 beds under the Directorate of Health Services
which consists of Primary Health Centres, Community Health Centres, Taluk Head Quarters hos-
pitals, District hospitals and specialty hospitals for mental illness, leprosy and tuberculosis. De-
tails of major medical institutions under DHS during 2010 & 2011 are shown in Table 13.3 below.
Table 13.3
Major Medical institutions under DHS
(No.)
[Link]. Institution 2010 2011
1 Primary Health Centres (in-
cluding MCH Centres)
835 835
2 Community Health Centres 237 230
3 Taluk/District /Women &Chil-
dren Hospitals
95 103
4 Dispensaries 24 25
5 T.B. Clinics/Centres 17 17
6 Grant-in-aid institutions 29 29
7 Leprosy Control Units 3 3
8 Sub Centres 5403 5403
Source: Directorate of Health Services
Economic Review 2011
360
Fig:13.2
Major Medical institutions under DHS during 2011
13. 7 Category wise major medical institutions and beds in Kerala under DHS are given as
Appendix 13.1.
Primary Health Centres
13.8 According to World Health Organization report Primary health care is essential health care, based
on practical, scientifcally sound, and socially acceptable method and technology, universally accessible
to all in the community through their full participation at an affordable cost and geared towards self-
reliance and self-determination (WHO & UNICEF, 1978).There are 835 Primary Health Centres in Kerala
along with 5403 sub centres under Health department. 175 PHCs are now categorized as 24x7 PHCs.
District wise number of PHCs and sub centres with details of beds during 2011 is given in Table 13.4
Table 13.4
District wise number of PHCs and Sub centres with details of beds during 2011
( No.)
Sl
No.
PHCs
(other than 24 X 7 PHCs
24 X 7 PHCs Sub centres
District Insttutons Beds Insttutons Beds Insttu-
tons
Beds
1 Thiruvanantha-
puram
62 182 7 101 481
2 Kollam 48 32 6 114 421 Nil
3 Pathanamthitta 38 264 5 96 261 Nil
4 Alappuzha 39 54 17 254 366 Nil
5 Kottayam 41 62 13 316 330 Nil
6 Idukki 29 122 11 164 309 Nil
7 Ernakulam 41 60 34 872 409 Nil
8 Thrissur 68 262 11 166 471 Nil
9 Palakkad 64 414 11 206 504 Nil
10 Malappuram 63 184 21 340 591 Nil
Kerala State Planning Board
361
Sl
No.
PHCs
(other than 24 X 7 PHCs
24 X 7 PHCs Sub centres
District Insttutons Beds Insttutons Beds Insttu-
tons
Beds
11 Kozhikode 56 80 7 94 401 Nil
12 Wayanad 13 24 8 140 201 Nil
13 Kannur 68 442 14 312 411 Nil
14 Kasaragod 30 0 10 168 247 Nil
Total 660 2182 175 3343 5403 Nil
Source: Directorate of Health Services
Community Health Centres
13.9 At present, there are 230 Community Health Centres under the Directorate of Health Services.
Major departments like surgery, orthopaedics etc is functioning in some CHCs. The district wise num-
ber of CHCs and allotment of beds during 2011 are given in Table 13. 5 shown below:
Table 13.5
District wise number of CHCs and allotment of beds during 2011
(No)
[Link]. District CHCs Beds
1 Thiruvananthapuram 23 789
2 Kollam 17 443
3 Pathanamthitta 13 242
4 Alappuzha 16 424
5 Kottayam 17 609
6 Idukki 14 302
7 Ernakulam 23 779
8 Thrissur 24 806
9 Palakkad 19 463
10 Malappuram 21 526
11 Kozhikode 16 334
12 Wayanad 8 242
13 Kannur 10 339
14 Kasaragod 9 229
Total 230 6527
Source: Directorate of Health Services
General /District /Taluk Hospitals
13.10 There are 11 General Hospitals, 15 District Hospitals, 19 speciality hospitals, 80 Taluk Head-
quarters Hospitals and 48 other hospitals under Health department. As a part of standardization,
these hospitals are to be strengthened with equipments and modern amenities.
13.11 District wise details of inpatient/outpatient, major/minor operations conducted in hospitals/dis-
pensaries under DHS during 2010 and 2011 are given in Appendix 13.2
Economic Review 2011
362
Box No. 13.1
NABH Accreditation
During 2010-11 General hospital Ernakulam received NABH Accreditation from the National Accredita-
tion Board for Hospitals and Health providers .This is the only hospital in Government sector which has
received NABH Accreditation.
Source: Directorate of Health Services
Women & Childrens Hospitals
13.12 The W&C hospital provides special care to women and children particularly to pregnant women.
The hospital also gives immunization for children. There are only 6 Women & Childrens Hospitals
in Kerala in Thiruvananthapuram, Kollam, Alappuzha, Ernakulam, Palakkad and Kozhikkode. More
Women & Childrens Hospitals are to be established covering all districts of Kerala, ensuring 100 per-
cent institutionalization of delivery and making pregnancy safe with specialty treatment in gynecology
and early detection of child diseases.
T.B. Clinics/Centres
13.13 There are 17 T.B. Clinics and 3 TB centres in Kerala under DHS. The district wise distribution of
clinics and beds available is given in Table 13. 6 as shown below.
Table 13.6
District-wise distribution of T.B. Clinics/Centres and Beds 2011
(No)
[Link] District T.B. Clinics T.B. Centre
Institutions Beds Institutions Beds
1 Thiruvananthapuram 2 508
2 Kollam 0 0 2 0
3 Pathanamthitta 0 0 1 0
4 Alappuzha 0 0 2 36
5 Kottayam 0 0 2 48
6 Idukki 0 0 1 0
7 Ernakulam 0 0 1 40
8 Thrissur 0 0 1 0
9 Palakkad 0 0 1 0
10 Malappuram 0 0 2 52
11 Kozhikode 1 100 1 0
12 Wayanad 0 0 1 0
13 Kannur 0 0 1 0
14 Kasaragod 0 0 1 0
Total 3 608 17 176
Source: Directorate of Health Services
Leprosy Sanitoriums
13.14 There are 3 leprosy sanatoriums in Kerala under Directorate of Health Services for the eradica-
tion of leprosy. The total bed strength of these institutions is 1916. Besides this, there are 8 leprosy
Kerala State Planning Board
363
control units without inpatient facility. These units conduct surveys, medical camps and referral servic-
es. Re constructive surgery (RCS) facility is provided to patients. The number of RCS done in 2009-10
was 38. During 201-11, 46 surgeries were conducted. District wise distribution of leprosy control units
in Kerala during 2011 is given in Table 13.7
Table 13. 7
District Wise Distribution of Leprosy Control Units in Kerala 2011
(No)
[Link]. District Institutions Beds IP
1 Alappuzha-Nooranadu 1 993 240
2 Thrissur-Koratty 1 660 230
3 Kozhikode-Chevayoor 1 263 140
Total 3 1916 610
Source: Directorate of Health Services
13.15 The prelevance rate of leprosy for the year 2010-11 is calculated as 0.27. New cases are detect-
ed through school health programme and home visit of ASHA workers. The incidents of new cases in
past fve years is given below in Table 13.8.
Table 13.8
The incidents of new cases of Leprosy
(No.)
Year New Cases
2006 870
2007 778
2008 827
2009 884
2010 931
Total 4290
Source: Directorate of Health Services
Box No.13.2
Pain & Palliative and Elderly Care
In Kerala 11% of population comprises of the Elderly which is projected to become 185 by 2026. The
Directorate of Health Services provides Palliative care services which are implemented at three
levels
Primary level-home based care supported by LSGI and PHC
Secondary level-hospital based care supported by civil society initiatives and Taluk level hospitals
Tertiary level-supported by civil society initiatives and Medical colleges
More than 422 Palliative care units are established in the State under the Palliative care project
of NRHM. Through Palliative care a total of 7300 patients were covered ie, 422 patients through
primary level, 175 secondary and 16 patients through tertiary level.
Source: Directorate of Health Services
Kerala State Institute of Virology & Infectious Diseases, Alappuzha
13.16 Kerala is the only State with its own Virology Institute, which is a useful concept that should
serve as a model for other States. The aim of the KSIVID is to establish necessary infrastructure and
processes for early detection and rapid prevention of infectious diseases like chikungunia, dengue
Economic Review 2011
364
fever, leptospirosis and other occasional threat of some other diseases like Avian Flu, Anthrax etc.
Isolation and identifcation of viruses is the main function of the Institute. Considerable progress has
been made in the control of many vaccine preventable diseases, but many other infections are on the
increase. During the outbreak of infectious diseases, the institute gives necessary assistance for in-
vestigation. The Institute has two components namely laboratory component and disease surveillance
component.
State Institute of Health and Family Welfare
13.17 The Health and Family Welfare Training Centre Thycaud Thiruvananthapuram was started dur-
ing 1967 as Family Planning Training Centre for imparting in-service and orientation training for Medical
offcers and paramedical staff of Kerala Health Service department. With the integration of Maternal
& child health and public health activities, the training centre has been redesigned as Health and Fam-
ily Welfare Training Centre (HFWTC). Then it was upgraded as SIHFW on February 2001. In 2004 it
was given functional autonomy. Now this institute is the apex training institute under the Kerala Health
Services. This institute plays a key role in improving the quality of manpower in the health sector.
13.18 The State Institute of Health and Family Welfare provides training to employees of Kerala health
services and conducts monitoring activities and has a mandate for research consultancy. The Institute
has excellent infrastructure facilities including computer lab and is capable of running 5-6 programmes
simultaneously. This Institute undertakes training for various categories of health staff under differ-
ent schemes such as Plan, NRHM and State training programmes of IMG. The Institute is committed
towards equipping personnel with latest techniques and developments in Health sector and Family
welfare. The Institute also involves in the development of training resource material and training mod-
ules. The trainings conducted are pre-placement trainings, induction trainings, in-service trainings,
skill development like supervisory, administrative management and computer trainings and training
of trainers in which doctors, administers, nurses, ministerial staff, paramedical staff and other offcers
got trained. Nearly 450 medical staffs got NRHM& UNICEF training and 166 persons received STP
training during [Link] Institute has provided four trainings on gender based violence during 2011
and this has contributed much in improving the welfare of women. The training programmes provided
to health staffs like nurses, attenders, nursing assistants etc. resulted in remarkable change in their
attitude, behavior and effciency.
Box. No.13.3
Present Status of the Training Institutes and Trainings in Kerala
The Kerala State Institute of Health and Family Welfare Thycaud ,Thiruvananthapuram is the
apex institute for conducting trainings
Regional Family Welfare training instititute in Kozhikkode provides training to the staff of the
northern districts
Public Health training school Thiruvananthapuram provides two year Diploma Health
Inspector(DHI) course for J unior health inspectors, one year MPW for J HI and six months
female health supervisor training course for J PHN
Female Health Supervisors training school in Kozhikkode conducts six month FHS training
course for J PHNs
Junior health Inspector training cente in Palakkad district conducts two year Diploma course
Four Junior Public Health Nurse Training Centres are functioning in Kerala in Thiruvanantha-
puram, Kottayam, Palakkad and Kasargod districts
District training centres are functioning in Kollam, Alappuzha, Thrissur, Wayanad and Kozhik-
kode districts
Source: Directorate of Health Services
Kerala State Planning Board
365
Welfare Society for the Locomotor Disabled
13.19 The aim of the Welfare Society for the Locomotor Disabled is to help the locomotor disabled
by giving aids and appliances. The Society is concerned with the early detection of disability by giv-
ing training to ASHA workers, anganwadi workers, health staff and other NGOs. The Society conducts
medical camps for the disabled and supplies artifcial limbs and walking aids free of cost to poor
patients. Every year the society conducts various camps and distributes aids and appliances. During
2010-11 the Society distributed aids and appliances worth Rs.9 lakh.
Society for Medical Assistance to Poor
13.20 A registered society started in 1998 to provide necessary fnancial assistance to the poor
patients for life threatening diseases such as brain surgery, open heart surgery, pacemaker implanta-
tion, angioplasty, renal transplantation surgery, tumor resection and prosthesis, tumor of lumbar thoracic
vertebral, cancer, dialysis, and liver transplantation surgery. Every month about 400 numbers of appli-
cations are received in the Directorate of Health Services for assistance from the society. Details of as-
sistance availed to benefciaries through the society from 2007-08 to 2010-11 are given in Table 13.9
Table 13.9
Details of assistance availed to benefciaries through the society from 2007-08 to 2010-11
Year Number of
benefciaries
Amount availed
2007-08 560 82.43
2008-09 3649 513.92
2009-10 2318 306.53
2010-11 3380 422.25
Total 9907 1325.13
Source: Directorate of Health Services
Para Medical Services
13.21 Medical and paramedical professionals are essential to achieve health strategy. The different
type of laboratories functioning for providing paramedical services in the State are
Public Health Laboratory
Government Analyst Laboratory
Chemical Examiners Laboratory Department
Drugs Control department
Public Health Laboratory
13.22 Public Health Laboratories caters to the diagnostic needs of patients from both in the Govern-
ment and private sectors. The State Public health and clinical laboratory, Thiruvananthapuram is a
pioneer institution in the feld of bio-medical investigations. The laboratory functions through eight
different technical sections such as Clinical Pathology (Diagnostic), Biochemistry, Serology, Bacteri-
ology, Cytology, Radio immunoassay and Central Malaria Lab. In addition to this, a teaching section
for Diploma in M.L.T. course and a Voluntary Counseling and Testing Centre (V.C.T.C.) is functioning.
The laboratory is associated with an external Quality Control Programme of CMC Velloor. About 300
patients attend the lab daily and about 3000 tests are performed daily in the SPHL, TVPM. There
are three Regional Public Health Laboratories at Ernakulam , Kozhikode and Kannur. The RPHL
Ernakulam & Kozhikode functions through four different technical sections such as Hematology/Clini-
cal Pathology, Biochemistry, Serology and Bacteriology. In the Regional Public health laboratories at
Economic Review 2011
366
Ernakulam & Kozhikode about 100-150 patients attend the laboratory daily and about 1000 different
tests are performed. District public health labs are functioning at Kollam and Alappuzha districts.
These laboratories cater their services to the general public ie, from Government hospital as well as
from private hospitals.
Government Analyst Laboratory
13.23 The Analyst Laboratories which is under the control of Commissionarate of Food Saftey per-
form a very important role in the health activity in the State by checking the quality of food materials
and drinking water available to the public .These laboratories check dietary articles collected from vari-
ous hospitals, food materials supplied through Civil Supplies Corporation, exported and imported food
articles of Food Corporation of India, samples collected from industrial concerns and chemicals used
for water treatment, samples concerned with food poison etc. In addition, these laboratories are con-
cerned with the detection of newer type of adulterants such as brominated vegetable oil, soluble coal
tar dyes, pesticide residue heavy metals etc. Water pollution problems are also being dealt in these
laboratories. The laboratories are declared as the Appellate Authority under the Pollution Control Act.
Government Analyst Laboratory, Thiruvananthapuram and Regional analyst laboratory of Ernakulam
and Kozhikode and District food testing laboratory, Pathanamthitta are working for food analysis as
well as water analysis needs of the State. Now these laboratories are preparing for NABL Accredita-
tion. The Analytical Laboratory has two wings Water analysis section and Food analysis section. Par-
ticulars of samples are given below
The food samples are received from local bodies, MVs and railway under PFA Act 1954
Government department samples
Suspected food poisoning
Private parties including tea board and FCI
Hospital dietary articles
Sabarimala /informal samples
Water samples
13.24 Total number of samples collected in these laboratories and number of samples found adulter-
ated during 2011 is given in Table 13.10
Table 13.10
Details of samples found adulterated in Analyst laboratories during 2011
(No )
Sl No. Name of laboratory Samples col-
lected
samples found
adulterated
1 Govt. Analyst laboratory, Thiruvananthapuram 9586 224
2 Regional Analyst laboratory, Ernakulam 9705 319
3 Regional Analyst laboratory, kozhikkode 7951 279
4 District Food Testing laboratory, Pathanamthitta 1786 36
Total 29028 858
Source: Government Analyst Laboratory, Thiruvananthapuram
13.25 Out of the total 29028 samples collected 2.95% of samples were found adulterated during
2011.A total number of 11392 food samples were received and analyzed under PFA Act 1954 from
various local bodies in the State. Out of this, 320 samples were found adulterated. The highest per-
centage of adulteration is found in ice cream (26.92%). A total of 12023 water samples were analyzed
during [Link] of 5599 samples analyzed, 2594 samples were found to be free from coliform
bacteria. Samples received from private parties for analysis is 8807 and an amount of Rs.975930 has
Kerala State Planning Board
367
been collected as fee for analysis. The total number of prosecution launched in connection with food
adulteration during 2010-11 was [Link] number of cases disposed off during this period was 158
out of which 86 cases were convicted and 72 cases were acquitted.
Chemical Examiners Laboratory
13.26 Chemical Examiners Laboratories were established in India to render independent scientifc
service to Criminal J ustice Administration system by the middle of 19th century. Chemical examiners
laboratory is under the administrative control of the Home department and is issuing certifcates after
examining material objects involved in criminal cases and also provides expert opinion to various
courts. As a part of modernization programme and to ensure increased effciency of service modern
analytical instruments were purchased and infrastructure facilities developed. Details of technical
work for the year 2011 in the Chemical Examiners laboratory is given below as Table 13.11.
Table 13.11
Consolidated Annual Report of the Technical Works of the Chemical Examiners
Laboratory Department 2010-11
(No.)
Sl.
No.
Crime Head cases
Pending as on
1/9/11
cases
received during
9/11
cases examined
during 9/11
cases pending as
on 1-10-2011
Cases Articles Cases Ar-
ticles
Cases Articles Cases Articles
1 Murder Cases 254 873 26 127 30 89 250 911
2 Sexual Offences 840 2073 107 392 70 322 877 2143
3 Human Poisoning
Cases
22237 83543 344 1222 155 630 22426 84135
4 Animal Poisoning 113 615 4 17 3 13 114 619
5 Drunkenness/Blood
Alcohol
42 70 18 35 41 50 19 55
6 Excise 9571 27027 1478 4845 2187 8527 8862 23345
7 Distillery 11 15 365 995 376 1010 0 0
8 Narcotics 391 1338 58 90 53 204 390 1230
9 Miscellaneous
Cases & Explosives
178 482 25 120 23 68 180 534
10 Tinctures Under
M&TP
80 2309 4 16 1 35 83 2290
Total 33717 118345 2429 7865 2939 10948 33207 115262
Source: Consolidated report , Chief Chemical Examiners Laboratory
Drugs Control Department
13.27 The Drugs Control department regulates the manufacture, distribution, sale and quality of drugs
marketed in the State under the provision of the enforcement of the Drugs & Cosmetics Act 1940 and
Rules 1945 and enforces other laws like Drugs and Magic Remedies Act 1954, The Kerala Drugs and
Other Stores Act 1971, The Drugs Order 1995,The Kerala Poison Rules 1996 and NDPS Rules. The
department was formed in 1961. The regulatory agency is involved in the work of licensing inspections
, analysis of random samples of drugs and prosecution against offenders of law and other related acts
implemented by the department. There are 82 modern drug manufacturing units,171 blood banks,15
Economic Review 2011
368
blood storage centres, 44 cosmetic manufacturing units, 21 homeopathic drug manufacturing units,
929 ayurvedic drug manufacturing units, 14700 modern drugs sales premises and 687 homoeo sales
premises, 309 restricted licenses, 9 van licences,74 poison licenses and 294 poison permits in the
State. The Department has an intelligence branch to detect and prevent the sale of spurious drugs.
The Drugs Controller is the authority to approve palliative care centre as recognized medical institution
for processing oral morphine preparation.
Kerala State Aids Control Society
13.28 The Kerala State Aids Control Society and Kerala State Blood Transfusion Council ensures
the availability of safe blood to the needy patients. The Kerala State Aids Control Society plays an
important role in the prevention of HIV/AIDS epidemic. Seven blood component separation units and
35 blood storage centres have been started during [Link] Society implements various pro-
grammes with the support of National AIDS Control Organization (NACO) supported by UNAIDS
and WHO. The main programmes of the Society are Jyothis, Prathyasa, Pulari, Ushas, Blood safety,
Suraksha, Community care centre, Tele counseling etc. Details of AIDS cases reported during 2011 is
given in Table 13.12
Table 13.12
AIDS cases reported during 2011
Category AIDS cases reported Death
Male 3404 1040
Female 2136 359
Children 302 45
Total 5842 1444
Source; The Kerala State AIDS Control society
Fig:13.3
AIDS cases reported during 2011
13.29 The details of blood units collected in Blood banks in Kerala monitored by KSACS is given as
Appendix 13.3. The annual blood collection report of the Kerala State Blood Tanfusion Council is given
below in Table 13.13
Kerala State Planning Board
369
Table 13.13
Blood collection report of the Kerala State Blood Tanfusion Council during 2011
Sl No. Item Number
1 Voluntary blood collection 3701
2 Screening of Blood
a) HCV+ 11
b)HbsAg+4
c)VDRL+ 4
19
3 Blood bags used 3715
4 HIV kits used( Rapid) 44
5 HCV 44
6 Hbs Ag 44
Source: Kerala State Blood Transfusion council, Thiruvananthapuram
Nursing Education Nursing Schools
13.30 There are 15 Nursing Schools under DHS, which provides three year General Nursing course.
10 nursing schools are functioning under the State Plan schemes. Every year an annual intake of 385
students are being admitted for the General Nursing course. The infrastructure facilities of these insti-
tutions are far below the standards set by the Indian Nursing Council.
13.31 Details on the annual intake in different nursing courses during 2011 are given in Appendix 13.4.
Institute for Communicative & Cognitive Neuroscience (ICCONS)
13.32 The Institute for Communicative & Cognitive neuroscience has been formulated under Society
for Rehabilitation of Cognitive and Communicative Disorders (SRCCD).The SRCCD is a charitable so-
ciety registered under the Travancore-Cochin Literary Scientifc and Charitable Societies Act (1995) in
1998. The Institute is working in the feld of Cognitive and Communicative disorders of developmental
and acquired nature affecting persons of all ages from infancy to old age. Now the Institute provides
treatment for diseases like autism, mental retardation, learning disability, cerebral plasy, hearing im-
pairment, post stroke, central visual disorders, dementia, developmental neurometabolic disorders
etc. ICCONS has two centers, one at Thiruvananthapuram and the other at Shornur. A communitive
outreaching centre is also functioning in Kottayam district. Nearly 16000 patients have registered in
ICCONS so far. Major services available under this Institute are the following.
Neurology, OP,IP services
ENT services
Speech therapy
Psychotherapy and behavioral therapy for IPs and OPs
Physciotherapy and occupational therapy
Parental education programmes, diagnosis and counseling
Audiological rehabilitation
Training programme for teachers, parents, doctors etc
Linguistic training
Workshop and public education programme on disabilities
Research and development activities
Software development for autistic children
Multi model stimulation and psycho dynamic exercise for the rehabilitation of children with cognitive
language and motor disabilities
Special schools at Thiruvananthapuram and Shornur
Genetic and metabolic outreach
Economic Review 2011
370
Commissionarate of Food Saftey
13.33 Food Safety and Standards Authority of India has been established under the provisions of
Food Safety and Standards Act, 2006 as a statutory body for laying down science based standards
for articles of food and to regulate manufacture, storage, distribution, sale and import of food so as to
ensure availability of safe and wholesome food for human consumption. The aim of the department is
to make all edible items used by people safer. Under the Food Safety and Standards Act, the Authority
has a mandate of ensuring safety of food items imported into the country also.
13.34 District wise details of Medical and Para medical personnel under DHS during 2011 are given
as Appendix13.5.
Medical Record Cell
13.35 Medical Record Libraries provide information regarding Health care system. It is established
with the intention of maintaining medical records, medico legal documents, birth and death register
properly and to generate data for the implementation and evaluation of health care system. At present,
medical record libraries are functioning in 49 institutions in the State.
Department of Medical Education
13.36 Medical Education department plays a vital role in imparting medical needs of medical
and Para- medical personnel and to meet the health needs of society. In Kerala, medical education
is imparted through fve medical colleges at Thiruvananthapuram, Kozhikode, Kottayam and Thris-
sur districts.. Nursing Education is imparted through three Nursing colleges in Thiruvananthapuram,
Kozhikode, Kottayam, Alappuzha and Thrissur districts. Dental Colleges are functioning in Thiruvana-
nthapuram, Kozhikode and Kottayam districts. In the private sector, 17 Medical Colleges, 19 Dental
Colleges and 101 Nursing colleges are affliated under the Health University.
13.37 Medical and Para medical courses conducted in Govt. Medical Colleges with annual intake of
students under DME during 2011 is given in Appendix 13.6. List of major Medical institutions under
DME are given in Table13.14
Table 13.14
Major Government Medical Institutions under DME 2011
[Link]. Institutions No.s
1 Medical College 5
2 Dental College 3
3 Nursing College 5
4 Regional Institute of Ophthalmology 2
5 College of Pharmaceutical Science 1
6 State Board of Medical Research 1
7 Directorate of Radiation Safety 1
8 Kerala Heart Foundation 1
9 Indian Institute of Diabetics 1
10 State Institute of Sports Medicine,
MCH, Kozhikode
1
11 Para Medical Council 1
Source: Directorate of Medical Education
13.38 Details of Personnel (Clinical and Non Clinical) in Medical Colleges under DME are given in
Kerala State Planning Board
371
Appendix 13.7. Details of major Medical Institutions in the private sector is given in Table 13.15
Table 13.15
Major Medical Institutions in the Private sector
[Link]. Institutions No.s
1 Medical College 17
2 Dental College 19
3 Nursing Colleges 101
4 Ayurveda Medical college 13
5 Homoeo Medical colleges 3
6 Siddha 1
Total 154
Source: Kerala University of Health and Allied Sciences
13.39 Details of beds, patients treated and operations conducted in Government Medical College
hospitals during 2011 is given in Table 13.16
Table 13.16
Beds, Patients treated and Operations conducted in Government Medical College Hospitals
during 2011
Sl
No
Medical College Hospitals Beds Inpatients Outpa-
tients
Major Op-
erations
conduct-
ed
Delivery
cases at-
tended
1 MCH, Thiruvananthapuram 1935 66361 731416 20223 0
2 SAT, Thiruvananthapuram 1025 34383 204316 6096 4415
3 MCH, Alappuzha 1035 30000 400000 11550 7000
4 MCH, Kottayam 1400 59255 551946 20849 3977
5 Institute of Child Health and
Childrens Hospital, Kot-
tayam
204 8741 146639 1152 0
6 Medical College Hospital,
Thrissur
714 28000 600000 7500 2850
7 Chest Hospital, Thrissur 441 9000 14000 1600 0
8 MCH, Kozhikkode 2125 73056 432563 12000 0
9 Institute of Maternal and
Child Health, Kozhikkode
1100 35099 221272 6047 12155
10 Institute of Chest Diseases,
Kozhikode
100 3439 39440 300 0
Total 10079 34733 3341592 87317 30397
Source: Directorate of Medical Education
Medical Colleges
13.40 Five Government Medical Colleges are functioning at Thiruvananthapuram, Kozhikode, Kot-
tayam, Alappuzha and Thrissur districts. During 2011 Government has allotted additional fund to start
four new Medical Colleges at Idukki, Kasargode, Pathanamthitta and Malappuram districts. Standard-
ization and up gradation of the medical Colleges by equipping them with modern facilities and trained
Economic Review 2011
372
staff is very essential .The Medical Colleges are trying to complete the developmental programmes
already started to keep the Medical Council of India norms.
Box No.13.4
Major Achievements under DME during 2011
Number of seats in MBBS course has increased from 200 to 250 in Kozhikkode Medical College
New OP block, golden jubilee block, super speciality, SAT etc started functioning in Thiruvananthapuram
Medical College under the scheme PMSSY
MRI scan was introduced in Medical colleges Alappuzha ,Thrissur and Kottayam
Institute of Maternal and Child Health (IMCH) started functioning in Kozhikkode Medical college
with Central assistance and co -operation of NRHM
Post graduation courses started in Alappuzha and Thrissur Nusing Colleges
New paramedical courses and institutions started
Source: Directorate of Medical Education
State Board of Medical Research
13.41 The incentive and encouragement for research initiatives and paper presentations at interna-
tional forums from the teaching institutions is promoted through this scheme. The idea is to provide
funds for those who present papers or chair sessions in international conferences, on the lines of
Government of India norms.
Child Development Centre
13.42 Child Development Centre was initiated as a project during 1987, to develop feasible strategies
for a policy change towards proactive anticipation of childhood disability and adolescent problems
rather than a passive attempt at provision of rehabilitation services alone. Child Development centre
provides support services for elderly care, pre- marital counseling, womens health issues, youth wel-
fare, and other related felds. The Centre has been able to visualize a conceptual framework of a valid
link between childhood disability, low birth weight babies and adolescent girls, under nutrition which it
has demonstrated conclusively, with scientifc evidence. With the establishment of 15 new Specialty
units, the Centre can provide state -of - the-art services to the needy. At present the Centre undertakes
activities such as research, public health awareness programme, clinical activities, distance education
programme, community extension programme etc
Regional Cancer Centre
13.43 The Regional Cancer Centre (RCC), Thiruvananthapuram, was established in 1981. The Re-
gional Cancer Centre is an internationally recognized centre for conducting a wide range of cancer
research and providing state-of-the-art facilities for cancer diagnosis, treatment, palliation and reha-
bilitation. The total bed strength in the RCC is 370, of which 95 are day care beds. Epidemiological
studies have shown that 70-90% of all cancers are environmental. Appropriate changes in lifestyle can
reduce the mortality and morbidity from a good proportion of cancer and heart diseases. Details of
cancer patients treated as age group wise are shown in Chapter 12. A total number of 11634 patients
were treated during [Link] details of leading sites of Cancer and Patients treated by sex in RCC
during 2011 is given in the following Table 13.17
Table 13.17
Details of leading sites of Cancer and Patients treated by sex in RCC during 2011
Kerala State Planning Board
373
Sl No Male Female
Site patients
treated
Death re-
ported
Site patients
treated
Death
reported
1 Oral Cavity 841 24 Breast 1732 51
2 Lung 836 70 Thyroid gland 745 1
3 Leukemia 501 77 Cervix uteri 472 11
4 Lymphoma 329 32 Oral cavity 373 9
5 Stomatch 306 15 Leukemia 340 53
6 Pharynx 284 13 Ovary 300 17
7 Larnx 221 10 Lymphoma 199 10
8 Prostate 214 9 Corpus uteri 169 5
9 Rectum 213 5 Lung 149 3
10 Oesphagus 209 2 Rectum 146 10
11 Others 1872 117 Others 1190 70
Total 5812 374 Total 5822 240
Source: Regional Cancer Centre, Thiruvananthapuram
Malabar Cancer Centre
13.44 Malabar Cancer Centre is an autonomous institution under Health & Family welfare Depart-
ment registered under Societies Registration Act XXI of 1860 and clinical work in MCC started from
March 2001 onwards. The main objective of the Centre is not only to provide comprehensive cancer
care, particularly to patients in north Kerala, but also to develop as a Research and Training Centre
of international standards. The present activities include out patient services, surgery, palliative care,
diagnostic services etc. Details of cancer patients treated at Malabar Cancer Centre is given below in
Table 13.18
Table 13.18
Details of Cancer Patients treated at Malabar Cancer Centre during 2011
Sl No. Item Number
1 New Cases treated 3729
2 Number of Beds 110
3 Major operations conducted 551
4 Minor Operations conducted 95
Source: Malabar Cancer Centre
13.45 As a part of patient welfare activities all inpatients are given mid-day meal free of cost. The
Malabar Cancer Centre offers two courses Certifcate course in Oncology nursing and Nursing As-
sistant course. Interactive discussions on specifc topics, lectures on recent trends in oncological care
journal club etc are carried out as apart of regular academic activities. Apart from regular academic
programmes, continuing medical education programme for doctors and post graduate students of
nearby Medical colleges are organized in collaboration with IMA. A scientifc Committee and Ethics
Committee have been constituted for conducting clinical studies in the Centre.
Indian Institute of Diabetes
13.46 Indian Institute of Diabetes set up in 2001 at Pulayanarkotta, Thiruvananthapuram as a joint
Economic Review 2011
374
venture of Government of Kerala and World India Diabetic Foundation is registered as an independent
society under the Charitable Literary and Scientifc Societies Registration Act. It is an autonomous
institute engaged in the service of improving the life of people with diabetics. For this, the institute has
been focusing on education of both patients and health care providers and develops and conducts
outstanding research in the feld of diabetics. The Institute is currently providing diabetics OPD service
both at Pulayanarcotta and at the city centre in the Public health lab campus.
State Institute of Sports Medicine
13.47 The absence of a comprehensive sports medicine facility makes it diffcult to meet the medical
needs of the sportsmen and sports women. The number of professional sportsmen and women are
increasing at a fast pace .Hence Sports Medicine has emerged as an important medical speciality. The
State Institute of Sports Medicine Centre at Medical College, Kozhikode caters to the much felt need
of sportspersons for specialized medical care.
Kerala University of Health and Allied Sciences
13.48 The Kerala University of Health and Allied Sciences was established by an Ordinance in 2009
and commenced its activities from 2010-11. Now it has started functioning in the premises of Govern-
ment Medical College, Thrissur. This university is established for the purpose of ensuring proper and
systematic instruction, training and research exclusively in all systems. There are 226 health care
professional colleges University and 110 UG and PG courses affliated to it which includes all systems
of medicines such as Alopathy, Ayurveda, Homeopathy, Sidha ,Unani, Yoga, Naturopathy, nursing
,Pharmaceutical science and paramedical courses. Kerala University of Health sciences has given
affliation for 42 Colleges and 246 courses and thereby gave opportunity to 3800 students. The univer-
sity has implemented online transmission of question papers for the frst time in Kerala. The University
has conducted research methodology workshop in collaboration with ICMR for medical faculties for
the frst time in Kerala
Ayurveda
13.49 Ayurveda is a science dealing not only with treatment of some diseases but also a complete
way of life. Indian System of Medicine department renders medical aid to the people through the
network of Ayurveda hospitals and dispensaries, grant-in-aid Ayurveda institutions, Sidha- Vaidya,
Unani ,Visha , Netra and Naturopathy . Special hospitals such as Mental Hospital, Panchakarma , Na-
ture cure and Marma hospitals are functioning under this department. List of major institutions under
ISM department is given in Table 13.19
Table 13.19
Institutions under ISM department 2011
Sl No. Item Number
1 Ayurveda hospitals 119
2 Ayurveda dispensaries 745
Speciality hospitals
3 Mental hospital(Kottakkal) 1
4 Nature cure hospital(Varkala) 1
5 Marma hospital( Kanjiramkulam) 1
6 Visha hospital(Kadampanadu
(Pathanamthitta), Vadakkanchery
and Madakathara (Thrissur).
3
7 Panchakarma hospital (Alappuzha) 1
Kerala State Planning Board
375
Sl No. Item Number
8 Sidha hospital(Tvpm- Vallakkadavu) 1
9 Unani (Kasargod) 1
10 Oushadhi(Thrissur) 1
Source: ISM department
13.50 District wise distribution of institutions, beds and patients treated under ISM department during
2010& 2011 is given in Appendix 13.8
Ayurveda Medical Colleges
13.51 There are 3 Government Ayurveda Medical Colleges situated at Thiruvananthapuram, Thrippu-
nithura and Kannur districts. The total bed strength in these Medical colleges is [Link] hospitals
are functioning under Ayurveda college, Thiruvananthapuram.
Government Ayurveda Medical college Thiruvananthapuram
Government Ayurveda college hospital for Women and children, Thiruvananthapuram
Government Ayurveda Panchakarma hospital Thiruvananthapuram
13.52 The three hospitals under this college have a total bed strength of 620 patients. Dietary articles
and medicine are supplied to the patients. 13 private Ayurveda medical colleges are also functioning
in the State. The details of beds and patients treated in Ayurveda Medical Colleges 2011 are given in
Table 13.20
Table 13.20
Beds and Patients treated in Ayurveda Medical Colleges during 2011
(No.)
Sl No. Medical College Hospital In patient Outpatient Beds
1 Government Ayurveda College hos-
pital Thiruvananthapuram
5518 140519 620
2 Government Ayurveda College hos-
pital Thrippunithara
2449 184092 489
3 Government Ayurveda College hos-
pital Kannur
1105 62110 150
4 Minor Operations conducted 95
Total 9072 386721 1259
Source: Directorate of Ayurveda Medical Education
13.53 The Ayurveda Medical Colleges imparts ayurveda medical education on BAMS and PG courses.
There are two aided colleges, 11 self fnancing colleges and one self fnancing siddha college for imparting
Ayurveda medical education. These institutions function as per the norms and regulations of CCIM/
AYUSH under Government of India. Annual intake of students and courses in Ayurveda Medical col-
leges are given in Appendix 13.9
Oushadhi
13.54 The institution was originally established as Sree Kerala Varma Ayurvedic Pharmacy in 1941
under the patronage of the Maharaja of Cochin, for supplying medicines to Govt. Ayurvedic Hospitals
in Cochin .In 1959, this unit was converted and registered as Co-operative Pharmacy & Stores Lim-
ited, Thrissur. On 8th September 1975, this was incorporated under the Companies Act, 1956 and
was renamed as The Pharmaceutical Corporation (Indian Medicines) Kerala Limited, Thrissur. Now
OUSHADI is the largest manufacturer of Ayurvedic medicines all over India in Government sector
functioning especially as a proft making public sector undertaking. Oushadhi is the exclusive supplier
Economic Review 2011
376
of Ayurvedic medicine to 1016 Government hospitals and dispensaries of ISM department. In Kerala
Oushadhi supplies `18-20 crores of medicines each year to State ISM department at 40 % less than
market price and ISM department supplies this medicine to the poor patients in the State free of cost.
The Company also caters to the demand of the public through a network of 468 exclusive agencies
spread all over the State. The details of turnover for the period from 2006-07 to 2010-11 are given
below in Table 13.21.
Table 13.21
Details of turnover for the period from 2006-07 to 2010-11
(` lakhs)
Year. Capital
Received
Sales to ISM
Department
Total Sales Proft be-
fore Tax
Proft
after Tax
Dividend
paid to Govt.
of Kerala
2006-07 88.00 701.82 2157.30 215.62 136.21 29.50
2007-08 25 733.39 2547.79 313.55 204.44 37.31
2008-09 250 682.89 3226.41 248.97 171.93 41.88
2009-10 380 1032.82 3793.46 622.99 400.58 54.33
2010-11 400 733.37 4530.44 1022.07 669.40 100.00
(proposed)
Source: The Pharmaceutical Corporation (IM) Kerala Ltd.,Thrissur
13.55 Kerala Ayurvedic Studies and Research Society is functioning at Kottakkal in Malappuram
to promote research and studies in Ayurveda.
Panchakarma Hospital
13.56 Panchakarma hospital, Poojappura, Thiruvananthapuram is one of the prestigious institution
under Ayurveda Medical Education. This hospital is imparting specialized Panchakarma treatment.
It is proposed to convert this centre into a National Institute of Panchakarma and Research Centre.
Homoeopathy
13.57 The Homoeopathy department was formed in [Link] is being accepted more and
more by the public as a system of treatment especially because of its economy, easy treatment and
absence of side effects. There are 526 homoeopathic dispensaries and 30 hospitals with a total bed
strength of 945 under Homoeopathy department in the State. In addition, Kerala State Homoeopathic
Co-operative pharmacy (HOMCO) Alappuzha, a medicine manufacturing unit is also functioning under
the Directorate of Homoeopathy. Details of major medical institutions under Homoeopathy is given
in Table 13.22.
Table 13.22
Major Institutions under Homoeopathy Department
[Link]. Name of Institution Nos / Place
1 Homoeo Hospitals
District hospitals-13
Taluk hospitals -17
30
2 Homoeo Dispensaries -
General-486
SCP -42
TSP -23
551
3 HOMCO (Alappuzha) 1
Total 582
Source: Directorate of Homoeopathy
Kerala State Planning Board
377
Fig:13.4
Major Institutions under Homoeopathy
13.58 District wise distribution of institutions, beds, and patients treated under Homoeopathic
department during 2010 &2011 is given as Appendix 13.10.
Homoeo Hospitals
13.59 Out of 30 homoeo hospitals, 13 are District homoeo hospitals and 17 are Taluk hospitals. To-
tal bed strength in these hospitals comes to 945. All hospitals were provided with wheel chairs and
[Link] labs started in 17 hospitals. District wise details of beds and patients treated in
Homoeo hospitals during 2011 is given in Table 13.23
Table 13.23
District wise details of Beds and Patients treated in Homoeo hospitals during 2011
( No.)
[Link]. District hospitals inpatients outpa-
tients
beds
1 Thiruvananthapuram 4 1387 178519 185
2 Kollam 3 1153 111653 75
3 Pathanamthitta 0 0 0 0
4 Alappuzha 3 1096 159707 75
5 Kottayam 3 1450 195539 150
6 Idukki 2 825 69147 50
7 Ernakulam 3 6330 163429 75
8 Thrissur 1 538 49910 25
9 Palakkad 1 564 76979 25
10 Malappuram 2 8376 164047 50
11 Kozhikode 3 11117 269417 75
12 Wayanad 1 1210 29539 25
13 Kannur 1 4582 45889 25
Economic Review 2011
378
[Link]. District hospitals inpatients outpa-
tients
beds
14 Kasaragod 3 2080 131789 75
Total 30 40708 1645564 910
Source: Directorate of Homoeopathy
Homoeo Dispensaries
13.60 At present, there are 551 Homoeo dispensaries in the Homoeopathy department of which
42 are in SC area and 23 in tribal areas. 426 dispensaries has been equipped with modern clinical
equipments. Every year 15 or 16 temporary dispensaries are functioning at various pilgrim centres
throughout the State.
Seethalayam
13.61 Seethalayam is the frst gender based scheme launched in 2010-11 for empowering womens
mental, physical and social health. At present Seethalayam units are functioning in Kozhikkode, Thiru-
vananthapuram and Kottayam districts. The department proposes to extend the services of Seetha-
layam to all the 14 homoeopathic hospitals in the State. Details of services rendered through these
units are given in chapter 14.
Box No.13.5
Major Achievements under Homoeopathy
Preventive medicines were distributed to 17 lakh persons
2850 medical camps and health awareness programmes were conducted
School health Programme is conducted in 28 selected schools
Speciality clinics were started in 13 district hospitals
Three regional medical stores were started in Kottayam,Malappuram and kannur districts
All homoeo hospitals (30 number ) and 204 dispensarie were computerized
Seethalayam units conducted 17 public awareness programmes
Source: Directorate of Homoeopathy
The Kerala State Homoeopathy Co-operative Pharmacy Ltd.
Alappuzha (HOMCO)
13.62 The Kerala State Homoeopathy Co- operative pharmacy limited (HOMCO) is engaged in the
manufacture and sale of Homoeopathic medicines. This centre is the sole supplier of medicines to
hospitals and dispensaries under Department of Homoeopathy since 1960. The HOMCO is the one
and only pharmacy functioning in the public sector with assistance from Central and State Govern-
ments in the feld of manufacture and sale of medicines. The AYUSH Department has provided over
`90 crores for purchase of essential drugs to various states for running the dispensaries in the rural
sector. The production of drugs in the Pharmacy has gone up during the last fve years as shown below
in Table 13.24
Table 13.24
Details on the Production of Medicines during 2006-07 to 2010-11
( `in lakhs)
Sl. No. Year of Pro-
duction
Production of
Medicine in
Value
Net Proft
1 2006-07 345.00 60.78
Kerala State Planning Board
379
Sl. No. Year of Pro-
duction
Production of
Medicine in
Value
Net Proft
2 2007-08 573.00 106.00
3 2008-09 661.00 168.77
4 2009-10 897.00 203.39
5 2010-11 904.00 212.00
Source: The Kerala State Homeopathy co-operative Pharmacy Ltd. Alappuzha
13.63 The HOMCO having ISO 9001-2008 and GMP certifcate, possesses medicinal plant frm to
cultivate and preserve rare and genuine herbs which is funded by NMPB.
Homoeo Medical Education
13.64 The Homoeo Medical Education department is formed to promote education, imparting re-
search and training in the feld of homoeopathy in Kerala. There are two Govt. Homoeopathic Medi-
cal Colleges, one functioning at Thiruvananthapuram and the other at Kozhikode. Hospitals attached
with Govt. Homoeo Medical Colleges are functioning with 100 beds. BHMS and PG Courses are
conducted in these colleges.
13.65 Three institutions are functioning in the private sector viz, (i) ANSS Homoeo Medical College,
Kottayam (ii) [Link] Memorial Homoeo Medical College, Ernakulam and (iii) Shree Vidyadhiraja
Homoeo Medical College, Thiruvananthapuram.
13.66 Annual intake of students and courses in Homoeo Colleges are given in Appendix 13.11.
Co-operative Sector
13.67 There are 74 co-operative hospitals with 6767 beds and 869 doctors and 4286 nurses and para
medical staff in Kerala. District wise details of infrastructure under Co-operative sector are given in
Appendix 13.12.
Insurance Medical Services
13.68 There are 12 ESI hospitals with 730 beds in the State. Institution-wise details of ESI hospitals,
beds, inpatients, outpatients, major operations, minor operations etc are given in Appendix.13.13.
National Rural Health Mission (NRHM)
13.69 NRHM was introduced in the country on April 12, 2005. It started functioning by the end of
August 2006. Kerala has implemented the activities of National Rural Health Mission effectively for
attaining the goals and objectives of National Population Policy and Millennium Development Goals.
The mission aims to provide accessible, affordable and accountable quality health services to the
poorest households in the remotest rural regions. The thrust of the Mission was on establishing a fully
functional, community owned, decentralized health delivery system with inter-sectoral convergence at
all levels, to ensure simultaneous action on a wide range of determinants of health like water, sanita-
tion, education, nutrition, social and gender equality. Under NRHM, the focus is on a functional health
system at all levels, from the village to the district. Major activities undertaken by NRHM are
Janani Suraksha Yojana
Civil works of health institutions
Conducting health awareness classess
Temporary appointment of health staff
Urban RCH and tribal health
Economic Review 2011
380
School health programme
Adolescent Reproductive and Sexual Health
Sneha Santhwanam to the endosulphan victims
ASHA workers programme
Paliative care
Lifestyle diseases control programme
Radio health programme
Quality assurance(NABH accreditation)
Supply of grant to health institutions
Box No.13.6
Achievements under NRHM
More than 422 palliative care units were established under palliative care project
Under Janani Suraksha Yojana fnancial assistance were given to women at the rate of
Rs.700 under panchayath area and Rs. 600 under Corporation area and the scheme ben
efted 47669 benefciaries in the State.
Through the Gender Based Violence Management centres a total of 2285 cases of GBV
were addressed
The school health programme benefted 99263 students
19560 Ward health Sanitation Committees are functioning in the State.
115 CHCs were upgraded to IPHS standards.
The Kerala Emergency Medical Services Project (KEMP) started in 2010 at Thiruvananth
puram district as a pilot project saved the life of 30,000 citizens in the district.
Conducted 189931 number of ward level nutrition days during 2009-10 and 142617 nutrition
days during 2010-11
Conducted awareness programmes through distribution of brief descriptions, fip books
and booklets on various subjects, conducting street dramas, exhibitions, magic, wall writings,
rallies etc
Preparation and distribution of Arogya keralam news letter, awareness creation [Link] and
documentaries and co-ordination of Government gazettes
3419 smart cards issued to endosulphan victims
Source: DHS & NRHM
Box No.13.7
The School Health Programme
In Kerala the School Health Programme started from October 2008 as a unique joint venture of the
NRHM, Departments of Health, Education, Sports, Council and Local Self Government. It aims to
introduce a unique concept of a comprehensive Health card, the School TC & Health Record, for
every student. The medical details and personal details of the childs health is recorded in this Health
Record named Minus 2 to Plus 2. This Health Record serve as a comprehensive document of
each student as the Transfer Certifcate and Conduct Certifcate are also incorporated into it. Com-
prehensive health services including the services of specialist doctors on fxed days are planned as
a part of this programme. Now he scheme has implemented in 1156 schools in the State.
Source: NRHM
Kerala State Planning Board
381
Accredited Social Health Activist (ASHA)
13.70 Under the implementation framework for the NRHM, the scheme of ASHA has now been ex-
tended to almost all States including, of course, the 18 high focus States. The Accredited Social Health
Activists (ASHAs) are recruited under Government of India Flagship programme of NRHM. Main re-
sponsibility of the ASHA workers are to help the weaker sections of society to make them aware of
the available health services and help them to achieve and protect such services. In Kerala the role
of ASHA workers has been extended to other felds like prevention and control of Communicable dis-
eases, identifcation and control of non-Communicable diseases, palliative care etc. There are 31838
number of ASHA workers throughout the State. The activities entrusted upon them are given below
Create social and health awareness among people
Provide health services to pregnant women and children
Birth registration, immunization and pre-natal care
Analyze the health issues in the locality and work along with the health and sanitation
committees to fnd solution for these issues
Take part in the communicable diseases control and mosquito eradication programmes
Inform the health workers about the details of new born babies and pregnant women
Distribution of Nirodh, tablets for prevention of pregnancy, O.R.S, medicine for TB etc.
Medical Services Corporation
13.71 The Kerala Medical Service Corporation was registered as a company on 28th December 2007
and started functioning from 1st April 2008 for the purchase, storage and distribution of quality drugs,
surgical items, medical equipments etc for the hospitals in the Health Services department at low cost.
At present the Corporation is having 14 district Drug warehouses in the State which were previously
functioning as District Medical Stores of the Health service department. The other main projects for
which the KMSCL provides medicines are Intra Dermal Rabies Vaccine (IDRV) project, medicine kit to
ASHA workers under NRHM project, ICDS medicine kits for Anganwadi workers, State Palliative care
Programme, Mental Health Programme, Sickle Cell Anemia Control Programme and non communi-
cable disease control programme.
Sports Ayurveda
13.72 A special wing called Sports Ayurveda has been formed by the department of Indian Systems
of Medicine in collaboration with selected district sports councils .The Sports Ayurveda cell has been
formed to manage the health issues of sportspersons and in the prevention, diagnosis, treatment and
rehabilitation of sports injuries. A number of masseurs had been sent to Delhi for training in view of the
Commonwealth Games and Asian Games in which their services were of immense help. The Sports
Ayurveda wing has emerged as a specialty to be encouraged. Its research and treatment programme
has started in Ernakulam and Kannur with the support of the District Sports Councils.
Major Diseases prevalent in Kerala
Cancer
13.73 Cancer affects different body organs due to a variety of factors. Among men, the majority of
cancers are found in mouth and throat, lung, stomach etc. and in women, they are found in large
numbers in cervix, breast, mouth and throat. It is estimated that almost 5 lakhs of persons will develop
cancer every year in the country and in any given year there will be almost 15 lakhs cancer patients..
In Kerala, 35000 new cases are detected every year. Nearly one lakh people are under treatment for
these diseases annually. By controlling the contributing factors and early detection the diseases can
be prevented to some extent. It is recognized that some cancers can be prevented. Most mouth can-
Economic Review 2011
382
cers can be prevented by not chewing tobacco and most lung and throat cancers can be prevented
by avoiding smoking. Medical Colleges, Regional Cancer Centre, Malabar Cancer centre and Gen-
eral hospital Ernakulam offers treatment for Cancer patients. Cancer Care Programmes were imple-
mented under State Plan during 2011-12. This programme emphasizes the importance of increasing
awareness and making the diagnostic and therapeutic services more accessible to people. Early
detection of diseases and provision of awareness is the best method for prevention.
Life style diseases
13.74 Diseases such as heart disease, stroke, high blood pressure, cancer and diabetes are called
modern lifestyle diseases. It is estimated that there are about 1.5 million diabetic subjects in Kerala.
These people need life time management involving lifestyle modifcations, drugs and proper diet. Re-
cent surveys in different categories of subjects in Kerala reveal that one out of three adults in Kerala
is hypertensive. Hyper tension leads to heart attacks, stroke and kidney failure and it is a life long
disease and needs careful and sensible management throughout life. Non Communicable Diseases
especially cardiovascular diseases, cancer, Type 2 diabetics mellitus account for 53% and 44% of all
deaths and disability. Alcohol consumption is increasing day by day. According to (WHO) estimates,
there are about 2 billion people who consume alcoholic beverages and 76.3 million with diagnos-
able alcohol-use disorders. Excessive drinking can cause a variety of health problems. In the case
of accidents on national highways, more than 72 per cent were related to drunken driving. Domestic
violence is also on the increase due to high alcohol consumption. Alcohol related diseases are grow-
ing. Chronic alcohol use can lead to adverse immunological consequence. Similarly, overweight and
obesity leads to heart attack, hypertension, breast cancer, and diabetes and joint problems.
Box No.13.8
Life Style diseases control Programme
NRHM implemented the Life Style diseases control Programme in the State during 2009 as
a pilot initiative at Wayanad and Thiruvananthapuram districts. As apart of this, details of all people
above 30 years are collected through ASHA workers . Besides early detection of diseases/medi-
cal camps for disease control , training to medical offcers and feld level health workers [Link]
also conducted . Life Style diseases clinics, special monthly clinics, provision of free treatment and
medicine were also conducted.
Source: NRHM
Box No.13.9
Measures to control Non Communicable diseases by DHS
New Cancer detection centers were opened in major hospitals
Diabetics clinics were started in major hospitals . Special care to diabetics patients,
screening and free supply of medicines were provided through these clinics
Dialysis units were established in major hospitals for helping the weaker sections of society.
New de-addiction centres, suicide prevention clinics, adolescent clinics and gender
based violence prevention clinics were opened in district hospitals and Taluk Head
Quarter hospitals
Tobacco control programme was launched for controlling tobacco use.
Source: Directorate of Health Services
HIV/AIDS
13.75 The estimated number of people infected with HIV in Kerala is 55167. The route of HIV trans-
Kerala State Planning Board
383
mission in Kerala is categorized as heterosexual 82%, homosexual 2%, through injection, drug use
7.85%, mother to child 7%, through blood /blood products 1% and unspecifed 5.5%. The prevalence
among pregnant women attending Antenatal Clinics (ANC) as per the 2007 sentinel surveillance round
is 0.38 %.The HIV epidemic in Kerala is a concentrated epidemic with more than 7.6% of Injecting
Drug Users (1DUs) infected and only 0.96% of Men having Sex with Men (MSM) and 0.87% Female
Sex Workers (FSWs) being infected. Although HIV prevalence among FSWs and MSM are under 1%,
the prevalence among IDUs is more than 7% .The HIV epidemic in the state is largely confned to in-
dividuals with high-risk behavior and their sexual partners.
Common Communicable Diseases
13.76 Communicable diseases such as Dengue, Malaria, leptospirosis, Hepatitis, Chikungunya, HINI
fever, Malaria etc are increasing every year. Thiruvananthapuram district is almost endemic to Dengue
and reporting about two thirds of cases in the State. Presence of co- morbidity is a major problem
which leads to mortality in case of communicable diseases which affects liver. Major problems in this
area are given below.
Lack of peripheral centres for early detection
Lack of Rapid Diagnostic Test (RDT) kits in health institutions
Lack of safe drinking water and unhygienic environment
Problem of migrant labourers
Lack of manpower in urban areas
13.77 Prelevance of principal communicable diseases during 2011 is given in Table 13.25
Table 13.25
Prevalence of Principal Communicable Diseases 2011
[Link]. Diseases 2010 2011 upto September
beds
Attack Death Attack Death
1 Acute Diarrheal Diseases 370389 5 150023 1
2 Diphtheria 0 0 6 0
3 Tetanus 6 0 7 0
4 Neonatal Tetanus 0 0 1 0
5 Whooping cough 65 0 7 0
6 Measles 3342 2 983 0
7 Chickenpox 9456 4 3199 0
8 Acute Respiratory Infection 6054396 123 2114537 39
9 Pneumonia 19764 50 12103 12
10 Enteric fever 4529 0 1386 0
11 Dengue fever 2597 17 514 0
12 Viral-Hepatitis-A 5181 6 1787 2
13 Viral-Hepatitis-B 630 8 302 6
14 leptospirosis 1016 85 488 42
15 J apanese encephalitis 20 5 31 1
16 Meningococcal meningitis 52 1 29 1
17 Rabies 9 0 9 0
Economic Review 2011
384
[Link]. Diseases 2010 2011 upto September
beds
18 Syphilis 5 0 1 0
19 Gonocologcal infection 80 0 19 0
20 Tuberculosis 12599 97 6923944 45
21 Other diseases 21330188 3837 6923944 2061
Source : Directorate of Health Service
Mental Health
13.78 Mental health is a balance between all aspects of life like emotional, economical, and spiritual
as well as physical which shows how we feel and think about our self, others and how we face lifes
situations. Mental health problems including higher suicide rates, health problems and death due to
road traffc accidents are increasing. The suicide rate of women in Kerala, stands at 31 per 100,000
which is the highest reported anywhere in the world. Rates of suicide are higher among those with
physical disorders than among other people, this is especially marked in elderly people. Depression
is associated with reduced levels of functioning of immune system and an increased risk of other
physical disorders (World Health Report, 2001). People suffering from chronic physical conditions
such as heart disease, diabetes and cancer have a heightened probability of developing mental dis-
orders such as depression. (Mental Health Context, WH0, 2003). Rates of suicide are higher among
those with physical disorders than among other people. An important fnding of the WHOs world
mental health survey is the high percentage of people who seek mental health care through general
health services and professional services At present there are three Mental health centres in Kerala.
Separate de-addiction units are also functioning in these Mental health units. All district hospitals have
psychiatric units. Similarly 12 Taluk headquarter hospitals have psychiatric units. Setting up of De-
addiction centres in Thiruvananthapuram ,Kollam, Palakkad and Wayanad districts are progressing.
The District Mental Health Programme Thiruvananthapuram was launched in [Link] main activities
of the programme are IEC,training and outreach Mental Health clinics in PHCs, CHCs and THQs in
Thiruvananthapuram district. These patients are regularly monitored with periodic examination by dis-
trict mental health team and provides free medicine. 14000 patients were registered in this programme
so far. Mental Health facilities in Kerala during 2011 is given in Table 13.26
Table 13.26
Mental Health Services in Kerala during 2011
Sl No No. of Institution No. of beds
1 Facilities
a Mental Health Centres 3 1342
b Medical Colleges 5 160
c General Hospitals 11 4866
2 Number of Psychiatrists 60
3 Clinical Psychologists 14
4 Psychiatric social worker 14
5 Occupational therapist 1
Source: Directorate of Health Services
Kerala State Planning Board
385
Box No 13.10
Health Tips
Eat healthy diet
Avoid tobacco and alcohol use
Check BP and blood sugar after 30 years
Control diet and do exercise
Adopt healthy life styles
Source: Directorate of Health Services
IRDV clinics
13.79 The problem of stray dogs is increasing. When an individual is infected with Rabies death is
unavoidable. But we can prevent death by giving anti rabies vaccine. For this purpose, anti rabies
vaccine clinics were started in all District, General, Taluk headquarter hospitals and selected CHCs.
District wise details of hospitals giving Rabies vaccine during 2010 and 2011 is given in Table 13.27
Table 13.27
District wise details of hospitals giving Rabies vaccine during 2010 and 2011
(No.)
Sl No. District 2010 2011
institutions Vaccine
given
institutions Vaccine given
1 Thiruvananthapuram 7 30614 7 29901
2 Kollam 25 37405 25 27860
3 Pathanamthitta 49 22590 49 17480
4 Alappuzha 23 4966 23 4297
5 Kottayam 14 13709 14 15281
6 Idukki 17 9139 17 10330
7 Ernakulam 18 30082 18 29975
8 Thrissur 17 12038 17 12302
9 Palakkad 24 29622 24 27616
10 Malappuram 7 8055 7 8259
11 Kozhikode 29 33370 29 14951
12 Wayanad 12 9511 12 7413
13 Kannur 17 20253 17 16683
14 Kasaragod 17 8278 17 8216
Total 276 269632 276 230564
Source: Directorate of Health services
Immunization coverage
13.80 Kerala has almost attained universal immunization. During 2009-10, the coverage of BCG was
522768. Similarly the coverage of DPT, Polio, Measles and TT for pregnant women is shown in the
table given below. The coverage of immunization programmes in Kerala during 2010-11 and 2011-12
is given in Table.13.28
Table 13.28
Economic Review 2011
386
Coverage of Immunization Programme in Kerala 20010-11 and 211-12 (No.)
SL No Programme benefciaries
2010-11
benefciaries
2011-12
1
DPT 536416 224380
2
Polio 537497 2671648
3
BCG 522768 374475
4
Measles 508683 360249
5
TT for Pregnant Women 510394 346921
6
TT for 5 years 418791 264636
7 TT for 10 years 392459 145080
8 TT for 16 years 324696 185585
Prophylaxis against nutritional anemia
1. Women 376099 38558
2. Children NA
Source: Directorate of Health services
Kerala State Planning Board
387
Family Welfare
13.81 The Family Welfare Programme in Kerala is being implemented through a network of PHCs,
Community health centres and sub centres. Family welfare programmes is also implemented by private
hospitals and clinics as well as non-governmental organizations. Keralas achievement in family welfare
front has been impressive in terms of major indicators viz. birth rate, death rate, maternal mortality
rate, infant mortality rate, couple protection rate etc. District wise details of family welfare programmes
and couples protected by effective family planning methods are given in Appendices-13.19 and 13.20.
Drinking Water Supply
13.82. Demand for water is increasing due to multitude of human activities in the country. The pri-
mary responsibility of providing drinking water facilities in the country rests with the respective State
Governments, though the Centre formulates policies and guidelines for the sector, and supplements
the efforts of State Governments by providing technical and fnancial assistance under the centrally
sponsored Accelerated Rural Water Supply Programme (ARWSP), now renamed as National Rural
Drinking Water Programme (NRDWP). Department of Drinking Water Supply, MoRD, GoI, formulates
guiding policy, sets standards, and provides funds and technical assistance to the states for rural water
supply and sanitation (RWSS). In 1986, the National Drinking Water Mission (later named as the Rajiv
Gandhi National Drinking Water Mission in 1991) was launched and further in 1999, the Department of
Drinking Water Supply was created to provide a renewed focus with a mission approach to implement
programmes for rural drinking water supply.
13.83. The 73rd and 74th amendment to the constitution has been a landmark policy shift towards
empowerment of Panchayats as the 3rd tier of government, and which provided for a greater role
of communities in provision of drinking water. Rural water supply has been included in the Eleventh
Schedule of the Constitution among the subjects that may be entrusted to Panchayats by the States.
Child Immunization dropout
Fig:13.5
Economic Review 2011
388
The focus of Government under the Rural Water Supply Programme was on coverage of habitations.
Coverage in this context referred to providing water, at a specifc norm of 40 litres per day per capita
(lpcd) with a source available within a walking distance of 1.6 km. in the plains or elevation of 100
metres in hilly areas, with one source available for every 250 persons (50 families). The frst coverage
data generated was based on the Nation-wide habitation survey conducted through the State Govern-
ments in 1991, revalidated in 1994 and updated in 1999. The status was again surveyed in 2003, with
the results validated in 2006 through the Indian Institute of Public Administration. These surveys classi-
fed all habitations in three categories Not Covered (NC) getting less than 10 lpcd, Partially Covered
(PC) getting between 10 and 40 lpcd, and Fully Covered (FC) getting more than 40 lpcd. A new cat-
egory Slipped Back, refecting the habitations which had moved from FC to NC/PC came into usage.
However, from 2009, the service level has been left to the States to decide with the condition that the
basic 40 lpcd level should be achieved for all habitations before taking up higher norms for any area.
13.84. In an attempt to better monitoring the progress made by cities and state governments in achiev-
ing the objectives of improved service delivery, the Central Ministry of Water Resources has developed
the Standard Service Benchmarks (SSB). The SSB have changed the defnition of coverage of water
supply from the earlier census based defnition to now included direct household connections for each
household. Integrated Management Information System (IMIS) is a comprehensive web based infor-
mation system, which enables the states and the center to monitor the progress of coverage of habita-
tions, rural schools and Anganwadis through a common monitoring format. This is an important shift
from the past when water service delivery was measured by a singular measure of coverage, where
the defnition of coverage did not incorporate a modern benchmark.
13.85. According to Census 1991, 55.54% of the Indian population had access to an improved water
source. As per Ministry of Drinking Water and Sanitation, GoI, 89 % of population in the country have
access to drinking water in 2011. Even if the existing schemes have greatly increased the coverage
of safe drinking water in the rural areas of the country, the provision of drinking water to rural areas
is fraught with problems. Many habitations which once came under the covered status have been
Kerala State Planning Board
389
found to slip down to the partially covered or even uncovered status, refecting adversely on the
effectiveness of the various schemes being run for the purpose. The supply of water is inadequate
and irregular, the quality falls below the safe drinking water standards stipulated by the Central Pollu-
tion Control Board, the water supply infrastructure created under these schemes have been found to
be badly maintained and often run at sub-optimum levels, forcing huge coping costs on the people.
Though these schemes have managed to create an access to drinking water in areas they cover, they
have not been able to sustain the quality and quantity of supply required, and thus not had the desired
effect on the lives of the benefciaries.
Bharat Nirman Rural Drinking Water
13.86. Bharat Nirman, a programme to build rural infrastructure, was launched by the Government of
India in 2005. Phase-I of the programme was implemented for the period 2005-06 to 2008-09. Phase
II is being implemented from 2009-10 to 2011-12. Rural drinking water is one of the six components
of Bharat Nirman. During the Bharat Nirman Phase-I period, 55067 un-covered and about 3.31 lakh
slipped-back habitations were to be covered with provisions of drinking water facilities and 2.17 lakh
quality-affected habitations were to be addressed for water quality problem in India. Against 55067
uncovered habitations to be covered during the Bharat Nirman period, 54440 habitations have been
covered during Phase-I. During 2009-10, 251 habitations out of the targeted 586 habitations were
covered.
Table 13.29
District wise Slipped Back Habitations in Kerala (2011-12)
Sl No
District Total Habitation Slipped
Back Hab-
itaiton
% to Total
Habitation
1 Thiruvanantha-
puram
1038 196 18.88
2 Kollam 1023 0 0
3 Pathanamthitta 640 0 0
4 Allappuzha 808 78 9.65
5 Kottayam 888 78 8.78
6 Idukki 617 0 0
7 Ernakulam 875 56 6.40
8 Thrissur 1077 329 30.55
9 Palakkad 1136 147 12.94
10 Malappuram 1438 227 15.79
11 Kozhikkode 883 57 6.46
12 Wayanad 359 0 0
13 Kannur 625 0 0
14 Kasaragod 476 82 17.23
Total 11883 1250 10.52
Source: Ministry of Drinking Water and Sanitation, GoI.
13.87. While prioritizing water quality problems, arsenic and fuoride affected habitations have been
accorded priority followed by iron, salinity, nitrate and other contaminants. More than 85% of the
sources in rural drinking water supply schemes are ground water based. Except for nitrate, all others
occur naturally. Nitrate occurs in drinking water due to leaching of chemical fertilizers and sewerage.
As on 01.4.2009 there are 1.79 lakh habitations in India which are quality affected, Bharat Nirman
Economic Review 2011
390
Phase-Il targeted 1.05 lakh habitations for the period 2009-10 to 2011-12, the cumulative achievement
as on 31.12.2011 are 69863 [Link] Kerala, total quality affected habitations in 2009 are 1879.
The second Phase of Bharat Nirman targeted 242 habitations and the cumulative achievement as on
31.12.2011 is 191 habitations.
Table 13.30
Status of Quality Affected Habitations Phase II (2009-10 to 2011-12)
2009-10 2010-11 2011-12
S
l
.
N
o
S
t
a
t
e
s
/
U
n
i
o
n
T
e
r
r
i
t
o
r
i
e
s
Q
u
a
l
i
t
y
-
a
f
f
e
c
t
-
e
d
H
a
b
i
t
a
t
i
o
n
s
a
s
o
n
1
-
4
-
0
9
T
a
r
g
e
t
A
c
h
i
e
v
e
m
e
n
t
T
a
r
g
e
t
A
c
h
i
e
v
e
m
e
n
t
T
a
r
g
e
t
A
c
h
i
e
v
e
m
e
n
t
C
u
m
u
l
a
t
i
v
e
A
c
h
i
e
v
e
m
e
n
t
1 Andhra
Pradesh
1097 126 217 810 134 201 25 376
2 Arunachal
Pradesh
274 34 38 264 215 0 0 253
3 Assam 26589 6868 6061 3515 2906 3158 1504 10471
4 Bihar 34909 7748 10036 7909 5975 6375 1758 17769
5 Chhattisgarh 8379 3551 1246 3426 1752 3283 689 3687
6 Goa 0 0 0 0 0 0
7 Gujarat 948 390 379 391 398 405 96 873
8 Haryana 179 88 91 36 14 23 13 118
9 Himachal
Pradesh
88 13 12 42 0 0 12
10 J ammu &
Kashmir
6 1 1 310 20 1 2
11 J harkhand 815 132 221 432 1074 804 74 1369
12 Karnataka 8559 2638 2344 4002 1453 2000 595 4392
13 Kerala 1879 152 101 47 49 157 41 191
14 Madhya
Pradesh
5385 502 620 700 393 575 297 1310
15 Maharashtra 3989 2086 1009 4124 1866 1272 607 3482
16 Manipur 5 0 25 1 4 0 1
17 Meghalaya 107 8 6 102 17 12 3 26
18 Mizoram 0 0 0 0 0 0
19 Nagaland 157 20 19 105 4 50 13 36
20 Orissa 23676 3452 2257 1721 1581 1609 995 4833
21 Punjab 864 466 273 392 64 22 5 342
22 Rajasthan 37658 1210 3109 3977 2708 3801 2441 8258
23 Sikkim 0 0 0 0 0 0
24 Tamil Nadu 637 0 1 1009 1009 77 12 1022
25 Tripura 7102 1346 733 309 871 982 481 2085
26 Uttar Pradesh 5911 1558 1562 2142 1831 800 195 3588
27 Uttarakhand 9 0 0 0 0 0
Kerala State Planning Board
391
28 West Bengal 10773 2202 1789 5304 2788 4160 782 5359
29 A & N islands 0 0 0 0
30 D & N Haveli 0 0 0 0
31 Daman & Diu 0 0 0 0
32 Delhi 0 0 0 0
33 Lakshadweep 0 0 0 0
34 Puducherry 4 4 4 4 0 8
35 Chandigarh 0 0 0
Total 179999 34595 32129 41094 27107 29790 10627 69863
Source: Dept of Drinking Water & Sanitation, GoI
Coverage of Water Supply in Kerala
13.88. As on 31.03.2011, the coverage of drinking water supply in Kerala was 75.28 percent of total
population. In urban and rural areas of the State, 85.18 per cent and 71.82 per cent of the popula-
tion were covered. The total number of urban and rural people covered by water supply schemes in
Kerala was 70.41 lakh and 169.30 lakh respectively. In 2010-11, the additional population covered was
800871, in which 769861 were in the rural area and 31010 were in urban [Link] highest increase
was experienced in Kannur district (14.01%). However, no change was registered in the coverage of
drinking water supply over the last one year in Alappuzha, Kottayam, Thrissur and Wayanad districts.
13.89. During 2010-11, Ernakulam District had the highest rural water supply coverage (98.26%)
and Kozhikode District had the lowest coverage (41.69%). In urban area, Malappuram District had
the highest coverage (99.35%) and Wayanad District had the lowest coverage with 50.10 percnt.
In the case of total population covered, Ernakulam District had the highest coverage (97.41%) and
Kozhikode District had the lowest coverage (54.60%) during 2010-11. The District wise details of
population covered by water supply schemes in Kerala as on 31-03-2011 are given in Appendix. The
percentage coverage of water supply facilities for rural, urban and total population in the districts and
Kerala are shown in Figure .13.6
Figure 13.6
Percentage coverage of Water Supply Schemes in Kerala
Source: Kerala Water Authority
Status of Water Supply Coverage in Habitats
13.90. According to the survey conducted by the Rajiv Gandhi National Drinking Water Mission in
1992, there were 9776 identifed habitats in Kerala. After ten years a fresh habitation survey was
Economic Review 2011
392
conducted in 2003 based on 2001 census population and the number of rural habitations/wards got
increased to 12165. The details of another 1124 habitations were further added on 1/4/2007 and the
total number of habitations became 13289. Out of these habitations, 1406 were Census Town (CT)/or
Out Growth (OG). As per the directions from the Government, these CTs and OGs were deleted from
the list and the total rural habitations became 11883 only. All these 11883 habitations attained fully
covered status as on September 2010 taking the private wells also into consideration.
Source wise Coverage of piped drinking water supply
13.91. Kerala Water Authority (KWA) is the single largest provider of drinking water supply in the state.
It covers 93.53 % of total piped water supply, of which 61.32 % are in rural area and 32.21 % in urban
area. Other agencies which provide water supply in rural area are Kerala Rural Water Supply and
Sanitation Agency (KRWSA) and LSGIs which covers 2.8% and 2% respectively. KRWSA and LSGIs
are ensuring community participation in the implementation of water supply schemes by sharing the
fnancial costs and taking responsibility in management, operation and maintenance to some extent.
Besides these agencies, Department of Urban Development and Department of Town and Country
Planning also act as agencies for water supply schemes under UIDSSMT and J NNURM respectively.
Figure 13.7 shows the source wise coverage of piped water supply in Kerala.
Figure 13.7
Source wise coverage by Piped Water Supply Schemes
Source:Kerala Water Authority
Kerala Water Authority
13.92. Various schemes are being implemented by Kerala Water Authority considering the need for
extending the coverage of protected water supply in the State adopting scientifc distribution and con-
servation, such as Centrally Sponsored National Rural Drinking Water Programme (NRDWP) and
Urban Water Supply Schemes, Technology Mission Schemes, Swajaldhara schemes, schemes with
loan assistance from NABARD/Banks, externally aided J BIC Projects (now J ICA), and ADB and World
Bank assisted schemes. State funded water supply schemes are also being undertaken by Kerala
Water Authority.
13.93. As on 31/3/2011 there are 2162 water supply schemes operating under Kerala Water Authority.
Kerala State Planning Board
393
Of which 71 are urban schemes, 978 Multi Panchayat and 1113 Single Panchayat [Link] ur-
ban water supply schemes Ernakulam(14 Schemes) and Thrissur(12 Schemes) have more schemes.
As in the case of Multi Panchayat schemes Thrissur is in frst position having 146 schemes followed by
Palakkad (133 Schemes) and Kozhikode (118 Schemes). For Single Panchayath scheme Wayanad
has only 32 schemes. Details are given in the Table 13.31
Table 13.31
District and Category-wise Water Supply Schemes - KWA
Sl No District No. of Urban
Water Supply
Schemes
Rural Water Supply
Schemes
Total
Multi Pan-
chayat
Single Pan-
chayat
1 Thiruvananthapuram 6 43 93 142
2 Kollam 3 38 64 105
3 Pathanamathitta 3 19 50 72
4 Alappuzha 7 1 77 85
5 Kottayam 5 55 97 157
6 Idukki 1 106 89 196
7 Ernakulam 14 62 87 163
8 Thrissur 12 146 103 261
9 Palakkad 4 133 50 187
10 Malappuram 5 112 38 155
11 Kozhikkode 2 118 128 248
12 Wayanad 0 30 32 62
13 Kannur 6 52 118 176
14 Kasargode 3 63 87 153
Total 71 978 1113 2162
Source:Kerala Water Authority
13.94. Kerala Water Authority at present has 77 ongoing Accelerated Rural Water Supply Schemes
(ARWSS) under various stages of execution. NC/PC schemes are proposed to provide water supply to
non-covered/partially covered areas. 432 NC/PC schemes under this category have been completed
and works of 95 schemes are under various stages of implementation.
13.95. The Rain Water Harvesting scheme Varsha is to collect rain water from the rooftop and store it
in a tank which is to be handed over to benefciaries on completion. 10% of the project cost has to be
borne by the benefciaries. The project is under implementation in Thiruvananthapuram, Alappuzha,
Kottayam and Ernakulam districts. KWA had completed 4532 units of Varsha schemes since [Link]
per the direction of Government of India, all the rural schools and Anganwadis having no drinking wa-
ter facilities are to be provided with such facilities. The expenditure for this purpose should be shared
by the Central and State Governments on 50:50 basis from the funds allocated for ARWSP. Kerala
Water Authority has provided water supply to 1934 schools so far and works of 9 schemes are under
various stages of implementation.
Economic Review 2011
394
13.96. Government of India provides assistance under Technology Mission for implementing schemes
in water quality affected areas. Up to 20% of the ARWSP funds are to be earmarked for new projects
designed to address water quality issues. Fifteen schemes have been sanctioned so far for a total
estimated cost of Rs.14081.00 lakh. Of the 15 schemes, three schemes are having a funding pattern
of 50:50 and the rest 75:25. Out of the total schemes, eight schemes have been completed and one
scheme is completed without distribute system. The works of remaining schemes are in progress.
13.97. Under decentralized planning Kerala Water Authority undertake deposit work from local bodies.
Most of these works are line extension proposals. As on 31.3.2010, 1367 ongoing deposit works were
under implementation. A special package for the completion of ongoing Urban Water Supply Scheme
(UWSS) was introduced by the government in 2009-10. Under this package 17 schemes were submit-
ted, of which 4 schemes namely Augmentation of Palakkad Water Supply Scheme(WSS), UWSS to
Vakakkekara census town in Ernakulam district,WSS to Chelakkara in Thrissur district and UWSS to
Manjeswaram in Kasaragod district are already completed.
Receipts of Kerala Water Authority
13.98. Major fnancial source of Kerala Water Authority includes revenue from water charge and sew-
erage, Plan and Non-Plan allocation from state government,Deposits from Local Bodies,fund from
[Link] India and loan from LIC/HUDCO/Bank. Details of revenue receipts of KWA are given in the
Table 13.30
Table 13.32
Receipts of Kerala Water Authority from various sources (` lakhs)
Year Revenue
from
Water/
Sewer-
age
State Govt.
Depos-
its from
Local
Bodies
Govt. of
India
Loan
from LIC/
HUDCO/
Bank
Others(TRP/
DRW/CCDU/
J ALANIDHI/
NATIONAL
GAMES
Total
Plan Non-
plan
2002-03 10580.00 10400.00 6186.00 302.00 6204.00 0.00 33672.00
2003-04 11512.00 9738.00 6124.00 375.00 4341.00 1000.00 33090.00
2004-05 11523.00 9626.00 7621.00 385.00 5885.00 300.00 35340.00
2005-06 14937.00 17499.00 8000.00 395.00 6170.00 4431.00 51432.00
2006-07 13839.09 23782.00 8860.00 829.00 6527.00 3046.13 56883.22
2007-08 15022.78 70783.00 9946.00 951.00 8972.00 2836.00 108510.78
2008-09 23089.00 45800.00 10720.60 1225.81 12474.00 26301.40 119610.81
2009-
10(P)
31371.00 66661.00 16792.66 598.37 15447.08 660.48 7041.86 138572.45
2010-11
(P)
33215.00 37553.00 19971.80 928.90 14876.64 689.75 579.00 107814.09
Source:Kerala Water Authority
Expenditure Pattern of Kerala Water Authority
13.99. During 2005-06 Plan expenditure of Kerala Water Authority to its total expenditure was 31.79
percent it has increased to 34.66 percent in 2010-11. For Non-Plan Expenditure, it was 68.21 percent
Kerala State Planning Board
395
in 2005-06 reportedly decreased to 65.34 percent in [Link] 13.33 shows the details of Plan
and Non-Plan expenditure of Kerala Water Authority.
Table 13.33
Plan and Non-Plan expenditure of KWA ( ` in lakh)
Period Plan Expendi-
ture
Non - Plan Ex-
penditure
Total
2005-06 17468.04 37488.79 54956.83
2006-07 38890.21 39694.48 78584.69
2007-08 65472.29 46526.93 111999.2
2008-09 70763.27 47579.23 118342.5
2009-10 62406.24 57038.67 119444.9
2010-11 35698.76 67297.56 102996.3
Source: Kerala Water Authority
13.100. Increase in Plan expenditure is caused by increase of external assistance which covers 48.43
percent in 2010-11. Decrease in non plan expenditure is highly caused by the reduction of payment
on power charge which was 38.33 percent of its total expenditure during 2005-06, decline to 21.87
percent in 2010-11. Expenditure on operation and maintenance has also reduced from 12.38 percent
to 7.93 percent for the same period. Out of total non-plan expenditure, 45.92 percent covers salaries
and establishment during [Link] 13.34 gives the details of percentage share of different com-
ponents of plan and non-plan expenditure incurred by Kerala Water Authority. Fig 13.7 shows the an-
nual percentage change of Plan,Non-Plan and total expenditure of KWA.
Table 13.34
Component wise share of Plan and Non-Plan Expenditure of KWA (In Percentage)
A) Plan Expenditure 2005-06 2006-07 2007-08 2008-09 2009-10 2010-11
State Plan Schemes 31.25 21.92 8.99 8.32 36.39 9.61
LIC/HUDCO 15.08 5.72 2.43
Externally Assisted 7.84 49.68 75.83 74.25 50.57 48.43
Centrally Assisted 38.17 16.23 12.75 13.73 13.04 8.17
Others 7.65 6.45 3.70 33.78
Total Plan Expenditure 100.00 100.00 100.00 100.00 100.00 100.00
B)Non- Plan Expenditure
Salary & Establishment 33.98 35.23 44.30 54.47 46.21 45.92
Power Charge 38.33 34.77 29.83 20.06 25.25 21.87
Operation & Maintenance 12.38 11.76 10.68 10.70 9.12 7.93
Interest on Loans 8.29 10.60 5.99 5.72 9.35 6.98
Repayment of Loans 5.09 5.86 7.59 7.43 8.72 16.11
Others 1.94 1.77 1.61 1.62 1.37 1.20
Economic Review 2011
396
A) Plan Expenditure 2005-06 2006-07 2007-08 2008-09 2009-10 2010-11
Total Non-Plan Expendi-
ture
100.00 100.00 100.00 100.00 100.00 100.00
Source: Kerala Water Authority
Fig 13.8
Annual percentage change of Expenditure by KWA
Source: Kerala Water Authority
Urban Infrastructure Development Scheme for Small and Medium Towns (UIDSSMT)
13.101. Urban Infrastructure Development Scheme for Small and Medium Towns (UIDSSMT) is
one of the components of J NNURM. It was launched in December 2005 for improvement in urban
infrastructure including water supply in towns and cities in a planned manner. The implementation of
the scheme is done by the respective Urban Local Bodies (ULB) Municipalities for which the funds will
be released to Urban Local bodies according to requirement. In order to execute the projects smoothly
an agreement is signed among the respective Municipality, Kerala Water Authority, Department of LSG
and Water Resources Department. As per this MoU, a city level Technical Advisory Group is formed
for respective Municipalities. Funding pattern is 80% Central, 10% State and 10% ULB.
Jawaharlal Nehru National Urban Renewal Mission (JNNURM) Projects
13.102. Government had accorded Administrative Sanction for four projects of one each in water supply
and sewerage sector for Thiruvananthapuram and Kochi Corporations of Kerala under J NNURM.
In order to execute these projects an agreement among the respective Corporation, Kerala Water
Authority (KWA), Department of LSGD and Water Resources Department was signed on 01/11/07.
The implementation of the scheme is done by KWA on behalf of the respective Urban Local Bodies
(ULB), for which the funds will be released to ULBs according to requirement.
Bank assisted Projects
13.103. Certain viable projects originally taken up with LIC/HUDCO assistance were posed for availing
term loan from Banks for completion. The Adhoc Augmentation of Kochi Water Supply Scheme,
taken up with bank assistance was completed and inaugurated on 5th October 2007. The Chowara
Scheme taken up using bank aid has already been commissioned. Bank loan is also being availed
for implementing water supply scheme to Thrippunithura and adjoining Panchayats has been partially
completed during 2009 (Thrippunithura portion). The scheme is expected to be completed by March
2012.
Kerala State Planning Board
397
NABARD loan assistance for Rural Water Supply Schemes
Schemes sanctioned under RIDF IX
13.104. There were 8 rural water supply schemes being implemented with NABARD loan assistance
under RIDF IX. The revised project cost for these 8 schemes was Rs. 6218.15 lakhs and the revised
loan sanctioned by NABARD 4444.61 lakhs. Out of the 8 schemes, 3 schemes in Kannur district
namely RWSS to Azhikkode, Edakkad and Ramanthali were commissioned during 2008-09. RWSS
to Poothady commissioned during November 2009 and RWSS to Udumbanchola completed during
September 2010. As the loan drawal period has expired the remaining schemes are to be completed
with the state fund.
Schemes sanctioned under RIDF XIV (SPAN projects)
13.105. There are 36 Rural Drinking Water Supply Schemes have been sanctioned by NABARD under
RIDF XIV. Major portion of the above schemes were LIC aided schemes which were held up due to
shortage of [Link] per G.O. (Rt) No. 764/08/WRD dated 24/7/2008 the State Government had
accorded Administrative Sanction for these schemes. Subsequently Kerala Water Authority also had
issued Administrative Sanction. Technical committees were constituted at Regional Chief Engineers
level and Head Offce level of Kerala Water Authority. Government also constituted an Empowered
Committee at Government level for taking suitable fnancial and administrative decisions to ensure
speedy and time bound implementation. Works which has been started is in different stages of
implementation. Total expenditure incurred for the schemes upto March 2011 was Rs. 302.34 crores
(excluding estimate share debit). Out of the above schemes, 5 schemes viz. (1) WSS to Kizhakkoth
(Kozhikkode) (2) WSS to Kolachery I(Kannur), (3) WSS to Kolacherry II (Kannur), (4) Vaikkom Scheme
(Kottayam.), (5) WSS to Koduvayoor-Pudunagaram (Palakkad) were completed on March 2011.
JBIC Assisted Kerala Water Supply Project
13.106. The J BIC assisted Kerala Water Supply Project currently known as J ICA assisted Kerala Water
Supply Project envisages the implementation of fve water supply projects in Thiruvananthapuram,
Meenad, Cherthala, Kozhikode and Pattuvam at a revised estimated cost of Rs.2987.40 crores.
There are 23 contract packages to be carried out by JBIC. Of which 11 are International Competitive
Bidding (ICB) packages and 12 are Local Competitive Bidding (LCB) packages. Out of these 23
contracts 21 were awarded and the construction activities are progressing. The remaining two contract
packages are the rehabilitation of existing components of Thiruvananthapuram and Kozhikode water
supply schemes which are under fnalization.
Jalanidhi Project
13.107. J alanidhi is a World Bank aided rural water supply and Sanitation project. It is based on
the cardinal concept of sector reform like demand responsiveness, community ownership and
sustainability of investment through cost recovery. Kerala Rural Water and Sanitation Agency
(KRWSA) is the implementing agency functioning under the Department of Water Resource, Govt.
of Kerala. Activities under J alanidhi are Small Water Supply Schemes, Comprehensive Water Supply
Scheme,Construction of Latrine, Ground Water Recharge,EMP and Drainage [Link] 13.35 gives
the physical achievements of J alanidhi upto 30.9.2011.
Economic Review 2011
398
Table 13.35
Physical Performance of Jalanidhi
Sl.
No
Items Units Over all
target
Achievements
Of 11th Plan (upto
30.9.2011
Total
Achieve-
ments
1. Water Supply
Schemes-Small
Nos. 2500 470 3694
2. Water Supply Schemes-
Comprehensive
Nos. 6 13 16
3. New Latrine Nos. 40000 795 68023
4. Latrine Conversion Nos. 8000 2668 24194
5. GWR-Point recharge BGs 563 26 1013
6. EMP-Works Nos. 26667 1610 89319
7. Drainage Mtrs 178000 10132 68362
Source:Jalanidhi
13.108. The Second Kerala Rural Water Supply and Sanitation Project (J alanidhi II) has been ap-
proved by World Bank with the cost of Rs.1022 crore. The project period is 5 years proposed from
J anuary 2012 covering about 200 GPs. For the year 2012-13, it is decided to cover 86 Panchayats,
216 Small Water Supply Schemes including 18 Tribal Plans, 2 Large Water Supply Schemes, 22 Water
Treatment Plants and 738 RWH units.
Water Rate in Kerala
13.109. Water charge in Kerala varies in accordance with the purpose of its uses. Table 13.36 gives
the existing rate of water with effect from 01.09.2008
Table 13.36
Existing Water Rates
Sl.
No.
TYPE OF CONNECTIONS
AND CONSUMPTION PER
MONTH
RATE
A DOMESTIC
Upto 5000 litres
` 20/-
5000 to 10,000 litres
` 20/- plus @ ` 4.00 per every 1000 lites in excess of 5000
litres
10,000 to 20,000 litres
` 40/- plus `. 5.00 per every 1,000 litres in excess of 10,000
litres
20,000 to 30,000 lites
`. 90/- plus @ `. 6.00 per every 1,000 litres in excess of
20,000 litres
30,000 to 40,000 liters
`.150/- plus @ `. 10.00 per 1,000 litres in excess of 30,000
liters.
Kerala State Planning Board
399
Sl.
No.
TYPE OF CONNECTIONS
AND CONSUMPTION PER
MONTH
RATE
40,000 to 50,000 litres
`.250/- plus @ `. 14.00 per 1,000 litres in excess of 40,000
liters.
Above 50,000 liters
` 390/- plus @ ` 25.00 per 1,000 liters in excess of 50,000
liters.
B NON-DOMESTIC
Upto 15,000 liters
At the rate of ` 10/- per 1000 lites and `. 125/- minimum
charge
15,000 to 50,000 lites
` 150/- plus @ ` 14.00 per every 1000 litres in excess of
15,000 litres
Above 50,000 liters
` 640/- plus @ `. 25.00 per every 1,000 liters in excess of
50,000 liters
C INDUSTRIAL
For consumption in a month
At the rate of `. 25/- per 1000 litre and `. 250/- minimum
charge
D LOCAL BODIES
Municipal Taps
` 5256/- per year
Panchayath Taps
`.3500/- per year
Source:Kerala Water Authority
Production and Distribution of Water
13.110. Kerala Water Authority produced water @ 1890.64 million litres per day and dis-
tributed @ 1417.90 million litres per day under piped water supply system during 2009-10.
Table 13.37
Production and Distribution of Water
Year Production (mld) Supply (mld) Leakage (%)
2005-06 1635.00 1259.00 23
2006-07 1750.00 1400.00 20
2007-08 1791.00 1254.00 30
2008-09 1811.00 1268.00 30
2009-10 1890.64 1417.90 25
Source: Kerala Water Authority
The unaccounted for water (ufw) is 543 mld, which means that the estimated distribution loss of water
produced is 25 per cent. Production and supply of water by Kerala Water Authority for the period 2005-
06 to 2009-10 is given in the Table 13.37.
Economic Review 2011
Human Development
C
H
A
P
T
E
R
402
Kerala State Planning Board
403
Human Development
Progress in many aspects of human development has been substantial over the past 40 years as
the 2010 Global Human Development Report showed. The worlds average HDI increased 18 percent
between 1990 and 2010 refecting large improvements in life expectancy, school enrolment, literacy
and income. However income inequality has worsened and production and consumption patterns
especially in rich countries seem to be unsustainable. Worsening income inequality has offset large
improvements in health and education inequality, such that the aggregate loss in human development
due to inequality is 24 percent as reported by Global HDR 2011.
14.2 The HDI trend calculated at fve year intervals over a period of 30 years is shown in Figure 14.1.
Fig. 14.1
e
Global Human Development Report 2011
14.3 Human development, which is about expanding peoples choices, builds on shared natural re-
sources. Promoting human development requires addressing sustainability locally, nationally and glob-
ally and this can and should be done in ways that are equitable and empowering. This years Report
Economic Review 2011
404
focuses on the challenge of sustainable and equitable progress. A joint lens shows how environmental
degradation intensifes inequality through adverse impacts on already disadvantaged people and how
inequalities in human development amplify environmental degradation. Salient fndings of the Human
Development Report 2011 is given in the Box No. 14.1.
Box No. 14.1
Global Human Development Report 2011
Last years human development report celebrated the concept of human development, emphasizing
how equity, empowerment and sustainability expand peoples choices. At the same time it high-
lighted inherent challenges, showing that these key aspects of human development do not always
come together. This years Report focuses on the challenge of sustainable and equitable progress.
A joint lens shows how environmental degradation intensifes inequality through adverse impacts on
already disadvantaged people and how inequalities in human development amplify environmental
degradation.
Increasing evidence points to widespread environmental degradation around the world and potential
future deterioration. Because the extent of future changes is uncertain, the report explore a range
of predictions and consider the insights for human development.
Simulations for this Report suggest that by 2050 the global HDI would be 8 percent lower than in the
baseline in an environmental challenge scenario that captures the adverse effects of global warm-
ing on agricultural production, on access to clean water and improved sanitation and on pollution
(and 12 percent lower in South Asia and Sub-Saharan Africa). Under an even more adverse en-
vironmental disaster scenario, which envisions vast deforestation and land degradation, dramatic
declines in biodiversity and accelerated extreme weather events, the global HDI would be some 15
percent below the projected baseline.
Looking at the relationship between environmental risks and the HDI, we observe three general
fndings:
Household environmental deprivations indoor air pollution, inadequate access to clean water
and improved sanitation are more severe at low HDI levels and decline as the HDI rises.
Environmental risks with community effects such as urban air pollution seem to rise and then
fall with development some suggest that an inverted U-shaped curve describes the relation-
ship.
Environmental risks with global effects namely greenhouse gas emissions typically rise with
the HDI.
The effects of climate change on farmers livelihoods depend on the crop, region and season, un-
derlining the importance of in-depth, local analysis. Impacts will also differ depending on household
production and consumption patterns, access to resources, poverty levels and ability to cope. Taken
together, however, the net biophysical impacts of climate change on irrigated and rainfed crops by
2050 will likely be negative and worst in low HDI countries. The effects of climate change on farm-
ers livelihoods depend on the crop, region and season, underlining the importance of in-depth, local
analysis. Impacts will also differ depending on household production and consumption patterns, ac-
cess to resources, poverty levels and ability to cope. Taken together, however, the net biophysical
impacts of climate change on irrigated and rainfed crops by 2050 will likely be negative and worst in
low HDI countries.
Source : Human Development Report 2011
Kerala State Planning Board
405
Human development index classifcation
14.4 HDI classifcations are relativebased on quartiles of HDI distribution across countries and de-
noted very high, high, medium and low HDI. Because there are 187 countries, the four groups do not
have the same number of countries: the very high, high and medium HDI groups have 47 countries
each, and the low HDI group has 46 countries.
14.5 The HDI value of some of the major countries is given in Table 14.1.
Table 14.1
Human Development Index of selected countries in the world
Name of the
country
HDI value HDI rank Life expec-
tancy at Birth
(yrs)
Norway 0.943 1 81.1
USA 0.910 4 78.5
J apan 0.901 12 83.4
Italy 0.874 24 81.9
UK 0.863 28 80.2
UAE 0.846 30 76.5
Malaysia 0.761 61 74.2
Sri Lanka 0.691 97 74.9
China 0.687 101 73.5
South Africa 0.619 123 52.8
India 0.547 134 65.4
Pakistan 0.504 145 65.4
Bangladesh 0.500 146 68.9
Nepal 0.458 157 68.8
Ethiopia 0.363 174 59.3
Liberia 0.329 182 56.8
Kongo 0.286 187 48.4
World 0.682 69.8
Source : Human Development Report 2011
14.6 India holds 134th position in the Human Development Value and is ranked under the countries
having medium human development in the world. Over the last three decades, the HDI value of the
country has got improved. The HDI value of India was 0.344 in 1980 which enhanced to 0.410 in 1990
which in turn was raised to 0.461 in 2000. During 2005, the HDI value was 0.504 which got enhanced
to 0.542 in 2010 and again improved to 0.547 in 2011.
India Human Development Report 2011
14.7 The frst National Human Development Report was published by the Planning Commission in
2002. The second NHDR was published in 2011. In the second HDR also, Kerala ranked frst followed
by Delhi, Himachal Pradesh, Goa and Pubjab (Table 14.2)
Economic Review 2011
406
Table 14.2
Ranking of States according to HDI value
State HDI 2007-08
Value Rank
Kerala 0.790 1
Delhi 0.750 2
Himachal Pradesh 0.652 3
Goa 0.617 4
Punjab 0.605 5
NE (Excluding Assam) 0.573 6
Maharashtra 0.572 7
Tamil nadu 0.570 8
Haryana 0.552 9
J ammu & Kashmir 0.529 10
Gujarat 0.527 11
Karnataka 0.519 12
West Bengal 0.492 13
Uttarakhand 0.490 14
Andhrapradesh 0.473 15
Assam 0.444 16
Rajasthan 0.434 17
Uttarpradesh 0.380 18
J harkhand 0.376 19
Madhya Pradesh 0.375 20
Bihar 0.367 21
Orissa 0.362 22
Chattisgarh 0.358 23
All India 0.467
Source: India Human Development Report 2011
14.8 Human Development Index in the country rose by 21 percent and placed again Kerala on top of
the index for achieving highest literacy rate and other dimension of HD. HDI has registered a gain by
21% to 0.467 in 2007-08 from 0.387 in 1999-00. Chattisgarh, Orissa, MP, UP, Jharkhand, Rajasthan
and Assam are those states which continue to lag behind in HDI and remain below the national aver-
age of 0.467.
Human development index and its components of Kerala
14.9 The health, income and education index of Kerala and India pertaining to the year 2007-08 is
shown in Table 14.3. The consistent high values of the components of HDI is leading to high HDI.
Kerala State Planning Board
407
Table 14.3
Components of Human Development Index, 2007-08
Kerala India
Health index 0.817 0.817
0.563
Income index 0.629
0.629
0.271
Education
index
0.924
0.924
0.568
HDI 0.790 0.790
0.467
Source : India Human Development report 2011
14.10 The life expectancy at birth in Kerala is 74 years. It is the highest in Kerala, among all the states
in India which is also higher than that of life expectancy of people of Brazil. The well documented
achievements of Kerala in some of the human development indicators are shown in Table 14.4.
Table 14.4
Selected indicators of human development for major states
State Life expectancy at birth (2002-06) (2007)IMR (per 1000 live
birth)
(2008)
Birth rate
per 1000
(2008)
Death rate
per 1000
M F T M F T
Andhra
Pradesh
62.9 65.5 64.4 48 50 49 18.4 7.5
Bihar 62.2 60.4 61.6 52 52 52 28.9 7.3
Gujarat 62.9 65.2 64.1 47 48 48 22.6 6.9
Karnataka 63.6 67.1 66.3 41 42 41 19.8 7.4
Kerala 71.4 76.3 74 10 13 12 14.6 6.6
Madhya
Pradesh
58.1 57.9 58 66 68 67 28.0 8.6
Maha-
rashtra
66.0 68.4 67.2 28 33 31 17.9 6.6
Punjab 68.4 70.4 69.4 37 39 38 17.3 7.2
Tamil
Nadu
65.0 67.4 66.2 27 29 28 16.0 7.4
West Ben-
gal
64.1 65.8 64.9 33 33 33 17.5 6.2
India 62.6 64.2 63.5 55 56 55 22.8 7.4
Source : Economic Survey 2009-10, India Human Development Report 2011
Poverty and Special Programme Special Programmes for Weaker sections
14.11 Poverty can be defned as the pronounced deprivation in well-being and has many dimensions.
It is the inability of people to acquire basic goods and services necessary for survival with dignity
due to low levels of income. Poverty is usually measured either as absolute or relative poverty.
Economic Review 2011
408
14.12 Absolute poverty or destitution refers to lack of basic human needs, which commonly include
clean and fresh water, nutrition, health care, education, clothing and shelter. Relative poverty refers
to lack of usual or socially acceptable level of resources or income as compared with others within a
society or country. In India, economists have tended to concentrate on absolute poverty rather than
relative poverty.
Multi dimensional Poverty Index of India
14.13 Multidimensional poverty index (MPI) was developed in 2010 by Oxford Poverty & Human De-
velopment Initiative and the United Nations Development Programme and used different factors to
determine poverty beyond income based lists. Multidimensional poverty index indicates the share of
the population that is multidimensionally poor and is adjusted by the intensity of deprivation in terms
of living standards, health and education. The health indicators are child mortality and nutrition, school
enrolment and living standards relating to availability of such essentials as cooking fuel, water, electric-
ity etc. According to the Human Development Report 2010, published by the United Nations Develop-
ment Programme, (UNDP), the multidimensional poverty index (MPI) of India was 0.296 with a poverty
of 41.6% ( in terms of PPP $ 1.25 per day).
14.14 The MPI of India and its neighbouring countries for 2000-2008 is given in Table 14.5. The rank
of these countries with reference to MPI based on available indicators of 169 countries is given in
parentheses.
Table 14.5
Multidimensional Poverty Index
Sl. No. Country Multdimensional Poverty
Index (2000 2008)
1 China 0.056 (89)
2 Sri Lanka 0.021 (91)
3 India 0.296 (119)
4 Pakistan 0.275 (125)
5 Bangladesh 0.291 (129)
Source: Economic Survey 2010-11
Poverty Measure of india
14.15 The existing poverty measure of Planning Commission of India is based on the recommended
nutritional requirements of 2400 calories/person/day in rural areas and 2100 calories/person/day in ur-
ban areas. The offcial percentage of population below poverty line is estimated based on the house-
hold consumer expenditure survey carried out by National Sample Survey Organization (NSSO).
14.16 For capturing household expenditure on a recall basis, NSSO decided to shift to mixed refer-
ence period (MRP) for all its consumption surveys in future, namely 365 days for low frequency
items, i.e., clothing, foot wear, durables, education and institutional health and 30- days for the remain-
ing items with effect from the 61st Round of National Sample Survey during 2004-05. It was found
that the MRP estimation method could capture the household expenditure on low frequency items
satisfactorily than the earlier 30 days uniform recall period method of estimation (URP).
Change in Trends of Rural Poverty
14.17 The URP estimates of population Below Poverty Line in rural India and Kerala pertaining to
1973-74, 1983-84, 1993-94 and 2004-05 (latest available) are given below for analyzing the trends
in decline of persons below poverty line since 1973-74.
Kerala State Planning Board
409
Table 14.6
Change in Trends of Rural Poverty Ratio
Sl. No. India Kerala
* No. of
Persons(Lakh)
% of Persons * No. of
Persons(Lakh)
% of Persons
1 2 3 4 5
1973-74 2612.90 56.44 111.36 59.19
1983-84 2519.57 45.65 81.62 39.03
1993-94 2440.31 37.27 55.95 25.76
2004-05 2209.24 28.30 32.43 13.20
*No. of persons in Rural Areas Below Poverty Line (Lakh)
Source: Hand Book of Statistics on Indian Economy 2010-11
14.18 The fgures in Table 14.6 are charted as fgure 14.2 and the same is given below.
Fig.14.2
X-axis: Reference Year Series 1: India
Y-axis: Rural Poverty Ratio Series 2: Kerala
14.19 The trends exhibited in the chart lead us to infer that Keralas attempts at alleviating poverty
were sharp sighted and the rate of decline was faster than that of India. Moreover, they showed an
almost downward linear trend. This inference correlates with Keralas performance in social security
measures adopted for the welfare of the vulnerable groups and labourers in the form of pensions, ef-
fective public distribution system, high literacy rate, health indicators of low infant mortality rate and
high life expectancy, participatory approach for alleviation of poverty through Kudumbasree Mission,
decentralized planning etc. in addition to the implementation of major Centrally-Sponsored Schemes
for poverty eradication.
Economic Review 2011
410
Rural-Urban Distribution of Poverty Ratios
14.20 Rural-urban distribution ratios of poverty based on MRP consumption with respect to the refer-
ence period of 2004-05, the 61st round of National Sample Survey, are given in Table 14.7. No offcial
estimation has taken place since 2004-05.
Table 14.7
Rural-Urban Distribution of Poverty Ratios
Category No. of Persons Lakhs % of Persons
1 2 3
Rural Population Kerala 23.59 9.60%
India 1702.99 21.80%
Urban Population Kerala 13.92 16.40%
India 682.00 21.70%
Source: NSSO Report 2004-05 (61st Round)
14.21 While rural poverty ratio of Kerala is below the national poverty ratio, urban poverty ratio is
much above its (national) rural poverty ratio. On the contrary, national urban poverty ratio (21.70%) is
below the national rural poverty ratio (25.70%). This is not due to the effect of migration of villagers to
towns and cities, but due to the nature and trends in urbanization in Kerala. (Source: Census of India
2011- Provisional Figures).
Rural Poverty in Southern states of India 2004-05
14.22 Rural poverty in southern states of India as on 2004-05 (MRP consumption) is illustrated in the
simple histogram given below based on data given in Table 14.8
Table 14.8
Rural Poverty in Southern States
Name of State Poverty Rato
1 2
Andhra Pradesh 7.50%
Karnataka 12.00%
Kerala 9.60%
Tamil Nadu 16.90%
Source: Hand Book of Statistics on Indian Economy 2010-11
Fig. 14.3
14.23 Among the southern states, poverty ratio of Andhra Pradesh is comparatively the least
(7.50%) followed by Kerala (9.60%). In this context, it may be borne in mind that the Radhakrishna
Kerala State Planning Board
411
Committee constituted in 2009 by the Planning Commission of India for framing the guidelines for
the new rechristened Mission Programme of the Central Government, the National Rural Livelihoods
Mission (NRLM), had modelled it after Kudmbashree Mission Programmes implemented in Kerala and
of the Society for Elimination of Rural Poverty in Andhra Pradesh.
14.24 The Hand Book of Statistics on Indian Economy 2010-11 provides inter-state comparisons of
Poverty, though its relevance is under question. The Tendulkar Committee on Poverty estimation
highlights that poverty has been rising since the reforms of 1991 both in rural and urban areas of India,
the rural situation being much worse off. In the summary of the report, it is stated that the procedure
of assessing poverty will continue to be based on consumer expenditure of households as collected
by the National Sample Survey Organization (NSSO). But the mixed recall period (MRP)-based
consumption expenditure will replace uniform reference period (URP) estimates for future poverty
line. The committee has also acknowledged the multi-dimensional nature of poverty. (Source: Report
of the Expert-Group to Review the Methodology for Estimation of Poverty, Planning Commission,
Government of India).
Poverty Alleviation And Employment Generation Programmes
14.25 The challenge of the XI Five Year Plan was to formulate inclusive plans to bridge regional, social
and economic disparities by providing a comprehensive strategy for inclusive development, building
on the growing strength of the economy. In addition to the Centrally- sponsored schemes/programmes
for eradication of poverty, the Kudumbashree Mission of Kerala had played a prominent and vital role
for uplifting the poor through participatory approach through the neighbourhood groups (NHGs) of
women in all local self-government institutions (LSGIs).
A brief description of the major programmes primarily concentrating on gainful wage/self employment
generation followed by fnancial/physical performance is given below.
1. The Mahatma Gandhi National Rural Employment Guarantee
Scheme (MGNREGS)
Economic Review 2011
412
14.26 This fagship programme of the Government of India touches the lives of the rural poor and
promotes inclusive growth. The MGNREGS aims at enhancing livelihood security of households in
rural areas of the country by providing at least one hundred days of guaranteed wage employment in a
fnancial year to every household whose adult members volunteer to do unskilled manual work. It also
mandates 33% participation for women. But in Kerala, approximately 92% of the total workers seeking
employment under the scheme are women. The primary objective of the scheme is to augment wage
employment. This is to be done while also focusing on strengthening natural resource management
through works that address causes of chronic poverty like drought, deforestation and soil erosion and
thus encourage sustainable development. Moreover, the scheme is demand driven and its funding
pattern is in the ratio of 90:10 between the Centre and the State.
Table 14.9
Expenditure of MNREGS XIth Plan Period (` in Lakh)
Year State
Budget
Provision
Release Total Fund Expendi-
ture
Expen-
diture
against
Total
Fund (%)
centre State Total
1 2 3 4 5 6 7 8
2007-2008 2500.00 5810.55 756.70 6567.25 9900.68 8333.83 84.17%
2008-09 5000.00 19887.32 2359.66 22246.98 29827.50 22440.92 75.24%
2009-10 4000.00 46771.42 4000.00 50771.42 59119.45 47039.01 79.57%
2010-11 5000.00 70423.24 1724.87 72148.11 84141.00 68874.18 81.86%
2011-12
(Up to
SEP 11)
13000.00 35656.21 526.88 36183.09 50019.02 24397.08 48.78%
Total 29500.00 178548.74 9368.11 187916.85 233007.65 171085.02 73.42%
Total Fund : Central and State releases , Opening Balance and other receipts
Source: Commissionerate of Rural Development, Government of Kerala.
14.27 Since the States contribution is on par with that of the Centre, the fund released by it for
these schemes will deviate from the actual budget provision earmarked for the schemes. Further,
State expenditure on Centrally-sponsored schemes cant be estimated exactly since the total provision
for these schemes comprise opening balances, Central and State releases and other miscellaneous
receipts.
14.28 The cumulative expenditure on the scheme under XIth Plan as on 30th September -2011
was Rs. 171085.02 lakh against the total available fund of Rs.233007.65 lakh (73.42%). Expenditure
during 2010-11 was 81.86% which was slightly above that of the fnancial year 2009-10, i.e., 79.57%.
14.29 Daily wages under the scheme is Rs. 150/- irrespective of gender differences. This crucial
limitation of the scheme, in the Kerala context, prevents the State from reaping the benefts of the
scheme, i.e,, utilization of the provision (40%) for material component, due to non- availability of
male labourers. This has, in turn, affected the strengthening of natural resource management to a
greater extent. The district-wise fnancial achievements under the scheme during 2011-12 as on 30th
September 2011 are given in Appendix 14.5 and the details of physical achievements are given in
Appendix 14.6.
Kerala State Planning Board
413
2. Swarnajayanti Grama Swarojgar Yojana (SGSY)
14.30 The Swarnajayanti Grama Swarojgar Yojana (SGSY) is a major ongoing scheme launched
in April 1999 to help poor rural families cross the poverty line by assisting them to take up income
generating economic activities through a mix of bank credit and government subsidy. The scheme
involves selection of key activities, planning of activity clusters, organization of the poor into self help
groups (SHGs) and building up of their capacities through training and skill development, creation of
infrastructure and technological and marketing support. SGSY specially focuses on vulnerable sections
of the rural poor with SCs/STs accounting for at least 50% and women 40% of the swarozgaris. The
share of minorities and disabled persons will be 15% and 3% respectively. Also, 15% of the SGSY
allocation is set apart for special projects that are implemented with different models of self-employment
generation and to enhance the income-generating capacity of the rural poor.
Table 14.10
Expenditure of SGSY General Projects XIth Plan Period (` in Lakh)
Year State
Budget
Provision
Release Total Fund Expendi-
ture
Expenditure
against Total
Fund (%)
centre State Total
1 2 3 4 5 6 7 8
2007-08 644.00 3022.70 1007.56 4030.26 4112.51 3932.07 95.60%
2008-09 800.00 3615.65 1205.21 4820.86 5048.83 4721.31 93.50%
2009-10 800.00 3818.47 1272.84 5091.31 5455.00 5087.97 93.27%
2010-11 639.00 4183.09 1394.36 5577.45 6058.78 5850.02 96.55%
2011-12
(Up to
SEP 11)
800.00 1943.50 647.83 2591.33 2833.54 1705.89 60.20%
Total 3683.00 16583.41 5527.80 22111.21 23508.66 21297.26 90.59%
Total Fund : Central and State releases , Opening Balance and other receipts
Source: Commissionerate of Rural Development, Government of Kerala.
14.31 The cumulative expenditure of the scheme under XIth Plan as on 30th September -2011 was
Rs.21297.26 lakh against the total available fund of Rs.23508.66 lakh (90.59%). The expenditure of
the scheme during 2010-11 was 96.55% which was just above the expenditure for the fnancial year
2009-10, i.e. 93.27%.
14.32 The targeted number of SHGs to be assisted during XIth Plan was 13997 and the physical
achievements till 30th September 2011 was 11324 (80.90%). The target for 2010-11 was to assist
3377 SHGs which was fully achieved. The achievement in the previous year was 91.66% of the target.
The total number of SHG members assisted under the scheme during XIth Plan till 30th September
2011 was 136870 against the target of 139971 (97.78%). Similarly the total number of individual
benefciaries assisted under the programme during XIth plan was 30246 against the target of 24740
(100%).
14.33 For the 11 SGSY special projects implemented in the XIth Plan, namely, THANIMA, KRITHIKA,
NIFT, KSPDC, COIRFED, MATSYAFED, SERISREE, SUBHICSHA, MEDICOM, MEDSEG and
NADAM, the State had released Rs. 1441.59/- lakh and the total fund, including the Centres share and
other miscellaneous receipts, was Rs.5951.33/- lakh. The cumulative expenditure till 30thSeptember
-2011 was ` 4536.58/- lakh (76.23%).
Economic Review 2011
414
14.34 The absence of an expert committee for identifying viable and feasible projects based on
local resource potentials had adversely affected the SGSY special projects implemented in the State.
More than 50% of the units were defunct with the result that the State had not been receiving Central
assistance to these projects since 2010-11.
3. Indira Awas Yojana (IAY)
14.35 This is yet another fagship programme of the Government of India for providing dwelling
units to the homeless rural poor below poverty line with a grant-in-aid of Rs.48, 500/- per house. The
programme ensures the benefciaries at least two cents of land. An amount of Rs.10,000/- is also
available for the purchase of homestead sites to the landless poor.
Table 14.11
Expenditure of IAY Programme XIth Plan Period (` in Lakh)
Year State
Budget
Provision
Release Total Fund Expendi-
ture
Expenditure
against Total
Fund (%)
centre State Total
1 2 3 4 5 6 7 8
2007-08 1000.00 7603.11 2562.50 10165.61 10889.09 10186.83 93.55%
2008-09 1451.00 15655.70 5009.45 20665.15 21610.53 15190.55 70.29%
2009-10 1451.00 16261.55 5440.14 21701.69 28337.24 21256.92 75.01%
2010-11 2377.00 18590.80 6196.94 24787.74 31896.87 23312.03 73.09%
2011-12
(Up to
SEP 11)
2420.00 9080.03 3026.68 22111.21 23508.66 21297.26 90.59%
Total 8699.00 67191.19 22235.71 89426.90 113442.61 77770.83 68.56%
Total Fund : Central and State releases , Opening Balance and other receipts
Source: Commissionerate of Rural Development, Government of Kerala.
14.36 The total fund released for IAY in the XIth Plan till 30th September 2011, was Rs.113452.61/-
lakh and the corresponding expenditure was Rs. 77770.83./-lakh (68.55%). The total release for the
programme during the fnancial year 2010-11 was Rs.31896.87/- lakh, 73.09% of which was expended.
This was slightly below the expenditure reported during 2009-10 (75.01%)
14.37 Considering the geographic and demographic background of Kerala, the cost of materials,
transportation charges, especially in the remote regions, the grant-in-aid per house given at present
is quite insuffcient. However, with the active support of the LSGIs the programme for construction of
houses is being implemented in Kerala satisfactorily.
4. Special Programme for Rural Infrastructure and
Development PMGSY
14.38 The Government of India has accorded highest priority to building rural infrastructure with the
objective of facilitating a higher degree of rural urban integration and for achieving an even pattern
of growth for the poor and disadvantaged sections of society. Some of the initiatives taken by the
Government to facilitate building of rural infrastructure and development include the PMGSY.
14.39 State support to PMGSY for meeting tender excess, shifting of utilities and maintenance
provision for assets already created was included in the State budget since 2010-11. The amount
earmarked in the budget 2010-11 was Rs. 2000/-lakh and the same had been fully utilized.
Kerala State Planning Board
415
.
Kudumbashree Mission
14.40 The Kudumbashree community-based organisation is a three-tiered structure with its apex tier
anchored in local self governments. The three tiers are; neighbourhood groups (NHGs) comprising of
10-20 women, area development societies (ADS) within wards of LSGs and community development
societies (CDS) registered society as the federation of ADS within the LSGs. The Kudumbashree
community organization network is present in all the 978 grama panchayats, 60 municipalities and 5
corporations. The total number of families covered by the mission as on 30thSeptember-2011 through
the three tiers is 38.31 lakh. Details of NHGs, ADS and CDS are given in Table 14.12.
Table 14.12
The Three-tiered Structure of Kudumbashree Mission
[Link] Name of Group Number
1 2 3
1 Number of NHGs 211731
2 Number of ADS 17486
3 Number of CDS 1061
Total 230278
Source: Kudumbashree Mission, Government of Kerala
14.41 The programmes of the mission focus on economic development as well as social development.
The former comprises of micro fnance activities such as thrift and credit, linkage banking, matching
grant and interest subsidy. The provisions under the programme are also meant for establishing micro
enterprises, samagra and collective farming. Social development activities comprises of Ashraya, BUD
Schools, projects for the welfare of SCs/STs, Balasabha, Balapanchayats, holistic health programmes
and gender self-learning programme.
14.42 Thus the major focal dimension of human development attempted for uplifting rural poor by
the mission include self-employment , food security ,health , creative potential development as well as
nourishing the innate talents in children ,voice and visibility of the poor through participatory approach
thereby preventing inter-generational transmission of poverty. Expenditure of Kudumbashree mission
2007-10 is given in table 14.13
Table 14.13
Expenditure of Kudumbashree mission 2007-10 (` in lakh)
Serial
No:
Category Outlay XIth Plan Cumulatve
Expenditure
Percentage Ex-
penditure
1 2 3 4 5
1 Organization 8748.00 5422.00 61.98%
2 Local [Link]. 22277.00 17166.00 77.06%
3 Social Dev. 1767.00 6274.00 100%
Total 32792.00 28862.00 88.02%
Source: Kudumbashree Mission, Government of Kerala
14.43 The cumulative expenditure till 2010-11 against the targeted outlay of Rs. 32792.00/- lakhs
Economic Review 2011
416
was Rs.28862.00/-(88%). The percentage expenditure for Socio-Economic Development activities
taken together till 2010-11 is 97.48 % while the percentage of expenditure for Organizational Setup is
only 62%.
Major Poverty Alleviation Programmes of Kudumbashree
1. Linkage Banking
14.44 NHGbank linkage scheme is one of the fagship programmes of Kudumbashree mission.
The bank linkage programme has helped NHGs to augment their existing resources collected through
thrift. The cumulative amount that had been lent to NHGs through linkage banking was Rs. 134460.27/-
lakh, as on 30thSeptember .The number of NHGs which availed of bank linkage was 1, 38,634.
The details of linkage banking are given in Appendix 14.7.
2. Lease Land Farming
14.45 Collective lease land farming is one of the major initiatives undertaken by Kudumbashree to
enhance livelihood of the poor families in NHGs by utilizing mainly fallow lands, a move towards the
goal of food security. Based on the NABARD JLG concept and guidelines, these groups are organized
as joint liability groups since 2010. Through this programme, 25062.081 ha of waste land was brought
under cultivation. District wise details of collective farming are given in Appendix 14.8.
3. Strenthening of Bala Sabha ,Bala Panchayat and
Holistic Child Health
14.46 Bala sabhas are structured grass root level neighbourhood network of children in LSGIs. Culti-
vating creative potential in children, by providing opportunities to express , learn and develop , iden-
tifying and nurturing innate talent that leads to the larger goal of recognition and protection of child
rights is the prime objective of the programme. Bala panchayats are apex level body of Bala sabhas
in Panchayats. As on 30thSeptember 2011, the formation of 50618 number of Bala sabhas across the
State has been completed with a membership of 878826 children. District wise details of Balasabha
and Bala Panchayat are given in Appendix 14..9
4. Micro Enterprises
14.47 Micro Enterprises are means for economic empowerment and employment opportunities to the
poor women with a view to increasing their purchasing power. An amount of Rs.37.69 lakh had been
provided as subsidy to 525 individual enterprises and an amount of Rs. 1236.28/- lakh had been
disbursed as subsidy to 2198 group enterprises till 30thSeptember 2011.
5. Special Programme Ashraya
14.48 Ashraya is the programme designed to identify and rehabilitate destitute families and integrate
them with mainstream civil society. Destitute families are identifed using transparent risk indices and
a participatory need assessment process, as detailed in Economic Review 2003. It is the comprehen-
sive project to address the various deprivations faced by destitutes in society. The main objectives of
the programme is to rehabilitate the entire destitute families of the state by providing them with basic
minimum needs, improved health, education and literacy levels and to enhance the social and eco-
nomic status by empowering them, to stand with the rest of the society, under the leadership of local
Kerala State Planning Board
417
bodies. The specifc objectives include
Provision for basic infrastructural support for the destitute in the society.
Provision for food for the starving, shelter to the homeless.
Provision for support for destitute with medical and care services.
Educational and pension support to destitute families.
Income generation activities among the destitute families.
14.49 The cumulative number of destitute families assisted under the programme till sep.2011-12 is
73827. The fund available with Kudumbashree is for supporting the initiative of Local Self Govern-
ments @ 40% of total project cost, subject to a maximum of ` 15 Lakh per Local Self Government.
The detailed physical achievements of various programmes implemented by the Kudumbashree Mis-
sion are given in the report as Appendix 14.10.
14.50 It is being planned to implement the demand driven National Rural Livelihood Mission (NRLM),
the restructured and rechristened SGSY programme of the Central Government for eradication of
poverty through gainful self employment or wage employment programmes, through Kudumbashree.
Kudumbashree was accredited by the Radhakrishna Committee constituted for recommendations on
NRLM in the sense that the committee suggested the replication of this Mission mode for implementing
NRLM across the country.
Urban Poverty
14.51 Urban poverty is a multidimensional phenomenon. It is not only nutritional defciency but def-
ciencies in the basic needs like housing, water, sanitation, medical care, education and opportunity for
income generation that contribute to it. According to the National Commission on Urbanization, poverty
cannot be characterized adequately in terms of income, expenditure or consumption pattern alone.
What is required is a multi dimensional concept inclusive of environment, access to services, social
and psychological supports. The following are the main reasons for urban poverty.
Migration of rural youth towards cities
Lack of vocational education/training
Limited job opportunities in the cities
Rapid increase in population
Lack of housing facilities
No proper implementation of PDS
14.52 Despite tremendous development in several areas like literacy and health care poverty re-
fuses to leave the State. More than ffteen lakh families are still caught in the clutches of poverty. High
density of population in urban areas has contributed to urban poverty. This manifests itself in many
forms, such as slums, unemployment, lack of social services, and increasing violence and crime. The
National Sample Survey Organization (NSSO) in its 61st round survey (2004-05) had estimated that
in Kerala poverty was 20.6 % in urban areas. The magnitude of urban unemployment has also been
increasing due to stagnation in manufacturing industry resulting in fewer employment opportunities
for urban dwellers. The National Sample Survey data showed that urban unemployment in Keralain
2000 was the second highest in India, at 10% (only after Goa). Due to rapid increase in land price and
construction costs, a good number of the urban people in Kerala are forced to live in slums. The living
conditions of slum dwellers are very pathetic. Availability of drinking water and sanitation facilities are
Economic Review 2011
418
grossly inadequate. Only one-fourth of households in slums have electricity. The composition of the
poor has been changing. While rural poverty is getting concentrated among agricultural labour and
artisan household, urban poverty afficts casual labour households.
14.53 A well co-ordinated approach is necessary to reduce urban poverty for which the following
aspects have to be considered seriously. i) Employment opportunities of a permanent nature need
to be made available to the poor both by macro strategies aimed at labour intensive growth and micro
strategies to enable the poor to attain the skills needed by the formal and semi formal sectors. ii) Self-
employment, product development, and marketing should be promoted. iii) Urban local bodies and
the State Government should ensure minimum standard in basic infrastructure relating to housing,
water supply, sanitation, electricity and roads. iv) Access of the poor to quality health and education fa-
cilities needs to be ensured, which, in turn, calls for improving the services available through hospitals
and schools. v) Finally, the most vulnerable groups need to be identifed through a transparent index.
A robust social protection system has to be set up for them, with a much higher level of support than
at present. Many of these issues will be addressed through the proposed project in the urban sector.
14.54 Rapid growth of urban population, expansion of existing towns and cities and low investment
in urban development have created defciencies in basic amenities, especially in the urban areas. The
shortages are serious for the urban poor due to inequality in the access to these amenities.
14.55 Poverty Index: Every two years, a survey is conducted for assessing urban poor by CDS using
the poverty index following non-economic criteria with nine risk factors refecting the poverty situations
of families. The neighbourhood community verifes these factors with the identifed families.
The nine risk factors of the poverty index in urban area.
A family having:-
Less than 5 cents of land/no land
Dilapidated house/no house
No sanitary latrine
No access to safe drinking water within 150 meters
Women headed household
No regular employed person in the family
Socially disadvantaged groups SC/ST
Mentally retarded/disabled/chronically ill member in the family
Families without colour TV
Any family having 4 or more factors is classifed as family at risk.
(Source: Kudumbashree, Thiruvananthapuram)
14.56 Kudumbashree: The State Poverty Eradication Mission is the State level nodal agency for
the implementation of major Centrally-sponsored urban poverty reduction programmes viz Swarna
Jayanthi Shahari Rozgar Yojana (SJSRY), Integrated Housing and Slum Development Programme
(IHSDP) and Basic Services to the Urban Poor (BSUP).The physical and social developments as well
as direct assistance to employment generation are the schemes taken up under these programmes.
Kudumbashree has organized community-based organizations (CBOs) of the poor in the State. Com-
Kerala State Planning Board
419
munity development societies (CDS) act as delivery system for various Centrally-sponsored urban
poverty reduction programmes.
Urban Poverty Reduction Programmes
1. Swarna Jayanthi Shahari Rozgar Yojana (SJSRY)
14.57 Swarna Jayanthi Shahari Rozgar Yojana (SJSRY) is a Centrally-sponsored scheme launched
in December 1997. The fund is shared on 75:25 basis by both Central and State Governments. The
objective of this integrated poverty alleviation programme is to provide gainful employment to the
urban unemployed and under-employed poor by setting up self- employment ventures and taking up
wage employment in public works. The programme is being implemented by the urban local bodies
through community-based organization of the poor. The components of the programme are as follows.
1) Urban Self-employment Programme The major objective of the scheme is to provide assistance
to individual urban poor benefciaries for setting up gainful employment ventures micro enter-
prises.
2) Urban Women Self-help Programme (UWSP) It encourages the under-employed and unem-
ployed urban poor to set up small enterprises relating to manufacturing, servicing and petty busi-
ness for which there is potential in urban areas.
3) Urban Women Self-help Programme (UWSP) Revolving Fund: Revolving fund for enterprise
groups as working capital support of matching grant, incentive to neighbourhood groups for bank
linkage.
4) Technology, Marketing and Other Services (TMOS): Creation of support mechanism for micro
enterprises on various areas of business management.
5) (STEP-UP) for Self-employment Training: For enabling correct selection of benefciaries for USEP
and UWSP enterprises and to build necessary skills for them to run the enterprises.
6) STEP-UP Placement-oriented training to enable urban poor to acquire skills and access em-
ployment opportunities in various sectors of the economy.
7) Urban Wage Employment Programme (UWEP):- This programme seeks to provide wage employ-
ment to benefciaries living below the poverty line within the jurisdiction of urban local bodies by
utilizing their labour for construction of socially and economically useful public assets.
8) Urban Community Development Network (UCDN) This programme focuses on strengthening
community structures and community development networks.
9) A&OE: Meeting administrative expenses at the State and district levels.
10) Information, Education and Communication (IEC): For undertaking information, communication
and education activities to promote SJ SRY.
14.58 Kudumbashree has organized community-based organizations (CBOs) of the poor in all the
65 urban local bodies in the State. There are 26348 neighbourhood groups (NHGs) having a mem-
bership of 429956. The CBOs in the urban areas act also as thrift and credit societies and facilitate
savings and credit to the poor. District- wise details of NHGs, ADSs, CDSs and thrift fund mobilized
are given in Appendix.14.11
Economic Review 2011
420
14.59 In 11th Five Year Plan (2007-08 to 2011-12), 8692 individual enterprises (USEP) and 1084
group enterprises (UWSP) were set up in SJ SRY scheme. As part of both these components, a total
of 18319 families were also assisted. Similarly, under STEP, 15871 persons were trained in various
sectors. Tables 14.14 and 14.15 show the fnancial and physical achievements of SJSRY (2007-08 to
2011-12). Details of micro enterprises and group enterprises are given in Appendices 14.12 and 14.13
The activities of group enterprises vary from solid waste management to the computer hardware as-
sembling.
Table 14.14
Financial Achievement of SJSRY (2007-08 to 2011-12)
(` in Lakh)
Year Fund Released Expenditure % of expen-
diture
Central State Total
2007-08 629.74 209.913 839.653 839.653 100
2008-09 1017.91 339.303 1357.213 1357.213 100
2009-10 948.13 316.043 1264.173 1187.04 94
2010-11 474.03 0 474.03 632.052 133
2011-12 688.26 0 688.26 310.808 45
Total 3758.07 865.259 4623.329 4326.766 94
Source: Kudumbashree, Thiruvananthapuram
Table - 14.15
Physical Achievements of SJSRY (2007-08 to 2011-12)
Year
Individual Enterprises
Developed
Group Enter-
prises Devel-
oped
Persons Man days created
under Wage Em-
ployment
2007-08 1426 190 2245 0.137
2008-09 1572 208 2362 0
2009-10 1600 214 2412 0.13995
2010-11 1670 215 2526 0.15627
2011-12 2424 257 6326 0.96212
Total 8692 1084 15871 1.39534
Source: Kudumbashree, Thiruvananthapuram
2. Integrated Housing & Slum Development Programme (IHSDP)
14.60 The Integrated Housing and Slums Development Programme (IHSDP) was launched during
2006-07 aiming at holistic development of slums in urban areas. The basic objective of the scheme
is to strive for holistic slum development with a healthy environment by providing adequate shelter
and basic infrastructure facilities to slum dwellers of identifed urban areas. The programme was
formulated by combining two erstwhile schemes, viz, Valmiki Ambedkar Awas Yojana (VAMBAY) and
National Slum Development Programme (NSDP). IHSDP is to be implemented in all towns and cities
identifed as per 2001 census except cities/towns covered under JNNURM. (Thiruvananthapuram and
Kerala State Planning Board
421
Kochi Corporations).
14.61 The components for assistance under IHSDP include all slum development/ improvement/relo-
cation projects including new house construction/improvement of houses and infrastructural facilities.
Admissible components under the IHSDP are:
Provision of shelter including improvement & construction of new houses
Provision of community toilets
Provision of physical amenities like water supply, storm water drains, community bath, widening
and paving of existing lanes, sewers, community latrines, street light etc.
Community infrastructure and social amenities like provisions of community centres to be used
for pre-school education, non-formal education, adult education, recreational activities, primary
health care centre buildings.
Provision of model demonstration projects
Slum improvement and rehabilitation projects
The achievements for 2010-11 and 2011-12 (up to 30.9.2011) are summarized below in table 14.16
Table 14.16
Achievement 2010-11
2011-12
(up to September 2011)
New Houses 1191 610
Improvement of houses 2747 1370
Infrastructure works 278 59
Expenditure in lakh 3077 1701.12
14.62 The fnancing pattern is in the ratio of 80:20 by Central and State Governments. Benefciary
share (12% for general and 10% for SC/ST) is stipulated for projects for individual benefciaries like
housing. Out of 20% State share, the balance fund after deducting benefciary share will be borne
equally by the ULB and State (Maximum state share is 10% of the total Project Cost).
14.63 Details of projects approved by GOI during 2006-07, 2007-08, 2008-09 and 2009-10 of 45
ULBs are given in Appendix 14.14.
3. Basic Services to the Urban Poor (BSUP)
14.64 Basic Services to the Urban Poor (BSUP) is a sub-component of the J awaharlal Nehru National
Urban Renewal Mission (J NNURM) and implemented through Kudumbashree. The duration of the
mission is seven years beginning from 2005-06. Only two corporations in the State, Thiruvanantha-
puram and Kochi, come under the scheme. The objective of the scheme is to provide basic services
and civic amenities with a view to providing utilities to urban poor.
14.65 The total allocation under BSUP to the State during the mission period is Rs. 250 crore.
Projects are sanctioned based on detailed project report submitted by the mission cities. The Central
share is released in 4 instalments of 25% each based on submission of utilization certifcate for 70%
expenditure of the funds released. The fund sharing pattern for Thiruvananthapuram is 80:20 by Cen-
tral and State Governments. The States share is borne equally by it and the local bodies. As for Kochi
Corporation, the sharing pattern is 50:50 by Central and State Governments. Out of the States share,
30% would be borne by the State Government and the balance, after deducting the benefciary share,
come from the respective ULBs.
Economic Review 2011
422
14.66 Four phases of projects worth ` 208.01 crores and 3 projects worth ` 135.66 crores was sanc-
tioned for Thiruvananthapuram and Kochi Corporation respectively. The total central share for sanc-
tioned projects of Thiruvananthapruam and Kochi is ` 233.51 crores out of which ` 125.37 crores were
already released by Government of India. Total state share committed in ` 40.77 crores the central
share released by Government of India of ` 125.37 crore and corresponding state share amounting
to ` 35.20 crore have been released to Kudumbashree by the State Government. Details of projects
sanctioned under BSUP for the two Corporations during 2006-07, 2007-08 and 2008-09 are given in
Appendices 14.15 and 14.16
Achievements
14.67 3740 new houses and 327 upgradation of existing houses were completed during the year
2010-11 total expenditure during the period is 3983 lakhs. The achievement for the year 2010-11 and
2011-12 up to 30.9.2011 are summarized below in Table 14.17
Table 14.17
Achievement 2010-11
2011-12
(up to September 2011)
New Houses 3740 1618
Upgradation of houses 327 104
Expenditure in lakhs 3983 1802.2
Social Security and Welfare
14.68 In every society there are people who require social support for a well being. Poor income,
unemployment and underemployment, physical disability, destitution, ill-health etc. are the main fac-
tors which hinder the well being of these people. It is the duty of the government and society to take up
programmes to bring these people to the mainstream of the society. Keralas achievement in this area
is acknowledged worldwide. The state gives very much importance to the social security programmes
in its Five Year Plans and Annual Plans. Setting up of welfare fund boards for workers in the unor-
ganised sector, introduction of a series of pension schemes to the aged and disadvantaged groups,
formation of a state level Social Security Mission are some of the major steps taken for protecting the
disadvantaged groups.
14.69 It was identifed that these concerted efforts were not enough to provide protection to a group of
people who were anywhere in the picture of the development programmes. By the end of the 10th Five
Year Plan, the Ashraya programme was introduced to cover these [Link] challenges remain: the
decline in agricultural employment, low work participation of women, under nutrition and malnutrition,
marked growth of the elderly people, exploitation of the weak, etc.
14.70 Lack of an effective delivery system is one of the major problems in achieving the desired
results of the welfare programmes and state interventions. Strengthening of the institutions at the de-
livery end is necessary for the success of the social security programmes. Also, the delivery of social
security services can be improved to a great extent by better institutional arrangements and adopting
innovative technologies.
14.71 The social security programmes in Kerala can be grouped into two viz., Institutional Care and
Social Assistance Programmes.
Kerala State Planning Board
423
Institutional Care and Protection
14.72 The Government and voluntary organisations provide institutional care and protection mainly
to orphaned children, aged and infrm, mentally cured patients, physically handicapped, destitute etc.
Major welfare activities under institutional care and protection are undertaken by the following Govern-
ment Departments, Commissions, Institutions and Corporations as shown in Box No.14-2
Box: No. 14. 2
Major Government Departments and Agencies stands for social security measures
Sl.
No.
Major Government Departments/Agencies Major Actvites
1 Social Welfare Department Social security welfare activities, social defence
activities, nutrition programmes
2 Prisons Department Welfare, protection, employment and economic
uplift of prisoners.
3 Sainik Welfare Department Welfare of Ex-servicemen and war-widows.
4 State Commissionerate for Persons
with Disabilities
Welfare and social security measures for the
disabled.
5 Women's Commission Welfare and social justice measures addressing
atrocities against women, adalaths, legal work-
shops, jagratha samithies, etc.
6 Kerala State Womens Development
Corporation
Welfare, skill development, economic develop-
ment through income generating and employ-
ment generating schemes.
7 National Institute of Speech and Heaing Welfare, education, health activities of disabled in
speech and hearing.
8 State Institute for the Mentally Handi-
capped
Welfare, education, skill development etc of men-
tally challenged persons.
9 Kerala State Handicapped Persons
Welfare Corporation
Welfare, employment, income generating pro-
grammes of physically handicapped persons.
14.73 The Scheduled Castes Development Department, Scheduled Tribes Development Department
and Kudumbashree etc. are the other major agencies involved in addressing the problems of deserved
groups. Provision of education, skill development, programmes for improving the income level of
families, food support etc. are the major programmes taken up by these agencies.
14.74 The various welfare institutions run by the Social Welfare Department and its major services as
shown in Box: No.14.3.
Box No.14.3
Major Welfare Institutions run by Social Welfare Department and Services
[Link]. Name of Insttuton Services Ofered
1 Mahilamandiram Maintenance, education, vocational training, reha-
bilitation of the abandoned women above the age of
13 years
2 After Care Home Care, protection and rehabilitation for children/ ado-
lescents coming from J uvenile/ Welfare institutions.
Economic Review 2011
424
3 Rescue Home Protection and Rehabilitation of girls above 13
engaged in immoral activities or who are in fear of
being forced into such activities.
4 Children's Home Provides care and protection to destitute children
and children of leprosy patients
5 Old Age Home and Day Care
Centre
Care, protection and rehabilitation of the aged by
providing food, clothing, medical services, shelter,
etc.
6 Home for Physically Handi-
capped (Men & Women)
Care, maintenance and rehabilitation of the destitute
handicapped above the age of 16. Separate homes
are functioning for women and men.
7 Asha Bhavan Mentally cured patients abandoned by relatives are
taken care of by providing food, medicine, clothing,
etc. and rehabilitation/reunion with family whenever
possible.
8 Care Home for the Disabled Maintenance, education, rehabilitation, etc of the
handicapped children in the age group of 4-16.
9 Short Stay Home Providing living amenities to women in distress
arising out of family discord, and those fearing of
being forced in to immoral activities. They are given
proper counselling and rehabilitated within a stipu-
lated period.
10 Home for Mentally Defcient
Children
To provide special education, maintenance and re-
habilitation of mentally challenged children between
the age of 14-16.
11 Pratheeksha Bhavan Care, protection, maintenance of mentally chal-
lenged persons above the age of 16.
12 Vocational Training Centres To provide vocational training courses for the physi-
cally handicapped boys and girls so as to rehabili-
tate them.
13 Home for Physically Handi-
capped (Aged)
Care and protections of the aged and physically
handicapped who have nobody to look after.
14 One day Home To provide shelter for the girls or women who came
to the cities for attending PSC test, interviews etc.
15 Home for Adult mentally chal-
lenged persons-female (Pra-
thyasa Bhavan)
Care and protection of mentally defcient women
above the age of 16.
14.75 Details of the welfare and juvenile justice institutions and its inmates are given in Table 14.14
The district wise details are given in Appendix 14.18
Table-14.18
Welfare Institutions, Sanctioned strength and Inmates 2011
[Link]. Insttutons Numbers Inmates
(Nos.)
Sanctoned
Strength (Nos.)
1 2 3
4 5
1 Mahilamandiram 12 231 300
Kerala State Planning Board
425
2 After Care Home 3 96 250
3 Rescue Home 1 17 100
4 Children's Home 1 31 50
5 Old Age Home 14 697 1250
6 Homes for Physically Handicapped (Aged) 4 127 150
7 Asha Bhavan 6 293 300
8 Care Home for the disabled children 2 22 50
9 Short Stay Home 1 4 25
10 Home for Mentally Defcient Children 1 41 50
11 Pratheeksha bhavan 1 57 50
12 Vocational Training Centre 2 100 100
13 Home for physically Handicapped men and
women
3 64 125
14 Home for adult mentally challenged persons
(female)
1 18 25
15 Day Care Centre and Old age Home 1 23 75
16 Prathyashabhavan 1 18 25
Total 54 1839 2925
Source: Social Welfare Department
14.76 The gap in the number of occupants and the sanctioned strength of inmates reveals the
ineffectiveness of the delivery system which requires a thorough revamping to reach the deserved
and needy.
Welfare of the Old Age People
14.77 The population of the aged in Kerala is increasing at a rapid rate. The projected fgure by the
end of the 12th plan, 2 % of the population would be above 80 years of age. It is estimated that the life
expectancy of the males is 68 years while that of females is 73 years. This accounts for higher number
of elderly people in society. It is also noted that women outnumber men. If the present trend persists,
by 2030 Keralas older population will be more (20%) than its child population (18%). The protection
and welfare of the aged will be a major challenge to the state and society.
14.78 There are 15 Old Age Homes functioning under the department of social welfare for the care and
protection of the aged. Details are given in Table 14.19
Table-14.19
Welfare Institutions, Sanctioned strength and Inmates 2011
[Link] Insttutons Numbers Total Inmates
(Nos.)
Sanctoned Strength
(Nos.)
1 Old Age Home 14 697 1250
2 Day care Centre & Old
Age Home
1 23 75
Total 15 720 1325
Source: Social Welfare Department
14.79 The present institutions lack facilities for counselling and geriatric care. The physical, emotional
and psychological problems faced by the elderly people due to aging demand that these institutions be
revamped. Participation and involvement of NGOs and other welfare organisations can be thought of to
ease or share the fnancial burden of revamping and providing the above facilities in these institutions.
Economic Review 2011
426
Welfare of the Disabled
14.80 As per the latest available statistics, 2.7% population of Kerala is disabled in one form or other.
The department of Social welfare, Health and Education are the major departments implementing
schemes for the welfare and the development of persons with disabilities. Moreover the Government
have set up autonomous institutions to impart social security to the disabled through institutional care
and protection.
14.81 There are 18 institutions working under social welfare department for the care of physically and
mentally challenged persons in the state. Details are given in Table 14.20
Table 14.20
Institutions for Physically & Mentally Retarded Persons 2011
Sl.
No
Insttutons Numbers Total Inmates
(Nos.)
Sanctoned
Strength (Nos.)
1 Home for Mentally Defcient children 1 41 50
2 Home for Physically Handicapped 3 64 125
3 Home for Cured Mental patients
(Asha Bhavan)
6 293 300
4 Care Home for Disabled Children 2 22 50
5 Home for Physically Handicapped
(Aged)
4 127 150
6 Pratheeksha Bhavan (Home for
Mentally Retarded above 16 years)
1 57 50
7 Home for adult Mentally Challenged
Persons (female)
1 18 25
Total 18 622 750
Source: Social Welfare Department
14.82 According to the Persons with Disability Act, 1995 it is mandatory to provide disability certifcate
to all disabled. In view of this, Government started a scheme in 2009-10, viz., Issuing Disability
Certifcate-cum Identity Cards to all the disabled persons in Kerala. The social welfare department is
the implementing agency of the scheme. From December 2009 to May 2010, the department issued
200774 identity cards in 8 districts. Though the programme envisaged the issue of ID cards to the
entire disabled population by the end of 2011-12, only 8 districts had so far been covered.
State Commissionerate for Persons with Disabilities
14.83 Persons with Disabilities Act,1995 deals with both prevention and promotional aspects
of rehabilitation such as education, employment and vocational training, creation of barrier free
environment, provision of rehabilitation services for persons with disabilities, institutional services
and supportive social security measures like unemployment allowances and grievance redressal
machinery at the Central and State level. The State Commissionerate, set up under the Act, conducted,
during 2010-11 awareness camps, redressal of the complaints of disabled persons, inspection of
institutions for disabled, besides organising seminars to elected members of local bodies, including
Anganwadi workers and ICDS supervisors. The Commissionerate also telecasted video quickies
and documentation through various media and displayed boards and slides regarding the rights and
privileges of the disabled.
Kerala State Planning Board
427
National Institute of Speech and Hearing (NISH)
14.84 NISH was established in March 1997 for the rehabilitation and welfare of the deaf and hard of
hearing persons in the state with facilities for detection and evaluation of hearing loss and rehabilitation.
The activities conducted in the area of disabilities are as follows.
Pre- school programmes and parent guidance programmes
Audiology evaluations and speech evaluations
Speech therapy
Physiotherapy
Psychology services and medical services
Ear mould fabrication
Academic programmes
14.85 Major achievements of NISH during 2010-11 are;
Audiology department of NISH conducted 2948 evaluations.
Speech therapy section completed 1048 speech evaluations.
Psychological department provided psychological evaluation to 341 individuals
Medical division examined 920 cases of hearing impairment.
Audiology department completed 1493 ear moulds.
Early detection centres had been setup at all district hospitals for screening disabilities.
Kerala State Handicapped Persons Welfare Corporation
14.86 The Kerala State Handicapped Persons Welfare Corporation is a state undertaking set up in
1979 for promoting and implementing welfare schemes for the development of disabled persons. It
also provides fnancial/technical assistance to differently abled persons, their groups and orgnisations
engaged in the area of disability. Distribution of aids and appliance, self- employment scheme (Bank
loan subsidy), subsidy for motorized cycles, fnancial assistance to self- help groups and disabled lottery
agents, vocational training to SC/ST disabled persons, etc are the major activities of the corporation.
It also implements schemes to assist the disabled persons for purchase/ftting of aids/appliances,
with the assistance of Ministry of Social J ustice and Empowerment. Moreover, the corporation is the
nodal agency for the implementation of the NPRPD scheme of Government of India which is being
implemented in the three districts of Kasaragod, Palakkad and Kollam. The major objective of the
scheme is prevention of disabilities, early intervention and rehabilitation.
14.87 The details of self - employment assistance provided from 2007-08 to 2010-11 by the Corporation
are given in Table 14.21
Table 14.21
Self Employment Assistance to Disabled Persons
Year Applicatons
Received
(Nos.)
Applicatons sanc-
toned and forward-
ed to Banks (Nos)
Applicatons
sanctoned by the
Bank(Nos.)
Amount released by the
Corporaton (Rs.)
1 2 3 4 5
2007-08 642 642 295 7,25,821
2008-09 643 643 268 7,22,100
2009-10 754 754 423 17,91,250
2010-11 971 971 297 16,00,000
Source: Kerala State Handicapped Persons Welfare Corporation
Economic Review 2011
428
14.88 The details of aids and appliances distributed from 2007-08 to 2010-11 by the Corporation are
given in Table 14.22
Table 14.22
Aids and Appliances Distributed through KSHPWC
Year No. of Aids and Appliances Dis-
tributed
Amount ([Link] lakh)
2007-08 561 19.00
2008-09 1065 30.00
2009-10 1835 49.90
2010-11 1143 69.00
Source: Kerala State Handicapped Persons Welfare Corporation
14.89 The corporation distributed cash awards@ Rs.2500 to the disabled student who secured highest
mark in SSLC and Higher Secondary examinations at the district and @ Rs. 5000 at state level. The
number of students given awards during 2010-11 is 104.
Social Assistance Programmes
14.90 Social Assistance Programmes aim at providing livelihood to those who suffer absolute
deprivation and vulnerability. This includes old age pension, widow pension, disabled pension,
unemployment assistance.
14.91 Several pension schemes are being implemented by Government as a safety net for vulnerable
sections of society. There are more than 40 pension schemes of which 20 are fnanced by the State.
These pension schemes are implemented directly by Government departments or through different
Welfare Fund Boards. The National Old Age Pension Scheme (renamed as Indira Gandhi National Old
Age Pension scheme), a part of the National Social Assistance Programme of Government of India
has been in operation since 1995 for persons above 65 years of age. The total number of benefciaries
of the scheme during 2011-12 is 261846.
Kerala State Planning Board
429
14.92 The district wise benefciaries on pension schemes implemented through Revenue department
during 2011-12 are given in Appendix 14.18
Social Security Measures Exclusively for Women
14.93 According the provisional census of 2011, in Kerala the women constitute 52.01% of the total
population. Even though the position of women in Kerala has improved substantially according to
conventional indicators there has been no proportional improvement in their socio economic status.
Several schemes for the social security of women are under implementation. Destitute/widow pension
is a major scheme. The scheme benefted 678217 women during 2011. Of the total benefciaries of the
scheme the highest number of benefciaries is from Thiruvananthapuram district (77363) and lowest
number is from Idukki district (11670). Details are given in Appendix 14.18
Women Development Programmes
14.94 Women development schemes aim at eradicate gender discrimination through welfare and
awareness programmes. Gender awareness and fnishing school for women were introduced in the 11th
Five Year Plan as gender fagship programmes.
14.95 Major women development programmes have been implemented through the Social Welfare
Department. Vocational Training Centres, one day homes, economic support to families headed by
women, developing Anganwadi Centres as community resource centres for pregnant and lactating
mothers, nutrition programme for adolescent girls are the major programmes implemented by the
department. In addition, two women specifc organisations implementing programmes for women is
detailed below.
Kerala Womens Commission
14.96 Kerala Womens Commission was established in 1996 as a statutory body constituted under
Kerala Womens Commission Act 1990 (Act 17 of 1995) with the objective to improve the status of
women and to enquire into unfair practices against women. Conducting seminars to promote gender
conciousness, redressal adalaths, awareness programmes/legal workshops, district level J agratha
Samithies, research studies about womens problems, DNA tests, publishing of Sthree Shakti magazine,
managing short stay homes, Kalalaya J yothi, awareness through print media/broadcast/telecast and
counselling and helpline are some of the major activities of the commission. Major achievements of
the commission during 2010-11 are;
Conducted 132 seminars and arranged three DNA tests.
Provided temporary accommodation to 250 old women in the short stay homes.
Conducted awareness programmes (kalalayajyothi) in schools and colleges benefting 48527
students.
Arranged 7 pre-marital counselling programmes benefting 1065 persons.
Disposed 4987 petitions by conducting 99 adalaths.
14.97 The details of complaints received by Kerala Womens Commission from J anuary 2011 to
September 2011 are given in Appendix 14.19
Kerala State Womens Development Corporation (KSWDC)
14.98 Kerala State Women Development Corporation (KSWDC) was established in 1988 under the
Companies Act 1956 with the objective of formulating, promoting and implementing women welfare
programmes. The benefciaries include women from the backward classes, minority communities,
scheduled castes and BPL women from the general category. During 2010-11 the programmes and
schemes of the corporation beneftted 207193 women. In this period 2582 families below poverty line
were benefted by self-employment loan.
Economic Review 2011
430
14.99 KSWDC is the State channelising agency for national corporations such as NSFDC, NSTFDC,
RMK, NBCFDC, NMDFC and NHFDC. During 2010 -11, the corporation provided fnancial assistance
to 10000 women in different backward categories.
14.100 Under the gender fagship programmes on fnishing school, the corporation focus on women
empowerment through skill development programmes. As many as 1060 women gained by them,
of which 895 benefciaries had assured placement. As part of fagship programme on gender, the
corporation conducted awareness programme in 40 womens colleges covering around 2 lakh students.
14.101 The KSWDC has set up REACH (Resource Enhancement Academy for Career Heights), a
fnishing school for women to give training in IT, personality development, English and other soft skills.
During 2010-11, 346 benefciaries had been trained of which 95 % got placement in various institutions.
Welfare of Ex-Servicemen and War Widows
14.102 There are 1,58,602 ex-service men, 46,000 widows and 262 war widows holding ID cards
issued by Zilla Sainic Welfare Offces as on 30th September 2011. Rehabilitation training on
vocational/professional/technical courses for equipping the ex-service men/war widows for suitable
re-employment or self-employment is a major programme envisaged by the department. Details of Ex-
Servicemen and War Widows in Kerala from 2007 to 2011 are given in Table 14.23
Table 14.23
Ex-Servicemen and War Widows in Kerala from 2007 to 2011
Year Ex-Servicemen (No.s) War Widows (No. s)
2007 149946 313
2008 153318 303
2009 155401 302
2010 157919 304
2011 158602 262
Source:Department of Sainik Welfare
14.103 Major activities implemented through the department of Sainik Welfare during 2011 are shown
in Table 14.24
Table 14.24
Major Welfare schemes/ achievements of Ex-Servicemen/War Widows during 2011
[Link]. Name of Scheme Benefciaries
(Nos)
Amount spent
during 2011
1 Financial assistance to Second World War Veterans
who are in indigent circumstances @1000 p.m.(w.e.f
01.04.2011)
1200 4655468 (as on
30/9/2011)
2 Construction of houses for disabled Ex-Servicemen 3 70000
3 Cash awards to recipients of Gallantry Decorations
in the defence service and dependents of defence
personnel
3 62050
4 Financial help for children of Ex-service men 37 111000
5 Training to Ex-service men/widows NA NA
Kerala State Planning Board
431
6 Cash awards to recipients of
Territorial Army Medal/Decorations in the Territorial
Army Service and dependents of Territorial Army
personnel
9 18000
Source: Department of Sainik Welfare
Welfare of Prisoners
14.104 Crimes of various types and magnitude are on increase. At present there are 49 jails and the
number of prisoners in jails is 6488. Details are given in Table 14.25 and its district wise break-up are
given in Appendix-14.20
Table 14.25
Details of Prisoners 2011 (as on 30.10.2011)
Type of Jail No. of jails Male(Nos) Female(Nos) Total (Nos)
Central J ail 3 2465 0 2465
District J ail 4 936 19 955
Sub J ail 29 1715 23 1738
Open Jail 2 346 0 346
Women J ail 3 0 108 108
Special Sub J ail 8 855 21 876
Total 49 6317 171 6488
Source: Department of Prisons
14.105 Modernisation of Prison and Welfare of Prisoners are the two major schemes implemented by
the prison department. During 2010-11, the fnancial achievement of the schemes was 100%. Major
physical achievements are;
Installed CCTV-Cameras in central prison, Kannur.
Constructed a check dam at open prison, Nettukalthery.
Completed the computerisation process of jails.
Established poultry farm in open prison at Nettukalthery and Cheemeny.
Started foriculture units in Central prison at Viyyur and in district jail, Ernakulam.
Established a rubber nursery unit in open prison at Nettukalthery
Established mushroom cultivation units in 5 major jails and Brostal School, Thrikkakara.
Social Defence Programmes
14.106 The prime function of the criminal justice system is to reform and rehabilitate a person who
is found guilty as a useful member of the society. Probation services, community services, day care
centres and brostal schools for adolescent offenders are the non-institutional forms of treatment of
offenders. Financial assistances to ex-convicts, victim rehabilitation programmes and indigent convict
scheme are the major activities under social defence programme. During 2010-11, fnancial assistance
was given to 85 probationers, 106 ex-convicts and 9 victims.
Adoption
14.107 Adoption is recognised as the best non institutional form of child care to discarded children or
children without parent or children without a family set up. The major activities under the programme
are;
Economic Review 2011
432
To establish baby cradle centres (Amma Thottils)
Strengthening/organizing adoptive parents organization in all districts and organizing get-together
conferences of adoptive parents, adoptive children and other stakeholders at district and state
level.
Conducting adoption awareness programmes by incorporating various state departments including
LSGs, NGOs and other stakeholders.
Providing minimum standards of services and procedures for adoption placement agencies.
14.108 There is a signifcant reduction on adopted children during 2010 compared to the previous
years. Details of adopted children in Kerala from 2007-08 to 2010-11 are given in Table 14.26
Table No: 14.26
Adopted Children in Kerala from 2007-08 to 2010 11
Year In-country adopton Inter-country adopton
Male Female Total Male Female Total
2007-08 183 10 183 9 13 22
2008-09 49 41 90 6 6 12
2009-10 100 103 203 14 25 39
2010-11(upto
30/09/2011)
55 24 79 5 6 11
Source: Social Welfare Department
Social Security and Welfare to Unorganized Sectors
Welfare Fund Boards
14.109 Kerala has made considerable progress in extending social security coverage to workers in the
unorganised sector through welfare fund boards by providing welfare assistance, income security and
employment to them. There are 28 Welfare Fund Boards constituted in the unorganised labour sector.
The general welfare measures implemented by the Workers Welfare Fund Boards are the following:
Pension benefts to the workers on their retirement or invalidity or family pension after their death.
Ex-gratia fnancial assistance to workers on prolonged illness/ permanent disability and death
relief to the dependents for funeral and related functions.
Medical reimbursement for medical treatment of the workers or dependents.
Marriage assistance for daughters marriage.
Educational assistance to members children like scholarships, cash awards and lumpsum grants.
Long term housing loans at low interest rate.
Maternity benefts.
Funeral expenses.
14.110 Details available shows the total numbers of members enrolled in these boards at 50 lakh, of
which 25.22 lakh are in agriculture sector including fsheries and diary. Female workers outnumbered
males in industries such as cashew, tailoring, coir, bamboo and beedi. In boards like Toddy Workers
and Abkari Workers, above 99% of the workers are male. Lack of effective delivery mechanism and
limited expertise in fund management are the major problems faced by these institutions. Details
regarding the total number of workers, enrolled workers and male-female workers are shown in Ap-
pendix 14.21 The details of major welfare measures of the welfare fund boards during 2011 are given
in Appendix 14.22.
Kerala State Planning Board
433
Unemployment Assistance
14.111 Unemployment assistance scheme is the most important social security schemes of the Gov-
ernment of Kerala. It was introduced in the state in 1982 under non-plan and is being implemented
through Local Governments. The scheme provides a relief to the registered unemployee by giving a
monitory dole of Rs.120/- The candidate must be registered in any of the employment exchanges in
the state and should have a seniority of 3 years of continuous registration after completing 18 years
of age. During the period sept 2011, there were 303691 such benefciaries under unemployment as-
sistance and an amount of Rs.2609.75 lakh was disbursed.
14.112 Details of unemployment assistance given for the period from 2007 to 2011 are given in
Table 14.27
Table 14.27
Benefciaries of Unemployment Assistance and Expenditure (2007-2011)
Year Benefciaries(Nos) Amount disbursed (Rs. in lakh)
2007 361930 5005.76
2008 337032 5094.78
2009 332280 2361.13
2010 283692 4096.65
2011 (Upto 30.09.2011) 303691 2609.75
Source: Directorate of Employment and Training
Kerala Social Security Mission
14.113 Kerala Social Secuty Mission established in 2008 is an autonomous organisation under the
Department of Social Welfare. The main objective of the mission is to organise and implement wel-
fare programmes on Social security for the aged, children, destitute, chronically ill and handicapped
persons. The major programmes implemented by the mission during 2010-11 are Cancer Suresksha,
Snehasparsham, Aswasakiranam, Thalolam and Sneha Swandhanam.
Nutrition And Child Welfare
14.114 According to the Census 2011 (Provisional) there are 33,22,247 lakh children in Kerala who
are below the age of 6 years constituting 9.95% of the total population. As per NFHS- 3 survey,
about 29% of the children in Kerala are suffering from general nutritional defciency indicated by un-
derweight and 55.7% at the age groups of 6 to 35 months are anaemic. In Kerala, under nutrition and
overweight/ obesity are high in school going children. The major programmes implemented for the
improvement of the health and development of children and adolescents are given below.
Integrated Child Development Services
14.115 The ICDS is a major fagship programme addressing the needs of children under the age of 6.
The scheme provides a package of services through the Anganwadi Centres for the children below six
years and pregnant women and nursing mothers as indicated below
Supplementary nutrition
Immunization
Health check-up
Referral services
Pre-school education
Nutrition and health education
Economic Review 2011
434
14.116 This is a centrally sponsored scheme wherein the State Government is responsible for pro-
gramme implementation. The scheme is implemented all over Kerala through 258 projects. There is
one Anganwadi Centre for every 1000 population in rural and urban projects and one for every 700
population in tribal area. There are 33115 sanctioned Anganwadi centres in the state. During 2011,
the number of benefciaries was 12,56,958 (including children, pregnant women and lactating moth-
ers). Details of district-wise ICDS benefciaries are given in Appendix-14.23 and Project wise details
of ICDS are given in Appendix 14.24
Integrated Child Development Services Training Programme
14.117 ICDS training is a national initiative for quality improvement of ICDS functionaries to achieve
improvement in the quality of early childhood care and development. The aim of the scheme is to de-
velop all the functionaries of ICDS into agents of social changes. It is carried out in all the 258 ICDS
projects. The components of the scheme are job training, orientation training, IEC materials and other
training.
Supplementary Nutrition Programme.
14.118 The objective of the scheme is to provide nutrition to the children below three years, pre-school
children, pregnant women, nursing mothers and adolescent girls. Under the schematic pattern of
ICDS, states are responsible for providing supplementary nutrition as per nutritional norms.
14.119 In Kerala, as part of decentralized planning, the programme had been transferred to the local
self-government institutions. The LSGIs are free to identify the food stuffs suited to the local conditions
having the prescribed nutritional value as per ICDS norms. Under the rural ICDS projects the expen-
diture on SNP is met by the Grama Panchayats and the Block Panchayats in the ratio of 2:1. During
2010-11 the amount earmarked as central share was Rs.6000 lakh and the fnancial achievement was
100%
Rajeev Gandhi Scheme for Empowerment of Adolescent Girls
(SABALA)
14.120 The scheme is being implemented using the platform of ICDS to address the multi dimensional
problems of adolescent girls. The total outlay earmarked for this scheme during 2010-11 was Rs.5000
lakh and the expenditure incurred was Rs. 512 lakh (48%). The scheme benefted 300016 adolescent
girls during 2010-11.
Conditional Maternity Beneft Scheme
14.121 The scheme is implementing with the objective of improving the health and nutritional status
of pregnant, lactating women and infants. The number of benefciaries during 2010-11 was 8318.
The amount earmarked during 2010-11 was Rs.5000.00 lakh as central share. The expenditure was
357.39 lakh with 7.15%
Integrated Child protection Scheme
14.122 Govt. of India introduced this scheme by incorporating all the activities under J uvenile jus-
tice and adoption. The scheme envisages protection of children and prevention of atrocities. Out of
Rs.2047 lakh as central share, Rs.320 lakh (15.63%) was expended during 2010-11.
Kerala State Planning Board
435
Welfare of Scheduled Castes, Scheduled Tribes and other
Backward Classes
14.123 Scheduled Castes in Kerala are comparatively better off than their counterparts in other, states
socially and [Link] Tribes have became impoverished over the years primarily due
to loss of their land resources to outsiders and due to the incapacity to beneft from development pro-
grammes meant for them . The Special Component Plan and the Tribal Sub Plan are intended to pro-
vide special protective measures to safeguard the interest of scheduled castes and scheduled tribes.
Table 14.28 presents a comparison of the national and State level status.
Table 14.28
Status of SC/ST (as per census 2001)
Sl. No Item SC ST
Kerala India Kerala India
1 Population (in lakh) 31.24 1666 3.64 836
2 Percentage to total Population 9.81 16.23 1.14 8.15
3 Decadal Growth Rate (%) 8.14 20.55 13.75 23.30
4 Child population to the total population 11.65 17.42 13.7 18.43
5 Sex Ratio 1048 936 1027 978
6 Literacy rate - General 82.66 54.32 64.35 47.08
7 Literacy Rate-Female 77.56 41.31 58.11 34.75
8 Poverty(as per 55th Round) 14.6 36.2 24.2 45.8
9 Percentage of Population in Slum Areas 7.50 17.40 0.20 2.40
Source: Census 2001
14.124 In Kerala there are 53 communities belonging to Scheduled Caste as per the Amendment Act
of 2006 to the Constitution of India. The settlement pattern in Kerala is entirely different from that of
other states and a major portion of the Schedule Caste population lives in scattered households with
other people and only a small portion live in concentrated colonies, in which very limited number are
isolated. The highest distribution of Scheduled Castes is in Palakkad District (13.85 %) followed by
Thiruvananthapuram (11.87 %), Thrissur (11.34 %) and Kollam (10.34%). Nearly half of SC popula-
tion of the State is distributed in the above four districts. The Scheduled Tribes in Kerala are not only
geographically concentrated, but are overwhelmingly rural. Highest concentration of Scheduled Tribes
is seen in Wayanad district (37.36 %) followed by Idukki (14 %) and Palakkad (10.89 %) and these
three districts together account for over 60 per cent of STs in the State. The costal district of Alappuzha
has the lowest percentage (0.15%). Details are given in Table 14.29. District wise Scheduled Caste/
Scheduled Tribe population details are given in Appendix. 14.25
Table 14.29
District-wise distribution of SC/ST Population in Kerala
Sl. Item Percentage Distributon Percentage to Total Popula-
ton
SC ST SC ST
1 2 3 4 5 6
1 Kasargod 2.88 8.33 7.49 2.52
2 Kannur 3.17 5.48 4.11 0.83
3 Wayanad 1.07 37.36 4.27 17.43
Economic Review 2011
436
4 Kozhikkode 6.43 1.63 6.98 0.21
5 Malappuram 9.14 3.36 7.87 0.34
6 Palakkad 13.85 10.89 16.53 1.52
7 Thrissur 11.34 1.33 11.91 0.16
8 Ernakulam 8.44 2.76 8.48 0.32
9
Idukki 5.1 14 14.11 4.51
10
Kottayam 4.81 5.04 7.69 0.94
11
Alappuzha 6.37 0.86 9.45 0.15
12
Pathanamthitta 5.19 1.8 13.13 0.53
13
Kollam 10.34 1.43 12.49 0.20
14
Thiruvananthapuram 11.87 5.74 11.47 0.65
Total 100 100 9.81 1.14
Source: Census 2001
Education and Enrolment
14.125 Education, being the key instrument not only for social empowerment but also provides the
essential base for all development pursuits, steps are being taken to ensure provision of quality educa-
tion to SC/ST so as to equip and enable them to enhance their employment prospects with competi-
tive ability and thus address the problems of their marginalization and deprivation in the employment
market.
14.126 The proportion of Scheduled Castes and Scheduled Tribe students in lower primary, upper
primary and high schools during 2011-12 is relatively higher than their population percentage as seen
in Table 14.30. The drop out ratio among STs is relatively higher than SCs as seen in Table 14.31. If we
examine the strength of students in government, private and aided schools, about 59.63% of total SC
students are studying in private aided schools and 37.39% in government schools whereas 43.94% of
ST students choose private aided schools and 54.31% government schools. The strength of SC/ST
students at school level are given in Appendix 14.26
Table 14.30
Enrolment of Scheduled Caste/Scheduled Tribe Students at School level as on 01.04.2011
Secton Total SC % to Total ST % to Total
1 2 3 4 5 6
L.P 1591154 177782 11.17 33775 2.12
U.P 1424068 159310 11.19 25926 1.82
H.S 1442534 151122 10.47 17811 1.23
Total 4457756 488214 10.95 77512 1.74
Source: Directorate of Public Instructions
Table 14.31
Drop out among SC and ST Students
Secton SC Drop out % ST Drop out %
LP 177782 531 0.30 33775 540 1.60
UP 159310 575 0.36 25926 572 2.21
HS 151122 1722 1.14 17811 721 4.05
Kerala State Planning Board
437
Secton SC Drop out % ST Drop out %
Total 488214 2828 0.58 77512 2626 3.39
Source: Directorate of Public Instructions
14.127 Details of SC/ST Students in the Arts and Science Colleges during 2010-11 given in Appendix
14.29 it is seen that number of girls students is about thrice the number of boys in cases of SC and
it is 1.5 times in the case of ST where as the total representation of girl students is about more than
twice that of boys.
Performance in SSLC and Higher Secondary Examination
14.128 The percentage of pass in the SSLC examination is a good indicator of social and educa-
tional development among different social groups. In the regular SSLC examination of 2010, out of the
[Link] belonging to Scheduled Castes who appeared 34450 have passed. The correspond-
ing fgures for Scheduled Tribes are 5363 and 4204 respectively. The percentage of passed students
from SC is 80.51 and that of ST is 78.39 which are below the overall state percentage of 90.76
14.129 A comparative statement showing the performance of students in SSLC examination from
2001 onwards is given in Table 14.32, which reveals that ST students are far behind others though
there is improvement in their performance.
Table 14.32
Performance of Students in SSLC Examination (Percentage of Pass)
Year Total Students ScheduledCaste Students Scheduled Tribe Students
1 2 3 4
2001 56.22 36.74 32.85
2002 60.62 39.32 39.69
2003 64.85 43.75 37.72
2004 70.06 48.14 45.95
2005 58.61 37.09 32.55
2006 69.33 48.58 41.18
2007 82.23 65.17 60.67
2008 92.08 83.37 82.46
2009 91.89 83.74 79.21
2010 90.76 80.51 78.39
2011 91.36 82.25 80.94
Source : Commissioner for Govt. Examinations
Performance of students in SSLC
Examination
0
10
20
30
40
50
60
70
80
90
2
0
0
1
2
0
0
2
2
0
0
3
2
0
0
4
2
0
0
5
2
0
0
6
2
0
0
7
2
0
0
8
2
0
0
9
2
0
1
0
2
0
1
1
P
e
r
c
e
n
t
a
g
e
o
f
P
a
s
s
ScheduledCaste
Students
ScheduledTribe
Students
Figure 14.4
Economic Review 2011
438
14.130 Table 14.33 shows the performance of students in Higher Secondary Examination 2009-10.
Table 14.33
Performance of Students in Higher Secondary Examination (2010-11)
Category Number of Students
Appeared
Number of
Students Passed
Percentage
S
c
h
e
d
u
l
e
d
C
a
s
t
e
s
Boys 12055 6581 54.59
Girls 15219 9910 65.12
Total 27274 16491 60.46
S
c
h
e
d
-
u
l
e
d
T
r
i
b
e
s
Boys 1622 742 45.74
Girls 1947 1125 57.78
Total 3569 1867 52.31
O
t
h
e
r
s
(
e
x
c
l
u
d
i
n
g
S
C
/
S
T
)
Boys 112864 89621 79.40
Girls 132408 119133 89.97
Total 245272 208754 85.11
GrandTotal 276115 227112 82.25
Source: Directorate of Higher Secondary Education
14.131 From the above table, it is clear that the percentage of passed students for SC is 60.46% and
that of ST is 52.31% only as against the overall percentage of 82.25%. Also it is interesting to note that
in all the categories, the pass rate of girls is higher than that of the boys.
Occupational Pattern
14.132 Table 14.34 below shows that while just 25.87 per cent of total population fell into the category
of workers as per 2001 Census, the corresponding fgures for SC and ST population were 29.75 and
30.17 respectively. The ratio of female workers belonging to SCs and STs was almost double than that
of other population. It is signifcant to note that the decline of workers among total population was
marginal during the decade 2001 compared to 1991, it is substantial in case of SCs and the same
is alarming for STs during the period. The decline in the proportion of main workers, both male and
female, is not a welcome change as it is indicative of growing unemployment, underemployment and
deprivation among the population.
Table 14.34
Distribution of Main Workers 1991-2001 (per cent) (Percentage of Pass)
Sl.
No
Category Total Scheduled Total Students
ScheduledCaste
Students
1991 2001 1991 2001 1991 2001
1 Main Workers 28.53 25.87 36.82 29.75 40.28 30.17
2 Male Main Workers 44.82 41.77 47.22 41.54 51.11 40.66
3 Female Main Workers 12.81 10.85 26.72 18.51 29.42 19.90
Kerala State Planning Board
439
Sl.
No
Category Total Scheduled Total Students
ScheduledCaste
Students
1991 2001 1991 2001 1991 2001
4 Percentage of Cultivators to Main
Workers
12.24 7.12 3.10 1.61 16.66 13.67
5 Percentage of Agricultural Labour-
ers to Main Workers
25.54 12.40 53.79 29.48 55.47 41.12
6 Percentage of Main Workers en-
gaged in Household Industry
2.58 3.35 2.44 2.60 0.47 2.57
7 Percentage of Main Workers en-
gaged in Other Services
15.17 77.13 10.70 66.31 5.28 42.65
8 Marginal Workers 2.90 6.43 4.38 10.63 5.76 16.18
9 Work Participation Rate 31.43 32.30 41.21 40.38 46.04 46.35
Source: Scheduled Tribe Atlas of India 2001
14.133 An analysis of the above table indicates excessive dependence of STs on agriculture (54.79
%) for their livelihood as against just 19.52%for the total population and for SCs the corresponding
fgure is 31.09 %. Other services is the source of income for 77.13 % of the total population, while the
sector offers livelihood for two third of the SC population. The above analysis of the occupational pat-
tern shows that the SC population is closely following the other population with regard to the change
in occupational structure that has been taking place in the Kerala economy while the ST population is
far behind in this respect.
14.134 In Kerala, as per Rule 14(a) of the Kerala State and Subordinate Service Rules 1958, 8% res-
ervation in public service is provided to SCs and 2% to STs. It shows that SC/ST had already achieved
more than 10% reservation in all the three categories. But ST candidates alone had not achieved 2%
reservation in State service. Details of representation of SC/ST employees in Government service is
given in Appendix 14.28.
Poverty among SC/STs
14.135 Kerala has registered a remarkable improvement in poverty reduction over the years among
all the social sections, including Scheduled Castes and Scheduled Tribes as per the NSSO. Poverty
level among the Scheduled Castes reduced to 14.6% in 1999-2000 from 62.3% in 1983. The share
of BPL population among Scheduled Tribes declined to 24.2% in 1999 2000 from 37.3% in 1993-94.
Details are given in 14.35.
Table 14.35
(Rural in 38th, 50th and 55th NSSO Rounds) (Percentage of Pass)
Sl.
No
NSSO Rounds India Kerala
Total SC ST State
Total
SC ST
1 2 3 4 5 6 7 8
1 38th Round(1983) 45.6 58.1 63.8 39.1 62.3 NA
2 50th Round (1993-94) 37.1 48.1 52.2 25.5 36.3 37.3
3 55th Round (1999-2000) 27.1 36.2 45.8 9.4 14.6 24.2
Source: NSSO
14.136 The incidence of poverty among Scheduled Castes and Scheduled Tribes in Kerala is only half
Economic Review 2011
440
that of the all-India level. The decline in the incidence of poverty in the State may be broadly attributed
to the land reform measures, prevailing wage rate structure of workers and the large number of anti-
poverty programmes undertaken by both the Central and State Governments. Also the growth of the
economy which in turn raised the level of income contributed to poverty reduction.
Generalised Deprivation
14.137 To assess disparity among districts in terms of the incidence of poverty, a more desirable ap-
proach would be to examine the incidence in deprivation instead of household consumer expenditure.
The index of deprivation reported in Human Development Report 2005 (Kerala) is based on depriva-
tion in four basic necessities for well being such as housing quality, access to drinking water, good
sanitation and electricity for lighting. The Table 14.36 given below shows the district- wise index of
deprivation and rank of districts of Kerala in 2001.
Table 14.36
Generalised Deprivation
Sl.
No District SC Rank ST Rank All Rank
1 2 3 4 5 6 7 8
1 Thiruvananthapuram 54.4 13 60.1 10 39.5 11
2 Kollam 47.8 8 50.7 5 30.4 8
3 Pathanamthitta 50.3 10 54.6 7 31.1 9
4 Alappuzha 45.9 6 40.1 3 29.6 6
5 Kottayam 42.1 4 43.1 4 25.1 3
6 Idukki 40.8 2 65.3 13 42.7 13
7 Ernakulam 29.3 1 37.2 1 15.5 1
8 Thrissur 42.0 3 37.5 2 24.7 2
9 Palakkad 52.9 12 65.3 12 40.4 12
10 Malappuram 46.2 7 56.8 8 28.6 5
11 Kozhikkode 48.8 9 50.9 6 28.3 4
12 Wayanad 51.5 11 66.0 14 46.3 14
13 Kannur 43.8 5 57.7 9 29.7 7
14 Kasargod 62.7 14 61.3 11 37.6 10
Total 45.5 57.9 29.5
Source: Human Development Report 2005, Kerala
14.138 The incidence of deprivation among SCs and STs is 45.5 and 57.9 respectively while that for
total population is only 29.5. Kasargod, Thiruvananthapuram, Palakkad, and Wayanad districts have
deprivation indices of above 50 percent regarding SC population. In 10 districts, the deprivation indices
is above 50 in respect of ST population and the same is highest in the three ST population concen-
trated districts of Wayanad, Idukki and Palakkad.
14.139 Among the Scheduled Castes, Vedan, Nayadi, Kalladi and Chakkilian are the most economi-
cally, socially and educationally backward castes. Majority among these are landless and living in huts
built in Purambock and are in starving conditions. Special emphasis is needed for the development
of these communities including provision of land and homes.
Kerala State Planning Board
441
Development Programmes for Scheduled Caste and
Scheduled Tribes
14.140 Kerala Government earmarks funds for SCP and TSP from State Plan outlay in proportion to
the ratio of population of Scheduled Castes and Scheduled Tribes to total population of the State. Out
of the total SCP/TSP Plan outlay a certain percentage of funds is allocated to local self government
institutions for implementation of schemes under decentralized planning. A portion of funds was con-
sidered as notional fow to other departments till 2008-09. This was meant for implementing schemes
exclusively for SC/ST population in the respective sectors. As this experiment was not found suc-
cessful the concept of notional fow was dispensed with from the Annual Plan 2009-10. A system of
earmarking certain amount of SCP/TSP as pooled fund under SCP and TSP for taking up schemes
adopting a project approach was introduced. This gave scope to get wide range of schemes with var-
ied objectives and physical targets which put together helped the all round development of the targeted
groups. The total plan provision set apart for the development of Scheduled Caste and Scheduled
Tribes during 2011-12 was `.1178.18 crore and `. 284.19 crore, respectively.
Year-wise details from 2002-03 onwards are given in Table 14.37
Table 14.37
SCP/TSP-Year wise Outlay (` Crore)
Year SCP TSP
2002-03 398.26 90.75
2003-04 390.76 87.62
2004-05 419.37 94.88
2005-06 501.72 106.35
2006-07 605.00 121.00
2007-08 681.80 139.00
2008-09 755.95 154.10
2009-10 874.73 180.85
2010-11 983.45 200.50
2011-12 1178.18 284.19
Figure 14.5
Economic Review 2011
442
14.141 A two pronged strategy is followed for development of Scheduled Castes and Scheduled Tribes
in the State. Infrastructure facilities like roads, electricity and water supply are provided in habitats
having more than 50 per cent SC/ST families. For implementing minor irrigation work, more than 50
per cent of the area should be owned by Scheduled Castes, Scheduled Tribes. For projects to beneft
individuals and families, 100 per cent of the benefciaries should belong to SCs, STs.
Special Component Plan and Tribal Sub Plan through Local
Governments
14.142 Local government-wise budget provision and expenditure pertaining to Scheduled Castes and
Scheduled Tribes during the year 2010-11 are given in Table 14.38.
Table 14.38
Grant-in-aid to LSGIs-Category wise Outlay and Expenditure during 2010-1 (` in lakh)
Type of
LSGIs
General SCP
Budgeted
Outlay *
Fund
available
Expendi-
ture
%
w.r.t
col. 5
Budget-
ed Outlay
*
Fund
available
Expendi-
ture
%
w.r.t
col.
11
1 2 3 4 5 6 7 8 9
Grama
Pts
77194.31 94476.95 75384.41 79.79 31310.34 47370.79 25339.54 53.49
Block Pts 25478.08 27518.43 18329.52 66.61 10435.72 12699.53 8904.50 70.12
District
Pts
30551.85 35733.61 19023.28 53.24 10435.72 15052.87 8192.19 54.42
Munici-
pality
14796.90 17392.49 12932.43 74.36 3656.17 5471.90 3143.70 57.45
Corpora-
tion
11773.09 14782.89 9803.53 66.32 3111.46 5719.76 2823.27 49.36
Total 159794.23 189904.37 135473.17 71.34 58949.41 86314.85 48403.20 56.08
Type of
LSGIs
TSP Total
Bud-
geted
Outlay *
Fund
available
Expen-
di-
ture
%
w.r.t
col.
17
Budgeted
Outlay *
Fund
available
Expendi-
ture
%
w.r.t
col.
23
1 10 11 12 13 14 15 16 17
Grama Pts 4375.56 6171.08 3961.23 64.19 112880.21 148018.83 104685.18 70.72
Block Pts 1748.57 2133.56 1548.21 72.56 37662.37 42351.53 28782.24 67.96
District Pts 2624.42 3561.75 2199.71 61.76 43611.99 54348.23 29415.18 54.12
Municipal-
ity
98.02 164.95 118.78 72.01 18551.09 23029.34 16194.90 70.32
Corpora-
tion
0 0 0 0 14884.55 20502.65 12626.80 61.59
Total 8846.57 12031.34 7827.93 65.06 227590.21 288250.58 191704.30 66.51
Sourse: IKM
Kerala State Planning Board
443
14.143 During the year 2011-12 a total of ` 648.44 crore was given to Local Governments as plan
grant under Special Component Plan and ` 97.31 crore as Tribal Sub Plan. Budget provision of SCP/
TSP through LSGIs during 2011-12 is given in Table 14.39.
Table 14.39
Budget provision of SCP/TSP through Local Self Government Institutions 2011-12
(` in Thousand)
Sl.
No
Local Self
Government
Institutions
Budget Provision
Total
General Special
Component
Plan
Tribal
Sub Plan
1 2 3 4 5 6
1 Grama Panchayat 79773077 3131034 437556 11541667
2 Block Panchayat 1706879 1043572 174857 2925308
3 District Panchayat 1706879 1043572 262442 3012893
4 Municipality 1301540 365617 9802 1676959
5 Corporation 1032027 311146 0.00 1343173
Total 13720402 5894941 884657 20500000
14.144 Percentage distribution of budget provision of SCP/TSP through Local Self Government Insti-
tutions during 2011-12 is represented in Figures14.6 and 14.7.
Figure 14.6
Economic Review 2011
444
Figure 14.7
Programmes of Scheduled Caste Development Department
14.145 State Schemes and Centrally Sponsored Schemes as well as the projects taken up under
corpus fund and pooled fund are the programmes implemented by the Scheduled Caste Development
Department for the welfare of Scheduled Castes. During 2011-12 the total State Plan provision set
apart for the development of Scheduled Castes was ` 1178.18 crore. This was 9.81% of the total State
Plan outlay. Of this, ` 529.74 crore was earmarked as State share for development programmes of the
SC Development Department including ` 40.16 crore for RD Schemes. An amount of ` 648.44 crore
was provided as development fund to local bodies.
14.146 The State and Central Government programmes covered a wide area comprising education,
economic and social welfare activities for the multifaceted development of Scheduled Castes which
produced favourable results in these areas.
14.147 Scheme wise outlay and expenditure of welfare of Scheduled Castes for 2010-11 & 2011-12
and the physical targets and achievement are given in Appendices 14.29 and 14.30 respectively
Educational Schemes
14.148 The Scheduled Caste Development Department is implementing various educational schemes
such as pre-matric studies, post-matric studies, running/construction of Model Residential Schools,
assistance to students studying in self fnancing colleges etc. During 2010-11, pre-matric educational
concessions to 4.51 lakh students and post-matric concessions were given to more than 1.28 lakh stu-
dents. An amount of `.65.48 crore had been spent towards stipend and lump sum grant and an amount
of `.63.14 crore had been spent for providing fee concessions. The details of educational assistance
given to SC students are shown in Appendix 14.31.
e-Grantz
14.149 One of the major achievements in education sector is the introduction of e-Grantz for the online
distribution of educational concessions to the students belonging to the weaker sections of the soci-
ety. As a pilot project, the web based scholarship distribution system was introduced among 3000 SC
students in 52 post-matric institutions in Alappuzha district during 2008-09 in association with State
Bank of India. This project was extended across the whole of Kerala during 2010 benefting students in
3450 educational institutions in the State. The project helps the students for getting assistance through
ATMs. During the year 2011-12, SBI eZ-pay card had been introduced for disbursement of students
entitlements, which would enable speedy disbursement eliminating delay in opening individual bank
account for students.
Kerala State Planning Board
445
Institutions run under SC Development Department
14.150 The Scheduled Caste Development Department is running 9 model residential schools, of
which three schools are functioning in rented buildings and rest of them are in owned buildings. The
model residential schools provide education with residential facilities from standard V to +2 levels.
Accommodation including mess, uniform, text books and study materials are provided to the students
under this scheme. Number of students benefted was 1284 during 2010-11.During2010-11,170 out of
171 students have passed SSLC examination. Details are given in Appendix-14.32. For giving aware-
ness in science subject, Sasthraposhini Lab was established in six Model Residential Schools
14.151 In addition there is a sports school, called Ayyankali Memorial Sports School for promoting
sports talents of SC students. Students are admitted from Class V with accommodation and other
facilities provided up to Class XII. The sanctioned strength of the school is 250, of which 180 are in the
school level and 70 in the higher secondary level. Presently, the total number of students in the sports
school is 186. Out of which, 129 are Scheduled Caste students and 57 are Scheduled Tribe students.
The daily mess allowance in sports school was enhanced to `.75/- from Rs. 40/-.
14.152 Apart from this, the Scheduled Caste Development Department is running 91 pre- matric
hostels ( 50 for boys and 41 for girls) which are transferred institutions of block panchayaths. Out of
91 pre-matric hostels, 14 are in rented buildings and 16 post -matric hostels are functioning under the
Department ( 9 for boys and 7 for girls). The mess charge in pre-matric hostels was enhanced from
` 700/- to ` 1300/-and in post-matric hostel raised from ` 900/-to `. 1500/- .
14.153 The Scheduled Caste Development Department runs Pre-Examination Training Centres at
Thiruvananthapuram, Ernakulam, Palakkad, Kozhikode to provide special coaching to SC/ST candi-
dates for selection to various jobs in Government, banks and other public sector undertakings. The
Department also runs an institute of Civil Service Examination Training Society (ICSETS) for providing
coaching facilities for SC/ST candidates who competed in Civil Service Examinations conducted by
the Union Public Service Commission. The selection is made through an entrance test and interview.
The Department also sponsored and funded an autonomous institution called CREST( Centre for Re-
search and Education for Social Transformation) at Kozhikode. This is an institution originally set up
under the IIM, Kozhikode to prepare SC/ST students for higher posts and admission to institutions of
higher learning. The Department runs 44 ITIs, which give training to the trainees in 12 different trades.
Of which , seven are matric trades and fve are non matric trades. Every year 1263 trainees are admit-
ted in these ITIs. The study tour allowance of ITIs enhanced from ` 500/- to ` 1100/-. New ITIs have
been started at Tooneri in Kozhikode, Bela in Kasargode and Varavoor in Thrissur during 2010-11.
Housing Scheme
14.154 The department is giving housing assistance @ `100000 for constructing a house from 18-9-
2009. During 2009-10, `.5027.42 lakh was expended for housing under plan scheme .Out of the 12753
houses sanctioned during 2009-10, 6285 were completed. During 2010-11, ` 12000 lakh is earmarked
for implementing housing project under plan scheme. Out of this, ` 1000 lakh is provided as one time
ACA. During 2010-11, ` 10668.04 lakh was expended for housing under plan scheme .Out of the
7021 houses sanctioned during 2010-11, 2160 have been completed. District wise details of houses
sanctioned and constructed during the period from 2007-08 to 2010-11 and houses sanctioned during
2011-12 are given in Appendix 14.33. Housing grant has been enhanced to ` 2 lakh per house during
the year 2011-12.
e-Housing
14.155 Government of Kerala given utmost importance to provision of housing in a time bound manner
to underprivileged sections, viz. Scheduled Castes/Scheduled Tribes. The Department of Scheduled
Caste Development has launched e-Housing, an online system of granting fnancial aid for house con-
struction to the Schedule Castes. The e-Housing website was launched on February 27, 2011. After
the successful implementation of e-Grantz, this is another step forward in e-governance for the Kerala
Economic Review 2011
446
Scheduled Caste Development Department. E-Housing will make the whole process of sanctioning
and distribution of monetary assistance under the Bhavana Nirmana Dhanasahayam Scheme time-
bound, effcient, transparent and easy as 90% of the work will be done online by the software.
Land to landless
14.156 The policy of the Government is that all the Scheduled Castes will be provided with land for
construction of house. The scheme intends to purchase land to the poor and eligible landless Sched-
uled Castes for construction of house. An amount of ` 9000 lakh was provided during 2010-11 and the
expenditure incurred was ` 8510.18 lakh. The number of persons benefted was 11154. An amount of
` 8000 lakh is provided during 2011-12 and expenditure as on 30-09-2011 is ` 76.40 lakh, benefting
514 persons. District-wise details as on 30-09-2011 are given in Appendix 14.34.
14.157 In addition to the scheme Land to Landless, land has been provided to the vulnerable group
among Scheduled Castes through the schemes Development Programmes for Vulnerable Groups
among Scheduled Castes and Rehabilitation of Vulnerable Primitive Scheduled Castes (One Time
ACA) during 2010-11. District-wise details are given below.
Table 14. 40
Land provided to the Vulnerable Group among Scheduled castes during 2010-11 (` Lakh)
Sl.
No.
District
Development Programme for
Vulnerable Groups among SC
Rehabilitation of Vulnerable Primi-
tive SCs
Amount
Provided
Expen-
diture as
on March
2011
Per-
sons
Ben-
efted
Amount
Provided
Expen-
diture
as on
March
2011
Persons
Benefted
1 Thiruvanantha-
puram
27.00 17.50 14 48.55 45.00 36
2 Kollam 36.00 20.00 16 18.14 --- ---
3 Pathanamthitta 24.74 15.00 12 --- --- ---
4 Alappuzha --- --- --- --- --- ---
5 Kottayam 52.50 6.25 5 33.90 23.75 19
6 Idukki --- --- --- 26.20 25.00 20
7 Ernakulam --- --- --- 11.65 2.50 2
8 Thrissur 12.45 --- --- 7.98 --- ---
9 Palakkad 22.81 15.00 12 160.30 157.50 126
10 Malapuram 23.25 15.00 12 2.40 --- ---
11 Kozhikkode 29.25 20.00 16 23.75 23.75 19
12 Wayanad 9.00 6.25 5 --- --- ---
13 Kannur 13.00 7.50 6 5.20 2.50 2
14 Kasaragode --- --- --- 25.80 12.50 10
Total 250.00 122.50 98 363.87 292.50 234
Health scheme- fnancial assistance to seriously ill
14.158 As per the recommendations of doctors, illness assistance is granted up to ` 25,000/- to the
Scheduled Castes, who are below poverty line and suffer from serious diseases like Cancer, Heart/
kidney/brain ailments. The assistance up to ` 10000/- will be sanctioned by the Director, Scheduled
Kerala State Planning Board
447
Caste Development Department and from ` 10001/- to ` 25000/- will be sanctioned by the Govern-
ment. During 2009-10, fnancial assistance was given to 8082 persons and the total expenditure under
this scheme was ` 550 lakh. An amount of ` 550 lakh is provided during 2010-11 and the number of
persons benefted during the year is 8367.
Development programmes for the vulnerable communities among
Scheduled Castes
14.159 The objective of this scheme is rehabilitation of landless and homeless SCs belonging to vul-
nerable communities viz. Vedan, Vettuvan and Nayadi. This scheme has the following provisions.
Assistance of ` 100000/- for house construction and ` 150000/-for purchase of 5 cents of land in
Grama Panchayat area (` 1.75 lakh in municipalities and ` 2 lakh in corporation area). If fewer
amounts are incurred for the purchase of land, the remaining amount can be utilized for the
construction of houses.
The amount provided is also meant for meeting the expenses in connection with the provision of
education, treatment, drinking water, electricity etc, to the vulnerable groups.
14.160 During 2010-11, fnancial assistance was given to 98 persons and the total expenditure under
this scheme was `122.50 lakh. During 2011-12, ` 1044 lakh is provided in the budget and the expendi-
ture incurred as on 31-10-11 is ` 38.68 lakh. Apart from this scheme, another scheme is implementing
under one time ACA for the rehabilitation of the most economically, socially and educationally back-
ward communities [Link], Nayadi, Kalladi and Chakkilian. Majority among them are landless and
living in huts in Purambok area and in starving conditions. An amount of ` 932 lakh was received as
One Time ACA from Government of India during 2008-09 and ` 300 lakh is released from State Gov-
ernment. The expenditure incurred was ` 73.24 lakh benefting 84 persons. An amount of ` 922 lakh
was set apart for the second phase of the project as One Time ACA during 2009-10 .The expenditure
incurred was ` 916.95lakh benefting 261 persons. An amount of ` 364 lakh is received as One Time
ACA during 2010-11 and the expenditure incurred as on March 2011 is` 292.50 lakh benefting 234
persons.
Self employment scheme
14.161 Assistance is given under self employment projects for promoting new ventures among Sched-
uled Castes in the ratio of 1:2 as subsidy and loan for taking up productive, service, market oriented
projects subject to the condition of Government stipulation.. The amount provided for the year 2011-12
is ` 807 lakh and the expenditure as on 30.09.2011 is ` 96.47 lakh, benefting 153 persons. Details
of district -wise assistance given under self employment scheme from 2008-09 are given in Appendix
14.35.
Assistance to marriage of SC girls
14.162 In order to reduce the burden of marriage expenses of daughters of SC parents, assistance is
given under this scheme. Priority will be given to the daughters of widows, unwed mothers and inca-
pable parents. Assistance is given @ ` 20000. An amount of ` 500 lakh is provided for the scheme
during 2009-10 and the expenditure incurred was ` 469.22 lakh and 4022 persons benefted through
this scheme. An amount of ` 500 lakh is provided during 2010-11 and 5455 persons have benefted
during the year. During 2011-12, 2637 persons have been benefted till 30.09.2011 under the scheme.
Protection of Civil Rights and Enforcement of POA Act
14.163 The activities proposed under this scheme are:
l Conducting awareness camps at Grama Panchayat level highlighting the need for protection of
civil rights of Scheduled Castes and enforcement of POA Act.
l Producing documentaries highlighting the evils of untouchability against Scheduled Castes.
Economic Review 2011
448
l Providing assistance to inter-caste married couples for starting economic and income
generation activities. During 2009-10 inter-caste marriage assistance enhanced to ` 50000/-
from ` 10000/-. The expenditure incurred is ` 11.18 crore beneftting 3052 persons.
l Celebrating Temple Entry Proclamation day
l Enforcement of Prevention of Atrocities Act, 1989.
l Conducting exhibition and procession in connection with Social Solidarity Fortnight
14.164 The number of cases of harassment/atrocities towards Scheduled Castes in the State for which
compensation has been granted during the last four years are given below:
Table 14.41
Year No. of Cases Compensation
Granted (` in Lakh)
2007-08 405 17.93
2008-09 416 12.02
2009-10 471 33.93
2010-11 570 85.08
l The main causes and nature of these harassment/atrocities are social harassment, sexual
exploitation, insult, intimidation and humiliation, outraging the modesty of woman causing injury
and insult or annoyance, giving false evidence, etc.
l Three Special Mobile Squads are functioning at Palakkad, Wayanad and Kasaragod to deal with
atrocities towards Scheduled Castes more effectively.
l Two Special Courts in Kalpatta and Manjery
l Atrocity Prone areas are Wayanad, Kasaragod and Attappady in Palakkad.
14.165 According to the National Crime Records Bureau, the year 2010 has witnessed an increase
of 24.83% in the incidence of crime committed against Scheduled Castes in Kerala .As 467 cases re-
ported in 2009 have increased to 583 cases in 2010. The rate of crime against Scheduled Castes has
increased to 1.7 in 2010 as compared to 1.3 in 2009. Details are given in the following table.
Table 14. 42
Incidence of Crimes Committed against SCs during 2009 & 2010
Particulars Kerala All-India
2009 2010 2009 2010
Incidence 467 583 33594 32712
Percentage contribution to All-India level 1.4 1.8 100 100
Rate of total cognizable crimes 1.3 1.7 2.9 2.8
Rank as per rate of total cognizable crimes 14 12
Rank as per percentage share to All-India level 12 11
Source: Crime in India, 2009 & 2010
Kerala State Planning Board
449
Box 4
New Initiatives in SC Department during 2011
Vijnjanvadi
The scheme aims at providing library, reading room, computer with internet facility, dailies and pe-
riodicals and necessary furniture to each and every Scheduled Caste colonies in the State. Initially
Vijnjanvadis will be started in colonies having infrastructure facilities such as community hall. In
other colonies, infrastructure facilities will be provided under the scheme
Bicycles to SC students studying in 8th Standard in Government or Aided Schools
In order to check the drop outs of Scheduled Caste students from schools and to encourage and
motivate the students in education, bicycles will be provided to the students of VIII standard in Gov-
ernment and Aided Schools.
Modernization of Pre-matric Hostels
There are 90 pre-matric hostels functioning under the Department. These hostels will be provided
with facilities such as computer, library and reading room, furniture etc.
Vision 2013
Under this programme, all the Scheduled Caste students who have secured A+, A, B+and B
grades in 10th standard will be given special coaching for appearing the medical and engineering
entrance examination on 2013 through reputed coaching centres.
Critical Gap Filling (Corpus Fund)
14.166 This Scheme intended to provide funds for flling critical gap in the SCP provision made under
various schemes on project basis with emphasis on human resource development, basic needs, eco-
nomic development etc. Two thirds of the outlay will be allocated to District on population proportion
basis. Schemes /projects up to `` 25 lakh will be cleared by the District Level Committee for SC/ST.
Project above ` 25 lakh will be cleared by SLWG/ Special working Groups. Outlay and expenditure
under the scheme during 11th plan period is given Table 14.43 and Table14. 44 below
Table 14. 43
Corpus Fund Allocation under 11th plan (` Crore)
Year Total SCP allocation to
Department
Of which Corpus
Fund
%
2007-08 143.09 67.91 47.46
2008-09 179.32 74.29 41.43
2009-10 338.74 42.54 12.56
2010-11 393.96 19.04 4.83
2011-12 529.74 136.14 25.70
Source: Directorate of SC Development.
Economic Review 2011
450
Corpus Fund Allocation under 11th plan
Figure 14.8
Table 14. 44
Outlay and Expenditure under Critical Gap Filling (` Crore)
Year SCP %of Expenditure
Outlay Expenditure
2007-08 67.91 67.59 99.53
2008-09 74.29 79.25 106.73
2009-10 42.54 78.29 184.04
2010-11 19.04 12.12 63.66
2011-12 136.14 - -
Source: Directorate of SC Development
Pooled Fund
14.167 A portion of funds was considered as Notional Flow to other departments till 2008-09. This was
meant for implementing schemes exclusively for SC/ST population in the respective sectors. As this
experiment was not found successful the concept of Notional Flow was dispensed with from 2009-10.
A system of earmarking certain amount of SCP/TSP as pooled fund under SCP and TSP for taking up
schemes adopting a project approach was introduced. This gives scope to get wide range of schemes
with varied objectives and physical targets which put together will help the all round development of
the targeted groups.
14.168 Various development Departments and agencies should submit projects to State Planning
Board for consideration. After vetting by Planning Board, it will be forwarded to Scheduled Caste/
Scheduled Tribe Development Department .The processing, sanctioning, implementation and monitor-
ing etc will be done as per the G.O (P) No. 44/2009/Scheduled Castes dated [Link] and
Expenditure under the scheme are given Table 14.45 and Table 14.46 below.
Kerala State Planning Board
451
Table 14.45
Percentage of Pooled Fund Allocation (` Crore)
Year Total SCP allocation to
SC Development Depart-
ment
Of which Pooled Fund %
2007-08 - - -
2008-09 - - -
2009-10 338.74 80.00 23.62
2010-11 393.96 50.00 12.69
2011-12 529.74 60.00 11.33
Source: Directorate of SC Development.
Table14. 46
Outlay and Expenditure under Pooled Fund (` Crore)
Year SCP
Outlay Expenditure % of Expenditure
2009-10 80.00 79.99 99.99
2010-11 50.00 38.21 63.68
2011-12 60.00 - -
Source: Directorate of SC Development.
Special Central Assistance to Special Component Plan (SCA to SCP)
14.169 The Special Central Assistance to Special Component Plan for Scheduled Caste is provid-
ed by Government of India to States for undertaking mainly economic development programmes for
Scheduled Castes. It is not on a schematic pattern. It will be an additionally with a multiplier effect. It
will also go a long way in helping to make the various programmes and schemes for the development
of Scheduled Castes more meaningful, comprehensive and need based and it will help to fll the gaps
which the fows from the Central, State and Local body plans are not in a position to fll
14.170 Out of the total funds received under SCA to SCP, 75 percent will be distributed to the District
Collectors on the basis of Scheduled Caste population in the districts. The balance 25 percent will be
kept with the Director; Scheduled Caste Development. Activities that can be taken up under SCA are
to assist Scheduled Caste families for taking up viable income generating activities, through a mix of
institutional fnance and subsidy. The families may be provided assistance under SCA in a manner
similar to those admissible under SGSY. The outlay and Expenditure detail of SCA to SCP under 11th
plan period is given in Table14. 47.
Table 14.47
Statement showing the Outlay and Expenditure under SCA to SCP during 11th Plan (` in lakh)
Year Outlay Expenditure Percentage
2007-08 240.00 20.35 8.48
2008-09 636.47 577.06 90.67
2009-10 1100.00 1007.40 91.58
2010-11 1000.00 672.25 67.23
2011-12 700.00 - -
Total 3676.47 2277.06 61.94
Source: Directorate of SC Development.
Economic Review 2011
452
Programmes of Scheduled Tribe Development Department
14.171 An amount of ` 112.03 crore earmarked during 2010-11 for the development programmes of
the ST Development Department and the expenditure is 102.78 crore. The total state plan provision
set apart for the development of Scheduled Tribes during 2011-12 is ` 284.19 crore. Out of this `
186.88 crore is earmarked as state share for the development programmes of the ST Development
Department including ` 7.71 crore for RD Schemes. An amount of ` 97.31 crore is provided as grant
in aid to local bodies. For the 50% and 100% CSS Schemes Central Share is ` 16.28 crore and `
36.55 crore respectively. In addition to this ` 5 crore is included as Special Central Assistance to TSP
with state budget. Details of Financial and Physical achievements of schemes implemented by the
department during 2010-11 and 2011-12 (up to 30.09.11) are given in Appendices 14.36 and 14.3 7
respectively.
Educational Programmes
14.172 The thrust of the development programmes is to promote the socio-economic conditions of
the Scheduled Tribes and to free them from exploitation. Lack of awareness which is the result of
educational backwardness is the main hurdle in the socio economic progress of the Scheduled Tribes
and hence top priority is given for their educational development and about 50% of total budget pro-
vision (both plan and non-plan) is set apart for the education sector. The department is distributing
educational concessions, scholarships and other kinds of assistance to the tribals from preprimary to
post graduate level. Apart from exemption from all kinds of fee, they are given lumpsum grant meant
for the purchase of books, stationery and dress materials and monthly stipend at varying rates. There
are nearly 78,000 prematric and 12500 post matric tribal students in the State. Details of the amount
spent during the period 2002-03 to 2011-12 for educational concessions is given in Table 14.48
Table 14.48
Details of Educational Concessions distributed by ST Department
Year No. of students
[ Pre-matric & post
matric]
Plan [post matric]
(` lakh)
Non Plan [prematric
& post matric]
(` lakh)
2002-03 62766 100.00 331.00
2003-04 69809 96.31 492.28
2004-05 78382 199.77 545.13
2005-06 82935 399.97 781.45
2006-07 82935 257.22 704.38
2007-08 84849 526.80 845.95
2008-09 83044 585.36 1157.05
2009-10 92276 172.2 1136.38
2010-11 93144 788.67 1196.04
2011-12 (As on
30.9.2011)
78903 6.39 488.43
Source: Directorate of ST Development
14.173 Educational concessions, scholarships and other kinds of assistance are provided to tribal
students from pre-primary level to post graduate level. Details showing the number of ST students
benefted and amount spent during 2010-11 and 2011-12 (up to 31.09.2011) are given in Appendices
14.38 & 14.39 respectively.
14.174 As stated by the department a study made by the ST Development Department reveals that
Kerala State Planning Board
453
nearly 10% of the tribal habitats are very remote and lack even primary school facility within a radius
of 2 km. In fact the position has improved to some extent during the last two fve year plan periods .
However the school facilities in primitive tribal areas are still poor with 71.95% of the PTGs lacking L.P
school facilities with in 1 km area.
14.175 Major portion of the non-plan outlay of ST Development Department is for educational devel-
opment activities including scholarship, boarding and lodging charges, incentive to parents etc.
14.176 With a view to provide residential education to tribal students from remote areas the ST De-
velopment Department is running 108 pre-matric hostels and 3 post matric hostels in the State for
providing boarding, lodging and tuition facilities. There are 29 single teacher schools for providing
pre-primary education to tribal students living in very remote and inaccessible areas. Of these 27 are
in Idukki District.
14.177 For providing pre-primary education to the tribal students 13 kindergartens and 22 Balawadies
are functioning under local self government and the ST department respectively. The nutritional re-
quirements of the children are taken care of to a great extent in these institutions. The Department
also runs 20 training centres for imparting job oriented technical training. At present 2% of the total
seats in educational institutions are reserved for ST students.
14.178 In order to provide quality education to ST students, 18 Model Residential Schools are func-
tioning under this department viz., 15 Ashram Schools in Tribal Sub Plan areas and 2 Ekalavya Model
Residential Schools and one special Model Residential[CBSE] school (100% Assistance under Art.
275[1]). The Model Residential schools could achieve impressive results in the SSLC examination
2009. Also under the Ayyankali Memorial scheme, selected students from STD. IV and VIII are provid-
ed with continuous special tuition and counselling. For imparting primary education to primitive tribe
children living in remote tribal settlements, 24 centres are functioning under the scheme Peripatetic
Education Centres of PTGs.
14.179 The Department give tuition fee of ST students who got admission to professional course in
self fnancing colleges under government quota. The plan outlay & expenditure during 2002-03 to
2011-12 in respect of educational sector are furnished in Table 14.49
Table 14.49.
Outlay and Expenditure of Education sector (plan) (` lakh)
Year Outlay Expenditure
2002-03 1106.60 931.97
2003-04 953.60 725.83
2004-05 1223.50 1068.23
2005-06 1242.14 1062.10
2006-07 1918.98 1735.33
2007-08 1878.85 1753.17
2008-09 2965.70 2757.25
2009-10 3957.98 3194.90
2010-11 7302.00 6206.7
2011-12 (As on 30.09.11) 6573.42 1975.56
Source: Directorate of ST Development.
Economic Review 2011
454
Figure 14.9
Housing
14.180 During the 11th Five Year Plan, top priority is given for providing houses to all houseless STs
in the state. In the eleventh plan, it is proposed to construct houses to all houseless families in a time
bound manner. At present the requirement of new houses is more than 25000. The ST Development
Department, TRDM, Rural Development Department [IAY Scheme] and the local bodies are the major
agencies involved in the tribal housing area in the State. During 2010-11 ` 1000 lakh provided under
general housing for the construction of new houses During 2011-12 `15 crore was sanctioned for
undertaking construction of new houses and for the completion of spillover houses.
14.181 The outlay and expenditure of the housing schemes under plan implemented by the
Department during the period 2002-03 to 2011-12 is given in Table 14.50
Table 14.50
Details of Housing Programmes undertaken by ST Development Department
(` Lakh)
Year Plan
Outlay Expenditure
2002-03 311.68 308.01
2003-04 211.68 188.11
2004-05 - -
2005-06 100.00 99.16
2006-07 1227.19 1194.36
2007-08 300.00 296.98
2008-09 400 390.04
2009-10 500 498.54
2010-11 1000 944.79
2011-12 (As on
31.09.11)
1500 326.12
Source: Directorate of Scheduled Tribe DevelopmentOther Schemes
Kerala State Planning Board
455
Figure 14.10
14.182 District wise details of houses constructed by the ST Development Department for 2006-07
onwards are given in Appendix 14.40
Health
14.183 Various measures are taken for providing timely medical attention to STs. The Health Ser-
vices Department run 63 PHCs in the tribal areas. Besides the ST Development Department has 4
Midwifery centres, 17 Ayurveda Dispensaries, 3 Allopathy Dispensary/O.P. Clinics, 1 Ayurveda Hospi-
tal, 2 Mobile Medical units and 1 Allopathy Hospital at Mananthavady. During 2007 the Nalloornad and
Attappady hospitals under the ST Development Department were transferred to the DHS and are now
functioning well. Apart from the PHCs and Ayurveda Dispensaries, Homoeo Dispensaries are also
functioning in tribal areas under TSP of the respective Department. The Health Department conducts
medical camps in tribal areas to diagnose diseases. Serious diseases detected are referred to district
hospitals and fnancial assistance given for treatment. Studies by the Health Department as well as
AIIMS,New Delhi show that nearly 15 % of the tribal families in Wayanad and Palakkad Districts have
traits of the genetical problem Sickle Cell Anaemia. In order to tackle the problem, Kozhikode Medi-
cal College has set up a Sickle Cell Anaemia unit with Electrophoresis machine. Also programmes for
rehabilitating Sickle Cell Anaemia patients are also undertaken in Wayanad District. During 2009-10
` 40 lakh is provided to Swami Vivekanada Medical Mission Kerala for extension of vocational cum
production centres for rehabilitating Sickle Cell Anaemia patients belonging to ST communities of
Wayanad.
14.184 As stated by the Department during 2010-11 an amount of ` 274.16 lakh was provided by the
ST Development Department for health programmes under plan and non plan. During 2007-08 a new
scheme Complete Health Care Programme for the Tribals has been implemented by the depart-
ment utilizing the ACA of ` 10 Crores received from Government of India and so far 27657 peoples
benefted.
143.185 There are a few remote settlements in Idukki, Palakkad, Thrissur, Wayanad and Malappuram
where such health care facilities are still lacking. Outlay and expenditure for plan and non plan health
programme for the period 2002-03 to 2010-11 are given in the table 14.51
Economic Review 2011
456
Table 14.51
Details of Health Programmes
[` Lakh]
Year Plan Non-plan
Outlay Expenditure Outlay Expenditure
2002-03 120.00 120.00 76.11 56.95
2003-04 229.56 119.42 68.81 66.02
2004-05 137.50 183.09 85.46 75.42
2005-06 120.00 106.90 91.33 85.50
2006-07 280.00 129.86 130.73 100.98
2007-08 1217.00 1201.62 148.76 115.98
2008-09 170.00 116.11 137.58 114.96
2009-10 80.00 79.99 149.83 130.36
2010-11 100.00 100.00 0 0
Source: Directorate of ST Development
Resettlement of Landless Tribes
14.186 A special scheme for providing land to the landless and houses to the houseless is being im-
plemented in the state. As part of the resettlement of landless, Tribal Resettlement and Development
Mission (TRDM) has been formed to undertake rehabilitation activities based on a Master Plan. They
have identifed 22052 landless tribal families and 32131 families with less than one acre of land. Land
distribution was inaugurated on 1/1/2002 and TRDM could so far distribute 8830.34 acres of land to
6664 tribal families as shown in table 14.52
Table 14.52
District wise details of land distribution
[Link] District
Families
(Nos)
Extent
(Acre)
1 Thiruvananthapuram Nil Nil
2 Kollam 128 114.68
3 Pathanamthitta 28 12.19
4 Kottayam 19 19
5 Alappuzha 35 7.67
6 Idukki 949 1460
7 Ernakulam 296 418.9
8 Thrissur 20 5.68
9 Kozhikkode 420 600
10 Palakkad 10 4.44
11 Malappuram 61 46.38
12 Kannur 3587 3491.37
13 Wayanad 997 2526.6
14 Kasargod 114 123.43
Total 6664 8830.34
Source: TRDM
Kerala State Planning Board
457
14.187 The Aralam Farm with an extent of 7612 acres, has been purchased by the State Government
at a cost of ` 42.09 crore. Half the area of the farm will be retained as farm itself and the remaining
portion (about 3779 acres) has been distributed to 2557 families during the year 2006 & 2007. In ad-
dition to this Government of India has been approached for diversion of 12196 hectare of forest land
for assignment to the landless families. The statement showing the land distributed to landless tribals
by the TRDM is given in Appendix 14.41.
14.188 The resettlement activities involves the following items viz. (i) preliminary work such as identi-
fcation of land, survey and demarcation of the plots, completion of procedures for selection of benef-
ciaries in a transparent manner prior to the resettlement; (ii) the actual resettlement by providing land
and facilities such as housing, drinking water, sanitation, health care, education etc;(iii) the develop-
ment of the plots into self suffcient agricultural farms, through crop husbandry, animal husbandry, soil
conservation activities, irrigation facilities, etc; and (iv) providing other essential infrastructure develop-
ment.
14.189 Major projects such as Sugandhagiri Cardmom project, Priyadarshini Tea Estate, Pookot Dairy
project, Attappady Co-operative Farming Society (ACFS), Vattachera Tribal Collective Farm etc were
started to improve the socio-economic conditions of STs and to free them from exploitation. These
fve projects could rehabilitate 1089 ST families in 3295 hectares of land. The rehabilitated families
have been given housing and other amenities and employment in the farms of the project. As a policy
decision of the State Government to issue land to landless tribal families, land belonging to Sugandhi-
giri Cardamom project, Pookot Dairy project and Vattachira Tribal Collective Farm were distributed to
the Tribal families within the project area. Now two Group Farms are functioning viz ACFS and Pri-
yadarshini Tea Estates (Mananthavady) and the grant-in-aid to these two farms were given out of the
budget provision under Support to Group Farms.
14.190 District-wise details of distribution of surplus land furnished by survey and land records de-
partment as on 30.10.2010 are given in Appendix 14.42.
Economic Review 2011
458
Corpus Fund
14.191 Out of ` 412.25 lakh under the Corpus Fund , an amount of ` 383.3 lakh was expended
during 2010-11 for undertaking various development activities. The components of the Corpus fund
includes self employments, skill development, water supply and sanitation, communication facilities,
foot bridges, technology transfer, improvement of education and health etc. Statement showing the
outlay and expenditure under Corpus fund from 2002-03 to 2011-12 is given in Table 14.53 and the
details of schemes taken during 2010-11 in Appendix 14.53
Table 14.53
Outlay and Expenditure under Corpus Fund from 2002-03 onwards
(` lakh)
Year Outlay Expenditure
2002-03 813.26 1019.36
2003-04 1485.02 1001.96
2004-05 1277.76 1187.50
2005-06 635.45 631.84
2006-07 671.38 649.09
2007-08 664.87 648.39
2008-09 813.15 806.05
2009-10 1135.11 1129.57
2010-11 412.25 383.3
2011-12 [as on
30.09.11]
3504 279.31
Source: Directorate of ST Development
Figure14.11
Other Schemes
14.192 In order to reduce the burden of marriage expenses of daughters of tribal parents, 100 girls
were given assistance @ ` 20,000/- during 2009-10. An amount of ` 50 lakh is earmarked during
2011-12. Priority will be given to the daughters of widows, unwed mothers and incapacitated parents.
14.193 The Department have also started 3 Care Homes for Tribal Destitutes, 2 in Wayanad Districts
(Sugandagiri and Mananthawady) and one in Palakkad District (Attappady) during 2004-05, having
Kerala State Planning Board
459
facilities for accommodating 25 inmates in each centre. The running cost of these Care homes is met
from the scheme Special Programme for Primitive Tribal Groups, Adiya & Paniya.
14.194 The department has engaged 76 Tribal youths as Apprentice Clerks in the Tribal offces.
Also the department has engaged 15 councellors in the Prematric Hostels and Model Residential/
Ashram Schools to conduct counseling programmes as part of providing quality education to the tribal
students.
Implementation of the Scheduled Tribes and other traditional Forest Dwellers [Recognition of Forest
Rights] Act 2006.
14.195 The Scheduled Tribes and other traditional Forest Dwellers [Recognition of Forest Rights].
Act 2006 enacted by the Government of India is under implementation in the state. The various com-
mittees envisaged under the Act have been constituted. The number of Forest Rights Committees
elected is 504 and applications received from the tribal families for recognition of their rights are being
scrutinized. Around 33000 tribal families are anticipated to be benefted under the Act. The Govern-
ment of India has already released a sum of ` 27.61 lakh under Art. 275[1] of the Constitution as one-
time grant to cover the expenditure related to the implementation of the Act. Pooled Fund for special
projects proposed by other departments under TSP.
14.196 During 2011-12 an amount of ` 1060 lakh was provided under the scheme Pooled Fund for
special projects proposed by other departments. The expenditure as on 30.09.11 is ` 62.14 lakh.
SCA to TSP
14.197 The Special Central Assistance to Tribal Sub Plan released by Government of India as an ad-
ditive to State Plan Funds is meant for undertaking employment cum income generation activities and
the infrastructure incidental to activities based on family and self Help Groups. Expenditure details of
SCA to TSP from 2002-03 onwards are given in Table 14.54
Table 14.54
Statement showing the Outlay and Expenditure under SCA to TSP during 2002-03 to 2011-12
(` In lakh)
Year Outlay Expenditure
Physical Achieve-
ment (families)
2002-03 275.00 348.45 5499
2003-04 350.00 355.36 6098
2004-05 350.00 379.30 4667
2005-06 246.00 244.45 2764
2006-07 350.00 241.20 1444
2007-08 350.00 330.90 3143
2008-09 350.00 349.38 1791
2009-10 450.00 189.56 1992
2010-11 500 499.54 5876
2011-12 (As on
31.09.11)
500 146.10 6879
Source: Scheduled Tribe Development Department
Economic Review 2011
460
Outlay and Expenditure under SCA to TSP during 2002-03 to
2011-12
0
1000
2000
3000
4000
5000
6000
7000
8000
2
0
0
2
-
0
3
2
0
0
3
-
0
4
2
0
0
4
-
0
5
2
0
0
5
-
0
6
2
0
0
6
-
0
7
2
0
0
7
-
0
8
2
0
0
8
-
0
9
2
0
0
9
-
1
0
2
0
1
0
-
1
1
2
0
1
1
-
1
2
O
u
t
l
a
y
a
n
d
E
x
p
e
n
d
i
t
u
r
e
(
R
s
.
i
n
l
a
k
h
s
)
Outlay
Expenditure
Physical Achievement
(families)
Figure 14.12
Co-operation
14.198 The SC/ST cooperatives were formed aiming the overall improvement of the socio-economic
conditions of SC and ST. The number of primary cooperative societies are 630(SC-532, ST-98).
Through these societies loans are being released and other activities are done. Minor forest produce
procurement, sales, other activities like Ayurdhara and Petrol pump are being undertaken by the Ker-
ala State Federation of SC/ST Development Cooperative Limited.
KIRTADS
14.199 The Institute conducts research and intensive study on Scheduled Caste and Scheduled Tribe
population of the state. During the year 2010-11 the department has already initiated the following
research studies.
Research study on the Kurumba Community and the Decentralized Development Process.
Research Study on Kadar Community.
Research Study on Mala Pulaya Community.
Mapping of settlement of PTGs and associated infrastructure facilities
using spatial technologies.
14.200 Anthropological investigation on doubtful community cases as requested by Scheduled Tribe
Development Department, Scheduled Caste Development Department, Revenue Divisional Offcers,
Tahsildars and District Collectors has also undertaken by the wing. 131 such studies have already
been completed during the period and report submitted.
14.201 The training wing of KIRTADS always coordinate and conduct a large number of programmes
which give more emphasis to Tribal Development . This wing also conducted many orientation pro-
grammes, capacity building programmes, empowerment programmes and educational programmes.
During the year 2010-11 major initiatives were being taken to give more opportunities to self employ-
ment and entrepreneurial development.
Welfare of OBC
14.202 An amount of ` 19.45 crore was expended for the welfare of Other Backward Classes during
2010-11. Major education schemes included pre-matric and post-matric scholarships to OBC/OEC/
SEBC students. During 2011-12 an amount of ` 23.06 crore is earmarked for the welfare of OBCs. An
amount of `4 crore is the 50% CSS to the scheme.
Kerala State Planning Board
461
14.203 Details of fnancial and physical achievements of schemes implemented by the department
from 2010-11 and 2011-12 (up to 30.09.11) for Scheduled Castes and OBCs are given in Appendi-
ces 14.29 and 14.30 respectively. Kerala State Development Corporation for Scheduled Castes and
Scheduled Tribes
14.204 The Corporation, with its Registered offce at Thrissur, functions through 14 Regional Offces
covering all the districts, is implementing various schemes to enable the SC/ST people to become
self-reliant in all respects. The sources of fnance for implementing various schemes are Corporations
own share capital and assistance from other national refnancing agencies like NSFDC, NSTFDC,
NSKFDC and HUDCO. The Corporation is now concentrating more on self employment schemes to
enable the target people to engage in some innovative and viable income generating activities and
earn their livelihood and thereby improve their socio-economic status in the society.
14.205 The major schemes implemented by the Corporation include agricultural land purchase, mi-
cro-credit fnance, mini-venture loans, small enterprise loans, housing, educational loan, marriage
assistance etc.
14.206 The scheme wise details of physical and fnancial achievements of the Corporation are given
in Appendix 14.44.
Kerala State Backward Classes Development Corporation
14.207 The Corporation aims at the socio-economic upliftment of the backward classes and minorities
in the state. The major objectives of the Corporation are:
1. To promote the comprehensive development of the Other Backward Classes and Minorities of
Kerala by rendering assistance by way of loans and advance for establishing small income generating
enterprises in various sectors.
2. To promote schemes, establish institutions for the socio, economic and educational upliftment of the
target group.
3. To assist Other Backward Classes and Minorities for the upgradation of technical and entrepreneur-
ial skills.
14.208 The Corporation mobilizes funds from the National Backward Classes Finance & Development
Corporation (NBCFDC) and National Minorities Development & Finance Corporation (NMDFC) in ad-
dition to State Government support. The source-wise expenditure and the physical achievements of
the Corporation during 2010-11 and 2011-12 (as on 30.09.2011) are given in Appendix 14.45.
Kerala State Development Corporation for Christian Converts from Scheduled Castes and the
recommended Communities
14.209 The main objective of this Corporation is to promote social, educational, cultural and economic
upliftment and other living conditions of the converted Christians from Scheduled Castes and other
recommended communities. The main schemes under implementation by the Corporation are agricul-
tural land purchase, foreign employment, housing, cash incentive to students, marriage loan, agricul-
ture and allied sector assistance, small business, educational loan etc. The Corporation implements
these schemes with the fnancial assistance received from state government and the loan assistance
from NBCFDC. Details of year wise disbursement of State Government assisted loan schemes for the
last 11 years are given in Table 14.55.
Economic Review 2011
462
Table 14.55
KSDC for Christian converts from Scheduled Castes and the recommended Communities-
Year wise disbursement of State Government assisted loan schemes
Year wise Physical
Financial
(` in lakh)
2000-01 578 116.15
2001-02 410 23.58
2002-03 147 58.54
2003-04 783 192.40
2004-05 320 147.06
2005-06 977 89.29
2006-07 872 83.02
2007-08 1298 77.92
2008-09 1877 220.60
2009-10 2211 442.16
2010-11 2493 499.83
2011-12(30.09.11) 1988 290.83
Source: KSDC for Christian converts from SC
and the recommended Communities
14.210 The scheme wise details of physical and fnancial achievements of the corporation are given
in Appendix 14.46.
Information & Publicity
14.211 Information and publicity activities constitute an integral part of the Govt. in disseminating
various information concerning the Govt. and its departments among the public. It acts as a media-
tor to the Government in promoting effective governance after taking feedback from the public. The
success of various developmental as well as welfare programmes are greatly depend on information
and publicity activities. The effective functioning of these activities enables the creation of a healthy
relationship between the government and the public.
14.212 The Department of Information and Public Relations is the nodal department which undertakes
States public relations activities and information services. Kerala Press Academy and Center for De-
velopment of Imaging Technology (C-Dit) under the control of I&PRD are the other two autonomous
institutions functioning in this area.
Information & Public Relations Department
14.213 The department functions mainly through 13 wings besides the District Information offces
and Kerala Information Centre in New Delhi. The major wings of I & PRD includes Press Release of
Government, Scrutiny of Media, Research and Reference, Advertisement & Marketing, Circulation &
Distribution, Field Publicity & Exhibition, English publication, Malayalam Publication, Web & Newme-
dia, Audio Video Communication (electronic news gathering & distribution, audio video production &
documentation), Planning & Development, Culture Development and Photo Division. Major Activities
of the Department are:-
Publicize the policies and programmes of the Government.
Giving publicity to the developmental and welfare programmes undertaken by the
Kerala State Planning Board
463
Government.
Publishing of monthly magazins Viz, Kerala Calling in english and Janapatham in
malayalam and monthly newsletters viz,Vikasana Samawayam in malayalam and
Kerala Interface in english.
Functioning as information and news dissemination centres at the district level.
Acting as an agency for government advertisement.
Acting as an enforcement agency for Cable TV Act, Press and Registration of Books
Act.
Preparing audio-video documentaries of prominent personalities of Kerala.
Extending fnancial assistance to Journalists in distress and their dependents.
Organizing press conferences of ministers and offcials.
Giving press release to media
Review on major Schemes/Activities
Sutharya Keralam
14.214 Sutharya Keralam is an innovative public grievance redressal progaramme started in 2005-
06 in the structure of a phone-in-programme through Doordarshan and All India Radio. The major
objective of the programme is the automation of Chief Ministers Grievance Redressal Cell and con-
vergence of communication to redress the grievances of the public. Now, the programme lacks the
facility to tackle the status of petitions which have already been lodged. So the programme would be
strengthened with support of IT enabled feedback system in order to make it as people friendly
Modernization of Tagore Theatre
14.215 The frst phase of modernization of Tagore Theatre aimed to renovate and develop the Tagore
Centenary Hall, Thiruvananthapuram as a multi purpose cultural centre for facilitating various cultural
and entertainment activities. A major share of the outlay in the sector during 11th Plan (Rs.1095.00
lakh) has been provided for the renovation purpose. The expenditure reported upto 30.09.2011 is only
Rs.159.28 lakh. It is noted that the modernization process of Tagore Theatre had been started in the
beginning of the 10th plan period and not completed. The delay in completion of the modernization
process of the centre is a concern as it is the symbol of the cultural heritage of the state.
Inter State Public Relations
14.216 Inter state public relations project was started in 2010-11 to conduct media conclave, cultural
shows and exhibitions at metro cities in order to attract prospective investors from outside Kerala. An
amount of Rs.10.00 lakh each has been provided for the scheme during the 10th and 11th Plan. The
scheme fails to achieve the fnancial as well as physical target of attracting prospective investors.
Government Web Portal and Maintenance of Mail Server
14.217 The offcial website of Government of Kerala was launched in 1999 and is maintained by the
web new media wing of Information & Public Relations Department with the support of C-Dit, Keltron
and Kerala IT Mission. The main function of the portal is to provide general information about the state
including the structure of the Government, functions of various Government departments and agen-
cies, details of ministries, Members of the Legislative Assembly and other elected representatives
and provides entry to other departmental websites. By releasing government tenders via window ads
scheme the state exchequer has saved nearly Rs. 2.50 crore as advertisement charges which it owes
to the print media every year. The new version of the web portal designed in the Content Manage-
ment Frame work has almost been completed. Now the department has taken a number of initiatives
to develop the government web portal into a meaningful information dissemination tool for ensuring
Economic Review 2011
464
transparency and effciency in the functioning of the government.
Press Release
14.218 Press release including special features through the print and electronic media, release of
video news clips to T.V media, convening press meets, providing better facilities to reporters for easy
reporting etc are the major activities coming under press releases. During the period upto September
2011, the department released 2971 press releases, 2353 photo coverages, issued 341 press accredi-
tation cards and arranged 122 reporting facilities.
Field Publicity and Exhibitions
14.219 Awareness programmes and campaign are the part and parcel of the public information system
and mass media activities. The feld publicity wing functioning at the Directorate of I&PRD organize
various event management activities of the government. At the district level, the feld publicity wing are
giving adequate publicity to Government policies and programmes. These campaign and awareness
programmes are being arranged in the form of art and cultural programmes.
14.220 Exhibitions and multimedia campaigns were launched for creating awareness on national inte-
gration, communal harmony, decentralised planning etc within and outside the state. During the period
Sept. 2011, the department conducted 22 seminars on various topics and 38 exhibitions on different
occasions in various places
Electronic Media Division & Advertisement in Electronic Media
14.221 Electronic Media Division formed in October 2008 consists of four wings viz, news distribution,
audio-video production, electronic media advertisements & marketing and web & newmedia. The ma-
jor activities of these divisions are the release of video news clips to media channels and streamlining
the production and management of advertisement. During the period Sept. 2011, the electronic media
division released 5412 video news clips to various media. Details of electronic media activities during
2011 are given in Table No.14.56
Table No.14.56
Details of Electronic Media Activities during 2011 (as on 30-09-2011)
[Link]. Items Total (Nos)
1
Video news clips released to T.V. chan-
nels
5412
2 Special features 28
3
Video news clips released to T.V. chan-
nels from Directorate
2994
4
Video news clips released to T.V. chan-
nels from DIOs
2418
5 Films and videos purchased 0
6 Navakeralam programme aired 9
7
J anapatham programme in All India
Radio
11
Source: Information and Public Relations Department
14.222 The electronic media division has now the facility for advertising and marketing. This facility
can be used to produce and release government advertisements of various departments. It will enable
the Government to cut short the huge advertisement cost to a large extent.
Kerala State Planning Board
465
Publications
14.223 The editorial wing is bringing out publications of reference books, magazines, newsletters,
pamphlets etc. on various subjects like culture, education, history, contemporary events, books on
eminent individuals and traditional arts. The prominent print media publications are Janapatham
(malayalam) and Kerala Calling (english). Kerala Interface (english) and Vikasana Samawayam
(malayalam) are the two major monthly news letters. The details of publications of the department
during 2011 are given in Table No.14.57
Table No.14.57
Details of Publications during 2011 through I&PRD (as on 30-09-2011)
[Link]. Publications Total (Nos)
1 Kerala Calling,magazine (monthly) 145000
2 J anapatham( monthly) 151500
3 Vikasana Samawayam Newsletter,(Malayalam) 155000
4 Kerala Interface, monthly 45000
5
Sahakarana mekhala kooduthal
karuthode(booklet)
50000
6
Uyarangal Keezhadakkunna Vyavasaya
Kuthippu(booklet)
10000
7 Pakarcha vyadikalum Prathirodhavum(booklet) 50000
8 Kalathinte Kaiyyoppu(booklet) 100000
9 Nadunarna Naluvarsham(Folder) 200000
10
Adisthana Janvibhagangalku Aashwasam Vydyudi
Rangathu Munnettam
10000
11
Nunapaksha Kshemam- Keralathinte Savishesha
Mathruka(Folder)
10000
12 Kerala- An Authentic Handbook 10000
13
Janapaksha Vikasanathinu Oru Desiya Mathruka
(Booklet)
20000
14 Nadinte VikasanathinuYuvashakthi(Folder) 50000
15 Media Handbook 10,000
Source: Information and Public Relations Department
Information Centres
14.224 The I&PRD has a state information centre under its research and reference wing at the Direc-
torate to provide facilities for research and reference. Also, the District Information Centres function-
ing at the district head quarters and centre at New Delhi provide various information to the general
public including district administration. These centres have a good number of books from the State
and Central Government. It also deals with the registration of periodicals and books as per PRB Act.
Kerala Press Academy
14.225 The Kerala Press Academy was established in 1979 as a joint venture of the GOK, Kerala
Union of working journalists and Indian Newspaper society. It is administrated by a general council
and an executive council comprising of working journalists, media owners and government repre-
sentatives constituted by the government. The main objective of the Academy is to promote and co-
ordinate study and research in the feld of journalism in the state and its impact on other spheres of
Economic Review 2011
466
publicity activity. It offers Post Graduate Diploma courses in J ournalism, Mass Communication, Public
Relations and Advertising. It also conduct short duration refresher programmes and seminars.
Center for Development of Imaging Technology (C-DIT)
14.226 C-DIT established in 1988 is a unique institution aiming at convergence of various aspects of
IT and electronics. It is an approved research centre of Department of Science & Industrial Research
(DSIR) and Kerala University. It acts as a communication and ICT total service provider through its
307 franchisee training centres. A series of diploma, post diploma and certifcate courses approved
by the Government of Kerala and the Kerala State Public Service Commission are being offered by
these franchisee centres. Cybersri is a unique e-inclusion programme organised by C-DIT jointly
with Scheduled Castes and Scheduled Tribes Departments for providing training to engineering pro-
fessionals in information communication technologies. One of the pioneering Research & Develop-
ment projects it took up was indigenization of flm and video equipments. It has also taken up some
pioneering R&D in Indian language computing, video communication and e-governance. Some of the
achievements of the institution, during 2010-11 are given below.
l Computational Linguistic Team of C-Dit was completed the Nila 3.1 version with an integrated type-
writer keyboard making it compatible with the Unicode 3.1 standard. C-Dit developed an english
malayalam dictionary having more than 90000 english words with its malayalam meaning and com-
pleted the seven unicode 5.1 compatible malayalam fonts. During this period, C-Dit developed the
malayalam english online dictionary which has more than 38000 malayalam words and its english
meanings.
l C-Dit developed beta version of Malayalam Grammar Checker system. This has all features of MS
Words Grammar checker system. Beta version of Malayalam OCR which is helpful in converting
digital image of Malayalam text in old lipi and koottaksharangal into editable text format is in progress.
l According to the request of Government departments and agencies to modify the Malayalam soft-
ware Kaveri that would work in new version of Windows and Linux platforms, C-Dit established the
Periyar ML software
l The hardware of the Video Communication Team of C-Dit was upgraded with the latest video/au-
dio equipments to facilitate better utilization by the I&PRD and also for the Sutharya Keralam Project
l The fund allotted for the ITESS was utilized with the setting up of the FOSS Training Centre at Ko-
chi during the year 2008-09. The classes for the frst batch for advanced training in Free and Open
Source Software was started on 25th February 2009 at Kochi. 34 students have been admitted to the
programme so far, 26 of them completed. 96%of students joined in reputed institutions after complet-
ing the course.
Gender Development
If you want to see which way a country is headed, look at the
countrys budget and how it allocates resources for women and children
-Pregs Govender, MP, South Africa
14.227 Even though the position of women in Kerala has improved dramatically according to conven-
tional indicators such as health status, literacy, education, and life expectancy, and is even compa-
rable to that of advanced countries, there has been no corresponding improvement in their social and
economic status. This is most evident in their abysmally low and declining work participation rate (16
percent in 2001). The declining work participation rate of women, it is often argued, is refexive of an
improvement in the economic position of the family as a whole, because of which women drop out of
the work force. But this is precisely what constitutes proof of the fact that their economic status has
not improved.
14.228 A contributory factor towards this has been the absence of job opportunities of the sort that
educated women would prefer. The Eleventh Plan has focused on to bring about a considerable in-
crease in the number of skill-imparting institutions in the State. The Kudumbashree experiment involv-
Kerala State Planning Board
467
ing poor women organized in self help groups has not only been a remarkable success, but has also
brought to the fore the enormous managerial and entrepreneurial talent that remained untapped. A
similar experiment in bringing together educated women, currently engaged in the household chores,
into neighbourhood groups for producing a number of services, offers a potential source of gainful
employment for them
14.229 The Eleventh Plan placed considerable emphasis on gender auditing and gender budgeting of
major development policies and programmes. Gender auditing is concerned with the assessment of
the gender impact of policies and programmes not just in technical terms but also in terms of overcom-
ing the personal and institutional biases in the culture of the relevant organizations which hinder the
achievement of gender equality objectives
Status of Women in India A Brief Overview
14.230 Census of India, 2011 indicates that only 65.46 % women are literate as compared to 82.14%
men (female literacy was 54% in Census 2001). Female literacy is highest in Kerala (91.98%) and
lowest in Rajastan (52.66%). The literacy rate taking the entire population into account is termed as
crude literacy rate and taking the population from age 7 and above into account is termed as effec-
tive literacy rate. Effective literacy rate is increased to a total of 74.04% with 82.14% of the males
and 65.46% of females being literate. The table No. 14.58 lists the crude literacy in India from 1901
to 2011
Table No. 14.58
Crude literacy Rate in India from 1901 to 2011
Census Year Total (%) Male (%) Female (%)
1901 5.35 9.83 0.60
1911 5.92 10.56 1.05
1921 7.16 12.21 1.81
1931 9.5 15.59 2.93
1941 16.1 24.9 7.3
1951 16.67 24.95 9.45
1961 24.02 34.44 12.95
1971 29.45 39.45 18.69
1981 36.23 46.89 24.82
1991 42.84 52.74 32.17
2001 64.83 75.26 53.67
2011 74.04 82.14 65.46
Source: Census of India 2011
Economic Review 2011
468
Participation in Economy
14.231 The number of workers in the urban areas is 92.28 million of which only 16.10 million are fe-
males as per Census 2001. In rural areas, out of 310 million workers, 111 million are females. Women
work longer hours than me, and carry the major share of household and community work that is unpaid
and invisible. According to the pilot survey conducted in 18,620 household spread over six selected
States, namely, Haryana, Madhya Pradesh, Gujarat, Orissa, Tamil Nadu and Meghalaya states that
women spent about 2.1 hours per day on cooking food ad about 1.1 hours on cleaning the household
and utensils. Mens participation in these activities was nominal. Taking care of children was one of
the major responsibilities of women, as they spent about 3.16 hours per week on these activities as
compared to only 0.32 hours by males.
14.232 Due to the untiring efforts of the womens movement, the country amended and enacted wom-
en-related legislations during the Tenth Plan. The Married Womens Property Act (1874), and the
Hindu Succession Act (1956) were amended and the Protection of Women from Domestic Violence
Act (PWDVA) (2005) was passed. The Union Budget 2005-06, for the frst time, included a sepa-
rate statement highlighting the gender sensitivities of the budgetary allocation under 10 demands for
grants. Gender Budgeting Cells were set up in 56 Central Ministries/Departments to review public ex-
penditure, collect gender disaggregated data, and conduct gender-based impact analysis. Under the
Women Component Plan (WCP), efforts were made to ensure that not less than 30% of funds/benefts
under various schemes of all ministries/departments were earmarked for women.
14.233 The goals of human development are closely intertwined with development and empowerment
of women, who as an independent group constitute about 48.2 percent of the total population of India.
The principles of gender equality are enshrined in the Indian Constitution, in its Preamble, Fundamen-
tal Rights, Fundamental Duties and Directive Principles.
14.234 The Ministry of Women and Child Development, Government of India, came into existence as
a separate Ministry with effect from 30th J anuary, 2006. As per 2001 census 71.4 % of the Countrys
population constitute women and children. Empowered women is living with dignity and contributing
as equal partners in development in an environment free from violence and discrimination. Promot-
ing social and economic empowerment of women through cross-cutting policies and programmes,
mainstreaming gender concerns, creating awareness about their rights and facilitating institutional and
legislative support for enabling them is necessary to realize their human rights and development to
their full potential. The Specifc targets for Women in the Eleventh Plan Documents (2007-12) is given
in the Table No. 14.59
Table No.14.59
Crude literacy Rate in India from 1901 to 2011
Raise the sex ratio for age group 0-6 from 927 in 2001 to 935 by 2011-12
and to 950 by 2016-17
Ensure that at least 33% of the direct and indirect benefciaries of all
government schemes are women and girl children
Reduce anaemia among women and girls by 50% by the end of 2011-12
Reduce dropout rate for primary and secondary schooling by 10% for both
girls as well as boys.
Source: Eleventh Five Year Plan 2007-12 (Volume II) Document
Kerala State Planning Board
469
Women in India
Child Sex Ratio
The child sex ratio during the period (000 males)
1991 2001 2011
945 927 940
Women Literacy
1991 2001 2011
32.17% 53.67% 65.46%
Women as Workers
Female share of non agricultural wage employment is only 17%
Participation of women in the workforce is only
13.9% in the urban sector and
29.9% in the rural sector
Womens Wage rate are, on an average
Only 75% of mens wage rates and
Constitute only 25% of the family income
Women occupy
Only 9% of Parliamentary seats
Less than 4% seats in High Courts and Supreme Court
Less than 3% administrators and managers are women
Women and Education
Close to 245 million Indian women lack the basic capability to read and write
Women and Health
The average nutritional intake of women is 1400 calories daily. The necessary
requirement is approximately 2200 calories
38% of all HIV positive people in India are women yet only 25% of beds in AIDS
care centres in India are occupied by them
92 % of women in India suffer from gynecological problems
300 women die everyday due to childbirth and pregnancy related causes
Source: NCRB Crime India
The status of women in Kerala
14.235 Provisional data on Kerala Population 2011 (Census 2011) shows that female population of
Kerala rose marginally from 51.42% of the total population in 2001 to 52.01% of the total population in
2011, i.e., an increase of 9.96 lakh. Sex ratio is one of the most important social parameters indicating
the balance between males and females in the society. The overall sex ratio in Kerala continues to be
favourable to women, being 1084 in 2011 compared to 940 for the country as a whole. Further the sex
ratios in all the districts of Kerala also are favourable to the females. Details are given in the Table No
14.60
Table No.14.60
Crude literacy Rate in India from 1901 to 2011
Sl.
No.
District/State
Total Population- 2011
Sex Ratio (Num-
ber of females
per 1000 males)
Males Females 2001 2011
1 Thiruvananthapuram 33,07,284 15,84,200 17,23,084 1058 1088
2 Kollam 26,29,703 12,44,815 13,84,888 1070 1113
3 Pathanamthitta 11,95,537 5,61,620 6,33,917 1094 1129
4 Alappuzha 21,21,943 10,10,252 11,11,691 1079 1100
Box No 14.5
Economic Review 2011
470
Sl.
No.
District/State
Total Population- 2011
Sex Ratio (Num-
ber of females
per 1000 males)
Males Females 2001 2011
5 Kottayam 19,79,384 9,70,140 10,09,244 1025 1040
6 Idukki 11,07,453 5,51,944 5,55,509 993 1006
7 Ernakulam 32,79,860 16,17,602 16,62,258 1017 1028
8 Thrissur 31,10,327 14,74,665 16,35,662 1092 1109
9 Palakkad 28,10,892 13,60,067 14,50,825 1068 1067
10 Malappuram 41,10,956 19,61,014 21,49,942 1063 1096
11 Kozhikode 30,89,543 14,73,028 16,16,515 1058 1097
12 Wayanad 8,16,558 4,01,314 4,15,244 1000 1035
13 Kannur 25,25,637 11,84,012 13,41,625 1090 1133
14 Kasaragod 13,02,600 6,26,617 6,75,983 1047 1079
15 Kerala 3,33,87,677 1,60,21,290 1,73,66,387 1058 1084
Source: Census 2011 (Provisional)
14.236 While the overall sex ratio in Kerala improved from 1058 in 2001 to 1084 in 2011, the child sex
ratio (0-6 years) decreased from 963 in 2001 to 959 in 2011. It is quite alarming that in all the districts
in Kerala, the child sex ratio is less than 1000. The number of child population in the age group 0-6
decreased from 36.53 lakh in 2001 to 33.22 lakh in 2011, and thereby registering a decrease of 3.31
lakh. This decrease is evenly distributed among boys and girls. District-wise details of child population
in the age group 0-6 and the corresponding sex ratio in Kerala are given in Table 14.61
Table No 14.61
District-wise details of Child Population and Sex Ratio in Kerala
Sl.
No.
District/State
Child Population in the Age Group 0-6
Sex Ratio 0-6
population
Males Females
2001 2011 2001 2011 2001 2011
1 Thiruvananthapuram 1,81,966 147777 173792 142884 955 967
2 Kollam 1,44,340 121481 138670 116581 961 960
3 Pathanamthitta 62,101 46582 60134 44919 968 964
4 Alappuzha 1,10,825 95556 106617 90466 962 947
5 Kottayam 1,05,680 86113 101089 82450 957 957
6 Idukki 65,656 51132 63711 48975 970 958
7 Ernakulam 1,67,866 148047 159192 141234 948 954
8 Thrissur 1,64,817 148428 157093 140698 953 948
9 Palakkad 1,54,070 146947 148441 141419 963 962
10 Malappuram 2,68,482 281958 262774 270813 979 960
11 Kozhikode 1,70,318 164800 164606 158711 966 963
12 Wayanad 51,308 45776 48923 43944 954 960
13 Kannur 1,38,169 135189 132031 130087 956 962
14 Kasaragod 76,071 76149 74836 73131 984 960
Kerala State Planning Board
471
Sl.
No.
District/State
Child Population in the Age Group 0-6
Sex Ratio 0-6
population
Males Females
2001 2011 2001 2011 2001 2011
15 Kerala 18,61,669 1695935 1791909 1626312 963 959
Source: Census 2011 (Provisional)
14.237 It is widely acknowledged that women in Kerala fare much better than their counterparts else-
where in India and development scholars point to past and current levels of female literacy and edu-
cation, late age of marriage, declining fertility and greater life expectancy to establish this fact. In
recent times, these conventional indicators are under the scanner due to various other indicators like
decreasing sex ratio among 0-6 age group (male preference), work participation rate lower than the
national level ratio, increasing violence against women and low political participation
Box 14.6
Women in Kerala
Population Size 1,73,66,387 (52.01%)
Population Size ( Rural Females) 90,51,800 (56.81%)
Population Size (Urban Females) 83,14,587 (52.18%)
Sex Ratio (Females per 000 males) 1084
Sex Ratio (Urban) 1091
Sex Ratio (Rural) 1077
Population Size 0-6 Yrs(Rural Females) 8,55,844
Population Size 0-6 Yrs(Urban Females) 7,70,468
Literate 7+ Yrs 1,44,78,339
Literate 7+ Yrs (Rural Females) 74,37,300
Literate 7+ Yrs Urban Females) 70,41,039
14.238 Every policy and programme affects men and women differently. Since there is a gender dis-
parity and discrimination in our society based on unequal power relations between men and women,
such programmes and policies often either ignore women or take a welfare approach attempting to
make women better wives or mothers. What is needed is to recognize that women are equal citizens
and have rights and entitlements. Hence the social justice/gender justice approach is required.
14.239 Gender is one among many issues of injustice and is an integral part of the socio-economic,
political and cultural system and not to be seen in isolation. It is also to be noted that women are not a
homogeneous category. There are issues of diversity and multiple identities among women. Moreover
womens subordination is a systemic problem and therefore it is not a question of men versus women.
Men and women need to be in the same camp in this search for justice.
14.240 The paradox of the status of women in Kerala lies in the confusion between `gender equality
and `gender equity. The notion of gender equality assumes that the needs and interests of women and
men are identical, whereas the notion of gender equity presumes they are different. Policies and plans
should take this into consideration and the differential needs be addressed to achieve gender justice.
Demography
14.241 Kerala has the most favourable sex ratio (1000men: 1084 women) in India. Yet a grave concern
is the declining sex ratio of the 0-6 age group. The census of 2011, shows that Keralas juvenile sex
ratio has come down in the last decade especially in districts like, Alappuzha, Idukki and Thrissur. The
district wise details of child population and sex ratio is given in the Table No. 14.62
Economic Review 2011
472
Table No 14.62
District-wise details of Child Population and Sex Ratio in Kerala (Sex ratio (1000 boys):
Sl.
No.
District/State
Child Population in the Age Group 0-6
Sex Ratio 0-6
population
Males Females
2001 2011 2001 2011 2001 2011
1 Thiruvananthapuram 1,81,966 147777 173792 142884 955 967
2 Kollam 1,44,340 121481 138670 116581 961 960
3 Pathanamthitta 62,101 46582 60134 44919 968 964
4 Alappuzha 1,10,825 95556 106617 90466 962 947
5 Kottayam 1,05,680 86113 101089 82450 957 957
6 Idukki 65,656 51132 63711 48975 970 958
7 Ernakulam 1,67,866 148047 159192 141234 948 954
8 Thrissur 1,64,817 148428 157093 140698 953 948
9 Palakkad 1,54,070 146947 148441 141419 963 962
10 Malappuram 2,68,482 281958 262774 270813 979 960
11 Kozhikode 1,70,318 164800 164606 158711 966 963
12 Wayanad 51,308 45776 48923 43944 954 960
13 Kannur 1,38,169 135189 132031 130087 956 962
14 Kasaragod 76,071 76149 74836 73131 984 960
15 Kerala 18,61,669 1695935 1791909 1626312 963 959
Source: Census 2011 (Provisional)
States Women Policy
14.242 The objective of States Women Policy includes declaring at least half the Panchayat and
municipality areas in the State as zones where there are no crimes on women within two years and
make Kerala a State that is free from offences against women in the next fve years. To achieve this,
vigilance committee will be strengthened in every area of the State and one day homes and short stay
homes will be established in all the cities. A committee will be formed to examine loopholes in the laws
meant to protect women to submit its recommendations
Livelihood, Employment
14.243 Livelihoods are about minimum conditions for living a life with dignity. Only if we view liveli-
hoods through the lens of human rights, in contrast to merely human needs, it will help us to explicitly
focus on people achieving those minimum conditions for a life with dignity. Kerala has piloted its pov-
erty eradication efforts through Kudumbasree and created successful models where womens agency
and empowerment is critical. These efforts need to be made sustainable and include the poorest of
the poor, especially the marginalized like tribal women, women from fshing communities and other
SC groups
14.244 There is increasing feminization and casualization of the workforce in Kerala and this is a
matter of serious concern. There are fewer women in the paid workforce than men. Womens work
is undervalued and unrecognized. Women work longer hours than men, and carry the major share
of household and community work, which is unpaid and invisible (Care economy). Multi-tasking by
women needs to be recognized and acknowledged.
14.245 Women who work in the agriculture and construction sectors and other unorganized sectors
also face wage discrimination. Women generally earn a far lower wage than men doing the same
Kerala State Planning Board
473
work. No Indian States has male-female wage equality in agriculture and construction sectors. Even
the Public Works Department (PWD) rates perpetuate the wage disparity between men and women.
Domestic workers are another category whose rights have to be taken care of.
14.246 The work participation rate of women nationally is approximately 25.7% and in Kerala it is only
15.3% as per Census 2001. The women, who work, in the private and unorganized sector which does
not offer regular income, labour rights or job security. Many women in Kerala work in beedi making,
coir, cashew, fsh selling and processing section, which are low- paying. Even women working in Spe-
cial Economic Zones (SEZ) face wage discrimination and they live in extremely poor conditions. Lack
of raw materials, marketing possibilities etc also weakens the precarious situation of those working in
the traditional sectors like reed mat making, basket weaving etc
14.247 Women and young girls migrate in large numbers to other States in India and other countries.
They may be skilled or unskilled- nurses, fsh processing workers, domestic workers etc. They are
often exploited and forced them to work in inhuman conditions
Assets, Resources, Infrastructure
14.248 Lack of access to assets and resources is symptomatic of underlying discrimination, exploi-
tation and exclusion. A right to resources is imperative to women who earn their livelihood through
agriculture and related occupations. This is also crucial to their bargaining power within the household
and community. Land ownership in itself (access) may not give women control over that asset due to
prevailing social and cultural practices. So it is important that efforts are made to create assets in the
name of women and help them to use that asset to live a life with dignity.
14.249 Ownership of land is also considered to be a strong social protection measure. According to
a recent study made by Bina Agarwal in Kerala, womens risk of physical violence from husbands is
dramatically less if they own land or a house. The incidence of violence is 49 per cent among women
without property, but 18 per cent among land owning women and 7 per cent if they own both land and
house. In Kerala which had a matriarchal tradition, most women do not own any property in their own
names. Only 23.8% women have operational landholding. Womens control and access to income
from land is limited. Women living in slum areas and in colonies do not have any rights of ownership,
leading their lives more vulnerable
Health (sexual reproductive health, occupational health,
mental health etc)
14.250 Though it has been possible to signifcantly reduce maternal and child mortality rates in Ker-
ala, morbidity rates among women are on the rise. Maternal mortality still needs attention, especially
among women from tribal, fshing and other marginalized communities. The burden of limiting the
family size is entirely on the shoulders of women. There is pressure on women from the family and the
medical establishment, to use oral pills and other invasive technologies. Although vasectomy is simple
and less expensive, it is mostly women who are sterilized. Vasectomies are only just 1%! Women
are forced to resort to early sterilization as a family planning method as shown in the Panchayat level
status studies conducted by KILA and Sakhi in 2005-06. The high level of hysterectomies is another
matter which has lasting implications. Women from poor and marginalized communities do not get
adequate care and rest after their deliveries leading to complications in later life.
14.251 Unhealthy life styles and physical inactivity place women at high risk and conditions like blood
pressure, diabetes, obesity and heart diseases are becoming major killers. Results from various stud-
ies indicate that not only more women in the State are growing obese, they are also suffering from
related complications such as elevated lipid and blood sugar levels and hyper tension that put them at
high risk of coronary events. According to [Link], Professor of Cardiology, SCTIMS quoted
in a report in The Hindu (7/10/11) the ratio of men to women admitted to intensive care units with heart
attacks was 24:1 in 1967 and in 1990 this ratio declined to 9:1 and shockingly in 2010 it is 4:1. The
Economic Review 2011
474
single most common reason attributed is the absolute lack of physical activity among women.
14.252 The high incidences of breast cancer and gestational diabetes among women in Kerala are
another indicator of life style changes. Breast cancer incidence which was 8 per one lakh population
in1985 has, increased to 32 per one lakh population in 2010. Other areas of concern are anemia
among pregnant women and obesity among women. Almost 30% of women are obese and around
12% are underweight. So Kerala has this double burden of obesity and low weight among women,
both of which require special attention.
14.253 Sexual health is an area which is shrouded in mystery, feeling of shame and is a taboo to talk
about in all sections of society, especially among the marginalized. Women are not able to speak
out about sexually transmitted diseases and seek treatment. With large scale migration from Kerala,
several problems arise. The public health system should be equipped to deal with this. Lack of clean
toilets with water and waste disposal facilities in schools, public offces and other public places contin-
ues the local authorities. Occupational illnesses, lung infections, back pain, prolapsed uterus (women
in peeling sheds), and allergy among cashew workers-- need to be addressed.
Mental health
14.254 Many women are becoming prey to depression and suicidal tendencies. Economic struggles
within households, mental and physical violence at home, dowry related harassment, issues related
to sexuality etc are contributory factors. During the last seven years the number of suicides in Kerala
was the highest in India. The numbers of men who commit suicide are higher than that of women but
the number of women who fail in attempts to commit suicide is higher. The results of the multiple re-
gression analysis reported in the paper by Mukhopadhyay, Basu and Rajan demonstrate fairly stable
statistical associations between a patriarchal gender ideology and higher levels of mental stress and
anxiety. What comes out strongly from the data is that the level of mental distress is fairly high in Kerala
for both men and women, and also that it is consistently higher for women as compared to men. The
women in the survey sample also appear to subscribe to patriarchal ideology to a greater extent than
the men. What is most interesting is the result that subscribing to a patriarchal gender ideology is a
much more potent (statistically signifcant) explanation for mental stress in women than it is in men.
Violence against women in Kerala (VAW)
14.255 Violence Against Women is the immediate and most visible indicator of womens powerless-
ness in gender relationships. A large number of studies and evidence point out to extensive violence
on women in all age groups-physical, sexual, mental and economic violence inficted at home, in public
and work places. It is to be remembered that violence or threat of violence keeps women in place,
and acts as a powerful deterrent dissuading women from crossing the socially ordained boundaries
of good womanhood. This tells us that all is not so right about the high status of women that Kerala
boasts about.
14.256 It is also important to note that high incidence of domestic violence and crimes against women
co-exists with high female literacy levels which raises questions about the content and process of
education and whether education leads women to internalize the patriarchal ideology.
14.257 Studies have shown that there is a rising trend in violence against women in multiple forms
domestic violence, rape, traffcking, child abuse, sexual harassment at the workplace, and harassment
and lack of safety in public places and while traveling. Reports of the Crime Records Bureau indicate
that crimes against women have actually doubled between 1995 and 2010. If we take into consider-
ation the unreported cases and those complaints that are brought before the Womens Commission,
this increase will be manifold. It must be also noted that most of the violence directed against women
is not reported which means that the actual incidence of violence is much higher
Kerala State Planning Board
475
Education and unemployment
14.258 Rate of enrolment of women in professional and technical institutions is comparatively low.
Admissions in Government ITIs cover only 28.93% women students; Polytechnics 36.49% women
students, and in Engineering it is 30%. Girls from adivasi, dalit, fshing and minority communities are
still lagging in education.
14.259 The unemployment rate among the youth is Kerala is exceedingly high and this is particularly
true among young females. It was 45.8 percent in rural areas (as against 32.3 percent for young
males) and 50.4 percent in urban areas (as against 26.6 percent young males) as per census 2001.
On 43,42,267 registered job seekers as on September 2011, on the live register of Employment Ex-
changes in Kerala; 25,67,558 (59.13%) are females, Kerala appears to be caught up in a high literacy
low skill trap. A number of women job seekers are forced to take up employment in vocations with
very low skills in the service sector.
Women in Governance
14.260 To measure womens empowerment, Gender Empowerment [Link] (GEM) takes 3
indicators, womens participation in economic, political and professional activities. Within political
power what is measured is mainly women in parliament, judiciary or in local bodies. It is also now
often pointed out that womens empowerment must be seen as a process where in we must consider
womens awareness, consciousness, choices with live alternatives, resources at their disposal, voice,
agency and participation. These are all related to enhancement of womens capabilities and decisions
they take individually or collectively for themselves. Women representation is limited and inadequate
in political parties, trade unions and in other positions of political power as well as in decision making
processes in professional bodies. Among members of the legislative assembly, only 5% are women.
Kerala has twenty members in the Parliament out of which the number of women is zero!. Women
representation both in mass organizations and high level committees of political parties is negligible.
It is only because 50% representation for women was made mandatory to local governments, that we
see so many women in local governance.
Increase in number of women headed households
14.261 The number of female headed households (excluding those working in Gulf countries) in Kera-
la is greater than the national average. While the national average is 8%, in Kerala it is 22%as per cen-
sus 2001. These include widows, single women, and abandoned/separated women. The increasing
unemployment of young educated men and the decline of the traditional sectors have increased the
domestic responsibility of women. Special studies should be commissioned to understand the impact
and schemes formulated to support and help such women.
Welfare Schemes for Women in India
Rajiv Gandhi Scheme for Empowerment of Adolescent Girls SABLA
14.262 With the objective to improve the nutritional and health status of adolescent girls in the 11-18
years of age group and empower them by providing life skill education, health and nutrition educa-
tion. Government of India has introduced the Rajiv Gandhi Scheme for Empowerment of Adolescent
Girls-SABLA in November, 2010 in which Kerala is also a part. The focus of the scheme was primarily
on out of school girls. An integrated package of services of Nutrition component and Non Nutrition
component would be provided to adolescent girls. Nutrition component is meant to be provided to
out of school girls in the age group of 11-14 years and non nutrition to all girls in the age group 14-18
years. For school going adolescent girls in the age group of 14-18 years, the non-nutrition compo-
nent (except vocational training) is proposed to be provided twice a month in school days and four
times a month during the vacations. Emphasize on convergence of various schemes/programmes viz,
Economic Review 2011
476
Health, Education, Youth Affairs, Labour, PRIs etc, is envisaged so as to achieve the desired impact.
14.263 The scheme will be piloted initially in 200 districts across the country. Anganwadi Centre will
be the focal point for delivery of services. In the current fnancial year, rs 328.00 crore have been
released for SABLA upto 28th February, 2011
.
Indira Gandhi Matritva Sahyog Yojana (IGMSY)
14.264 This is a new scheme introduced by Ministry of Women and Child Development for Pregnant &
Lactating (P&L) women keeping in view the need for giving maternity beneft to them so as to compen-
sate partly for their wage loss and at the same time for fulfllment of conditions essential for ensuring
safe delivery and promotion of Infant and Young Child Feeding (IYCF) practices. Thus, the payments
under the scheme will be conditional.
14.265 The scheme is being implemented from 2010-11 in 52 pilot districts across the country. It is a
centrally sponsored scheme under which amount will be given as grant in-aid to State government/
Union Territories. An amount of ` 101.00 crore has been released for IGMSY upto 28th February,
2011.
Financial Assistance and Support Services to Victims of Rape: A
scheme for Restorative Justice
14.266 Rape is one of the most violent forms of crimes against women. The victims of rape suffers
mental and psychological trauma, which must be addressed so that she is able to lead a dignifed and
meaningful life. The Ministry of Women and Child Development has formulated a scheme to Victims
of Rape to provide a helping hand to enable her to cope with the trauma suffered and to tide over her
immediate and long term needs. It is based on the principle of restorative justice and seeks to restore
the affected women to a position of dignity and self confdence and proposes to cover women and
minor girls who are victims of rape. The scheme also envisages the setting up of Criminal Injuries
Relief and Rehabilitation Boards at the District, State and Central levels for consideration of claims
and ensuring effective coordination among all stakeholders. The scheme has been approved by the
Expenditure Finance Committee and is awaiting approval of the Planning Commission.
National Mission for Empowerment of Women
14.267 The objective of the Mission is to empower women socially, economically and educationally
by securing convergence of schemes/programmes of different Ministries/Departments of Government
of India as well as State Governments. The Mission is yet to receive the approval of Planning Com-
mission as a centrally sponsored scheme. The key functions of National Mission are in the following
table No. 14.63.
Table No 14.63
Key functions of National Mission for Empowerment of Women
Economic empowerment of women
Convergence of women centric Government schemes
Ensure that violence against women getting eliminated progressively
Ensure social empowerment of women with particular emphasis on health and
education
Oversee gender mainstreaming of programmes, policies, institutional arrange
ments and processes of participating Ministries, institutions and organisations
Undertake awareness generation as well as advocacy activity to fuel the demand
for benefts under various schemes and programmes and create, if required,
structures at district, tehsil and village level with the involvement of Panchayats
for their fulfllment
Source: Annual Report 2010-11 Ministry of Women and Child Welfare
Kerala State Planning Board
477
Protection of Women against Sexual Harassment at Workplace Bill
2010
14.268 The Government introduced the Protection of Women against Sexual Harassment at Work-
place Bill 2010, in the Lok Sabha on 7th December, 2010, which covers the organised and unorgan-
ised sectors and seeks to provide every women, irrespective of her age or employment status (exclud-
ing domestic women workers) a safe and secure environment free from sexual harassment by fxing
responsibility on the employer and laying down a redressal mechanism. The Bill has been referred
to the Parliamentary Standing Committee for its consideration. The Key features of the Bill is in the
table No.14.64
Table No. 14.64
Key Features of the Bill
The Protection of Women against Sexual Harassment at Workplace Bill, 2010 aims at:
Providing protection to women against sexual harassment at all workplaces both
in the public and private sector, whether organised and unorganised and for the
prevention and redressal of complaints of sexual harassment.
Covering women who are employed as well as those who enter the workplace as
clients, customers or apprentices, besides the students and research scholars in
colleges and universities and patients in hospitals.
Laying down the effective complaints & redressal mechanism in the form of Inter
nal and Local Complaints Committees
Source: Annual Report 2010-11 : Ministry of Women and Child Development
Kerala Womens Commission
14.269 The objective of Kerala Womens Commission is to take steps for improving the status of
women and to enquire into unfair practices affecting women and the matters connected therewith on
incident thereto. Hence, all the activities and programmes of the Commission are intended to uplift
their status and for empowering them. The activities of the Commission during 2010-11 is given in the
table14.65.
Table No. 14.65
Activities of Kerala Womens Commission during 2010-11
Conducted 52 Adalats all over the State besides the routine Adalats at Headquar
ters and 2623 petitions were disposed off
47 seminars/workshops concerning various issues on women were conducted
and for empowering them on provisions available.
Provided temporary accommodation to 23 women who are ousted from their own
houses on account of domestic violence or victims of rape
One training programmes for the Jagratha Samithy members of Gramam
Panchayat/Corporation/District Panchayat.
Source: Kerala Womens Commission
14.270 The research studies conducted by the Commission during the period under review is given in
the Table No14.66.
Economic Review 2011
478
Table No 14.66
Research Studies conducted by Womens Commission
Major Studies
Problems of Women agricultural labourers in Kerala and need for a special women
policy
Study on the Socio economic and emotional impact of missing of persons on their
family and the society
Problems of women of the fshing communities in Kerala
Socio economic and cultural problems of the koraga tribes in Kasarsgod district
Minor Studies
Problems of women working in private sector business enterprises
Problems faced by women conductors
Problems arising out of marriages with foreigners
A study on the problems leading to women to shelter homes/Mahila Mandirams and
the impact on their family
Problems of women representatives of Local Self Government Insitutitons.
Problems of women locked up in prisons, convicted or otherwise
Source: Kerala Womens Commission
Flagship Programme
The Commission had constituted a media monitoring cell to evaluate the indescent representation
of women in Medias. During this year Commission held one meeting of this cell and reconstituted
the Cell. The Commission also gathered opinion of the public about the indescent representation of
women in advertisements as part of steps meant for action against it.
The Commission has made advertisement through Onam Specials of some leading Newspapers
and journals to make awareness among public especially women regarding the misuse of mobile
phones, functioning of J agratha Samities attached to Local Self Government Institutions, functioning
of Womens Commission, Dowry etc.
The Commission has started Pre-marital Counseling since a number of petitions are being received
in the Commission from newly married couples alleging and fnding fault with each other. Now Pre-
marital Counseling is available on all the working days at the Head Quarters of the Commission.
Kerala State Womens Development Corporation (KSWDC)
14.271 The objective of the Kerala State Womens Development Corporation is empowerment of wom-
en through education, training and the creation of vocational opportunities essential for the sustained
growth of the literate women of Kerala. It also focuses on promoting activities that recognizes the
aspirations of young women for establishing their position in society. The priorities of the Corporation
are given in the Box 7
Kerala State Planning Board
479
Box 7
Priorities of the Corporation
Enabling womens access to economic empowerment and opportunities,
especially for those who are most excluded with training, assistance and
allocation of resources
Providing marketing & technical assistance to small scale women entrepreneurs
to develop their production and marketing skills
Strengthening aspiring girls and womens employable skills to explore the
opportunities through degree, diploma and certifcate programme via Finishing
Schools
Focusing awareness programme at school and college level to build up a strong
foundation for making a healthy society
Advocating Gender Equality and Updating Womens Right by encouraging
womens leadership and participation in all areas that affect their lives
Prevention of Violence against women and girls and the expansion of the access
to survivor services
Ensuring overall personality development of women to help to improve their
esteem and bring them to the mainstream of community development project
Source: Kerala State Women Development Corporation
14.272 As a part of the broad training initiatives that are undertaken by the Corporation, the focus
on women empowerment in terms of technology and non technology skills. Training has been given
to 1016 benefciaries with 75% placements. In addition, a training programme of Post Graduation
diploma in banking operation has been given to 44 benefciaries with 100% placement assistance
programme with provisional appointment letter at the time of enrolment
14.273 KSWDC started its job oriented training programme REACH (Resource Enhancement Acad-
emy for Career Heights) provides a professional outlook to women to cope with the changing scenario
of globalised world. REACH is bringing out women with potential to move from informal to formal
situations by evaluating the situation they are faced with and knowing what is appropriate for them.
Two REACH centers are working at Thiruvananthapuram and Kannur concentrates on providing J ob
Oriented Training to young girls with +2 or Degree based on education level.
14.274 KSWDC has associated with Darpana Academy of Performing Arts of Dr Mallika Sarabhai
for the implementation of the project. Darpana has produced a short flm Unarthupattu based on
sensitive gender issues and the flm was screened in 40 Womens colleges followed by an interactive
seminar by Dr. Sarabhai.
Crime against Women
14.275 Although Women may be victims of any of the general crimes such as Murder, Robbery,
Cheating etc, only the crimes which are directed specifcally against Women are characterised as
Crime Against Women. Various new legislations have been brought and amendments have been
made in existing laws with a view to handle these crimes effectively. These are broadly classifed
under two categories
(1) The Crimes under the Indian Penal Code (IPC)
(i) Rape (Sec. 376 IPC)
(ii) Kidnapping & Abduction for specifed purposes (Sec. 363 - 373 IPC)
(iii) Homicide for Dowry, Dowry Deaths or their attempts (Sec. 302/304-B IPC)
(iv) Torture - both mental and physical (Sec. 498-A IPC)
(v) Molestation (Sec. 354 IPC)
(vi) Sexual Harassment (Sec. 509 IPC)
Economic Review 2011
480
(vii) Importation of girls (upto 21years of age) (Sec. 366-B IPC)
(2) The Crimes under the Special & Local Laws (SLL)
14.276 Although all laws are not gender specifc, the provisions of law affecting women signifcantly
are being reviewed periodically and amendments carried out to keep pace with the emerging require-
ments. The gender specifc laws for which crime statistics are recorded throughout the country are
(i) Immoral Traffc (Prevention) Act, 1956
(ii) Dowry Prohibition Act, 1961
(iii) Indecent Representation of Women (Prohibition) Act, 1986
(iv) Commission of Sati (Prevention) Act, 1987
14.277 A total of 2,13,585 incidents of crime against women (both under IPC and SLL) were reported
in the country during 2010 as compared to 2,03,804 during 2009 recording an increase of 4.79%
during 2010. In India, Andhra Pradesh, accounting for nearly 7.1% of the countrys population, has
accounted for 12.8% of total crimes against women in the country by reporting 27,244 cases. West
Bengal with 7.6% share of countrys population has accounted for nearly 12.2% of total crime against
women by reporting 26,125 cases in 2010. The crime against women for the year 2010 is given in the
Table No.14.67.
Table No.14.67
Crime against women in India 2010
[Link] Crime
Case
Report-
ed
% to
total IPC
Crimes
Rate of
crime
Charge
sheet-
ing rate
Con-
vic-
tion
Rate
1
Kidnapping & Abduction of
Women and Girls
29795 1.3 2.5 74.2 28.1
2 Molestation 40613 1.8 3.4 96.7 29.7
3 Sexual Harassment 9961 0.4 0.9 96.7 52.0
4
Cruelty by Husband and
Relatives
94041 4.2 7.9 94.2 19.1
5 Importation of Girls 36 0.0 0.0 90.6 20.0
Total Crime Against Women 213585 9.6 18.0 92.0 27.8
Source: Crime in India, 2010
14.278 The District wise reported cases of crimes against women in Kerala for the year 2010 are given
in Table 14.68.
Table No.14.68
The District wise reported cases of crimes against women in Kerala for the year 2010
[Link] Districts Rape
moles-
tation
Kidnap-
ping
Eye
teasing
Dowry
Death
Cruelty
by Hus-
band/
Rela-
tives
Other
Offences
1 Thiruvananthapuram 76 392 9 34 0 284 34
2 Kollam 40 225 13 12 0 287 22
3 Alappuzha 23 215 8 19 0 156 17
4 Pathanamthitta 21 89 6 13 0 69 7
Kerala State Planning Board
481
[Link] Districts Rape
moles-
tation
Kidnap-
ping
Eye
teasing
Dowry
Death
Cruelty
by Hus-
band/
Rela-
tives
Other
Offences
5 Idukki 21 75 4 15 0 130 9
6 Kottayam 19 124 7 46 1 164 16
7 Eranakulam 35 103 7 37 1 166 137
8 Thrissur 33 169 14 42 1 297 208
9 Palakkad 46 70 3 11 2 2190 22
10 Malappuram 35 116 7 18 0 340 116
11 Kozhikode 34 160 13 72 0 245 146
12 Wyanad 45 33 4 3 0 68 108
13 Kannur 12 62 1 14 1 178 155
14 Kasaragod 96 50 5 6 0 105 112
15 Railways 0 13 0 5 0 0 0
Total 546 1816 101 347 6 2679 1109
Source: State Crime Records Bureau, Thiruvananthapuram
14.279 The Details of Crime against women (IPC) towards total IPC crimes during the last fve years
is given in the table No.14.69
Table No 14.69
Proportion of Crime against Women (IPC) towards total IPC crimes
Sl.
No
Year
Total IPC
Crimes
Crime Against
women (IPC
cases)
Percentage
to total IPC
crimes
1 2006 18,78,293 1,54,158 8.2
2 2007 19,89,673 1,74,921 8.8
3 2008 2093,379 1,86,617 8.9
4 2009 21,21,345 2,03,804 9.2
5 2010 22,24,831 2,13,585 9.6
Source: Crime in India, 2010
Crime Rate
14.280 The rate of crime has increased marginally from 17.4 during the year 2009 to 18.0 during
2010. Tripura reported the highest rate of crime against women at 46.5 during 2010. The crime wise
details of reported crimes during 2006 to 2010 along with percentage variation are given in the table
No. The crime against women has increased by 4.8% over 2009 and by 29.6% over 2006. The IPC
component of crimes against women has accounted for 96% of total crimes and the rest 4% were SLL
crimes against women. The proportion of IPC crimes committed against women towards total IPC
crimes has increased continually during last 5 years from 8.2% in 2006 to 9.6% during 2010. Table
No. 14.57 shows crime wise incidents of crime against women during 2006-10 and percentage varia-
tion in 2010 over 2009.
Economic Review 2011
482
Table No14.70
Crime wise Incidents of Crime Against Women during 2006-10 and Percentage variation in
2010 over 2009
Sl.
No
Crime Head 2006 2007 2008 2009 2010
Percent-
age
variation
in 2010
over
2009
1. Rape (Sec 376 IPC) 19,348 20,737 21,467 21,397 22,172 3.6
2.
Kidnapping and Abduction(Sec
363 to 373 IPC)
17,414 20,416 22,939 25,741 29,795 15.7
3 Dowry Death(Sec 302/304 IPC) 7,618 8,093 8,172 8,383 8,391 0.1
4 Torture (Sec 498 A IPC) 63,128 75,930 81,344 89,546 94,041 5.0
5. Molestation(Sec 354 IPC) 36,617 38,734 40,413 38,711 40,613 4.9
6.
Sexual Harassment(Sec 509
IPC)
9,966 10,950 12,214 11,009 9,961 -9.5
7.
Importation of Girls(Sec 366-B
IPC)
67 61 67 48 36 -25.0
8 Sati Prevention Act ,1987 0 0 1 0 0 -
9.
Immoral Traffc Prevention Act
1956
4,541 3,568 2,659 2,474 2,499 1.0
10.
Indecent Representation of
Women (Prohibition0Act 1986
1,562 1,200 1,025 845 895 5.9
11 Dowry Prohibition Act, 1961 4,504 5,623 5,555 5,650 5,182 -8.3
Total 1,64,765 1,85,312 1,95,856 2,03,804 2,13,585 4.8
Source: Crime in India 2010
Women Health Care Centre - Seethalayam
14.281 Seethalyam is a gender based scheme launched in 2010-11 towards empowering womens
mental, physical and social health. The objective of the project is to provide aid to suffering women
in the society. The majority of women are facing physical and mental torture in domestic and social
environment. More than treatment Seethalaym is committed to provide multi-dimensional supports
from the Social and Family Welfare Departments, State Womens Commission, Home department etc.
14.282 Two lady Med ical Offcers, one lady counselor, one pharmacist, one attender and one DTP
Operator are there in the three centres of Seethalayam. The Seethalayam centre at Thiruvanantha-
puram has rendered service to 107 clients and conducted 6 public awareness programmes during the
period under review. The Seethalaym centre at [Link] hospital Kurichy, Kottayam has
rendered service to 40 female clients, 6 male clients and conducted 3 public awareness programmes.
The Seethalayam Centre at District Homoeo Hospital, Eranjickal, Kozhikode has rendered service to
330 female clients, 6 male clients and conducted 8 awareness programmes during the period.
Kudumbasree
14.283 Kudumbasree which means prosperity of the family, is the name of women oriented, com-
munity based, State Poverty Eradication Mission of Government of Kerala. The mission aims at the
empowerment of women, through self help group formation and encouraging their entrepreneurial
or other wide range of activities and to ensure that the women should no longer remain as passive
recipients of public assistance, but active leaders in women involved development initiatives. The eco-
Kerala State Planning Board
483
nomic marginalization of women in the development process has drawn considerable attention during
recent years. While the female work participation rate in India increased from 19.7 % between 1981
and 1991, in Kerala the ratio declined from 16.6% to 15.9% during the same period. The incidence of
unemployment among females in the State is higher than that among males by 5 times in rural areas
and 3 times in urban areas. Unemployment in Kerala is severe and is estimated to be 3 times larger
than of India.
National Employment Services
14.284 As a part of Gender Budgeting, the National Employment Services (Kerala) has introduced
a new scheme SARANYA, a self employment scheme for registered Widows/Deserted/Legally Di-
vorced/Unwedded mothers/Unmarried women above 30 years was approved by the government. An
amount of ` 80.00 lakh was estimated for the schemes for 2010-11 which was fully utilized for 197
benefciaries by using loan and subsidy. Interest free self employment loan subject to a maximum of
` 50000/-with a subsidy of 50% of loan amount is granted to eligible benefciaries under this scheme.
During 2011-12 an amount of ` 79.07 lakh was spent on women development initiative under the
scheme SARANYA.
Social Welfare Department
14.285 Besides being the nodal agency for implementing the provisions of Domestic Violence Act,
2005, including widespread gender awareness programmes, several programmes for women have
been implemented by Social Welfare Department, and they are enlisted below.
Media Campaign for Gender Sensitization in Domestic Violence Act and other Social Legislations
through print, audio and visual media
Imparted training to all stakeholders including Police Offcers and Judicial Offcers and capacity
building programmes to Protection offcers
Twenty three institutions including 15 governmental institutions are recognized as Shelter Homes.
The service of Legal Counselors and Clinical psychologists are provided through these Homes and 60
service providing centres functioning
Launched a Web Portal Kerala Women-exclusively for women Flagship programme of Finishing
School for women the women who posses degree or diploma, but lack the soft skills to secure a job
are given training. In addition to this, job oriented training is given through STED to enable the women
inmates to make productive use of their time and income.
Innovative schemes giving more emphasis to awareness creation regarding HIV/AIDS and reha-
bilitation of HIV positive women, physically handicapped persons, Women prisoners, Women headed
families and Widows who face discrimination are being implemented
For HIV affected, the need for nutrition support is very high. A new scheme Nutrition Supplement for
HIV affected Women & Children, is implemented to improve the health status of HIV infected individu-
als and also helps retard the progress of the disease. 2800 women and children have registered in
Anti-Retro Vital Therapy(ART) clinics and link ART clinics run by Kerala Aids Control Society are being
provided nutritional supplement.
Financial assistance was given to the children of prisoners who became semi orphans following the
imprisonment of the parents. An amount of Rs 500/- per month is given to the children as an assis-
tance for their education, transportation, clothing, food etc and continued upto graduation. The money
is credited into the joint account of the child and the care taker.
Mangalya is a scheme implemented by the Department for the widows below 50 years of age by
providing a fnancial assistance of Rs 25000/- to those who propose to remarry. The benefciaries are
selected with the help of local bodies and 172 widows have been selected for assistance under the
scheme during 2010-11
The Scheme is to provide fnancial assistance of Rs 1000 for the marriage of physically handicapped
girls and daughters of physically challenged couple hailing from fnancially poor families whose family
annual income is below Rs 36000. During 2009-10 340 girls and 2010-11 96 girls beneftted by this
Economic Review 2011
484
scheme.
Institutional Services for Women
Mahila Mandirams :- There are 12 mahila mandirams functioning in the State. Widows, deserted,
divorced and destitute women above 13 years are admitted in the institutions. Children with their
mothers are allowed to stay in the institutions upto the age of 6 years. Women will also be admitted in
the institution on the direction of District Probation Offcer, Police Offcials, and Courts.
Rescue Homes: - Rescue Homes are maintained to provide care and protection to women who are
guilty of immoral traffcking and women prone to danger. They provide rehabilitation facilities to bring
them back to mainstream. Rescue Home is functioning at Thavanoor in Malappuram
After Care Homes: - After Care Homes are for women released from institutions such as Childrens
Home, Poor Homes, Rescue Homes and Orphanages. Women between the age of 18 to 21 are ad-
mitted.
Short Stay Home: - This home is for the temporary shelter and rehabilitation of women who have no
social support system due to broken families, mental strains, social ostracism, exploitation or moral
danger. The woman can be admitted voluntarily and can continue their education or engage in voca-
tional training. They shall be released to their relatives or transferred to other institution if a longer stay
is needed. There is one short stay home in Kozhikode.
One day home :- This institution is for Women who come from other places to cities such as Thiru-
vananthapuram, Kochi and Kozhikode for various purposes such as writing tests, interviews or attend-
ing meetings can stay at the one day home for a short period. The rent for a day is Rs 50/- inclusive
of food
Gender Responsive Budget in Kerala
14.286 State has initiated the gender budgeting process at the local government level as far back
in 1998 and mandated the local bodies to allocate at least 10 % of the plan funds devolved by the
State specifcally for women (Women Component Plan). Over the years, this process helped the lo-
cal governments to understand the specifc issues of women through studies on status of women and
then refect some of these needs in the planning process. By and large, the mandatory allocation
for women addressed the economic empowerment of women through Self Help Groups (SHGs) and
through income generation programmes under the poverty eradication mission for Kerala Government
the Kudumbasree. 15-20 % of Local Governments (LGs) has undertaken, studies on the status of
women (Jaagratha samithis), specifc health and sanitation problems, focus on skill development etc.
14.287 During the Eleventh Five Year Plan the State has taken certain initiatives in terms of women
targeted schemes (gender responsive) through Flagship programmes in the 11th plan. These are the
(1) gender awareness programmes including the implementation of protection of women from domes-
tic violence act (2) and fagship programme on fnishing schools for women (to enhance employability
of women through skill training).
14.288 In the Budget 2010-11, gender audit of only the above two programmes were made, and there-
by more funds were allocated. The total outlay earmarked for women accounted for only 5.5% of the
total State Budget outlay in 2008-09, which increased to 8.5% in 2010-11. State wise Budget allocation
for schmes solely for the beneft of women (100%) is detailed in the Table No. 14.71
Kerala State Planning Board
485
Table No.14.71
State Budget allocation for Schemes solely for the beneft of women (100%
)
Year
Budget Allocation
(Rs Crore)
% of total
allocation
2008-09 318.69 5.5
2009-10 367.69 5.6
2010-11 620.97 8.5
Source: Budget Speech 2010
FOOD SECURITY
Public Distribution System (P D S)
14.289 Public Distribution System is very relevant for the State, where there is more than 75% defcit
in food grain production. Only 15% of the food grains required is produced here and the rest is met
from other States like Tamil Nadu, Andhra Pradesh, Madhya Pradesh, Bihar, Gujarat etc. The Public
Distribution System came into existence in the State from 1-7-1966 with the implementation of Kerala
Rationing Order, 1966. The coverage of ration population is nearly hundred percent.
14.290 The prime objective of the Civil supplies Department is to run the Public distribution System
in an effective manner and to ensure that rationed articles are made available to consumers at subsi-
dized prices fxed by the Government. The department is also responsible for ensuring availability of
essential commodities in the market at reasonable prices as well as to prevent unfair trade practices
like hoarding, undue profteering and black-marketing
Box. 14.8
Fair shops in Kerala
The Central Norm of one Fair price shop for 2,000 population has already been achieved in
Kerala and normally no card holders here need travel more than 2 Kilometer to reach his fair
price shop even in the remotest area. However, new fair price shops are being opened mostly
in tribal and hilly areas as and when found necessary reviewing the needs of the people of the
locality and giving preference to Co-operative sector/women/unemployed rural youth/SC/ST.
(Source: Department of Civil Supplies)
14.291 The Civil Supplies Department has to administer a PDS that caters to the needs of 76,28,656
ration cardholders (as on August 2011) by making available rationed articles at subsidized price
through a network of 332 Authorized Wholesale Dealers, 286 Kerosene Wholesale Distributors and
14,265 Authorized Retail Dealers. Table 14.72 shows the Public Distribution Profle of Kerala from
2006-07 to 2010-11.
Salient features
14.292 The Targeted Public Distribution system (TPDS) in the State has been implemented with effect
from 01.06.1997 as decided by the Govt. of India. Accordingly families under APL and BPL categories
have been identifed, distinctive ration cards under each category have been issued and food grains
distributed to the families under each category at different prices.
14.293 As per the latest fgures, out of the 76,28,656 cardholders in the State, 55,71,568 families are
APL, 14,61,988 families are BPL and 5,95,100 families are AAY scheme. Food grains are allotted by
the Government of India for distribution to AAY cardholders @ 35 Kilograms and for BPL cardholders
@ 25 Kilograms per month. During the year 2011 upto August, 1,11,410 MT of wheat and 8,29,682
Economic Review 2011
486
MT of rice has been distributed through Public Distribution System in Kerala. Month wise distribution
of rice and wheat in metric tonnes under PDS from 2006 to 2011(up to August) is given in Appendix
14.47. Food grain distribution through ration shops from April 2010 to March 2011 is given in Appendix
14.48. District wise distribution of rice and wheat to BPL and APL families under PDS during 2011 is
given in Appendix 14.49. Retail prices of commodities issued through ration shops during 2011 are
shown in Table 14.73
Table 14.72
Public Distribution system in Kerala Profle 2006-07 to 2010-11
Sl.
No
Items Unit 2006-07 2007-08 2008-09 2009-10 2010-11
1
No. of Ration Cards and Per-
mits
a) Ration cards for families as
on 1st April
No. 6986017 7025638 7034886 6835945 7340488
b) Ration permits for institution
as on 1st April
,, 14101 13330 10952 8709 7603
2
No. of FCI Sub Depots as on
1st April
,, 20 20 22 22 22
3
No. of Wholesale shops as on
1st April
a) Co-operatives
,, 34 36 35 25 36
b) Supply co ,, 10 10
c) Others ,, 302 302 301 300 288
d) Total Wholesale shops ,, 336 338 336 335 334
4
No. of Retail shops as on Ist
April
a) Co-operatives
,, 509 472 425 423 419
b) Others ,, 13702 13776 13819 13816 13833
c) Total Retail shops ,, 14211 14248 14244 14239 14252
5 Sugar (Allotted) MT 56050 57236 49236 49338 49362
6 Bale oil (Allotted) MT
7 Kerosene (Allotted) KL 277966 277988 277968 277944 225096
Source: Directorate of Civil Supplies
Table 14.73
Retail Price of Commodities issued through Ration Shops during December 2011
Sl. No. Items Price Rs./Kg.
1
RICE
APL Card holders 8.90/2.00
BPL Card holders 1.00
2 AAY Card holders 1.00
3 Annapurna Scheme Free of cost
Kerala State Planning Board
487
Sl. No. Items Price Rs./Kg.
4
WHEAT
APL Card holders 6.70/2.00
BPL Card holders 1.00
5
SUGAR BPL Card
holders
13.50
6 KEROSENE/Litre 14.50 to 15.00
Source: Directorate of Civil Supplies 2011
Scheme for Issue of food grains at `.2/-per Kg
14.294 During 5/09, State Government have launched a new scheme for issue of food grains @ Rs.
2/Kg. to all BPL/AAY card holders and to SC/ST, Fishermen, Ashraya families holding APL cards. Dur-
ing 6/10, the scheme was further extended by including APL cardholders under unorganised sector
also. In 25th J anuary, 2011 the Govt. of Kerala approved the scheme for providing food grains (Rice
& Wheat) @ Rs. 2/Kg. to all cardholders subject to certain conditions. As per the revised scheme all
ration card holders except the following families are entitled to the beneft of the scheme Rs. 2 per Kg.
1. Those families having more than 2.5 acres of land.
2. Those having more than Rs. 25,000/- monthly income.
3. Those having house of more than 2,500 sqft area.
Scheme for Issue of Rice @ `.1/- to BPL/AAY Families
14.295 The scheme of issuing Rice @ Re.1/-per Kg. has been implementing in the State since 1st
September 2011. As per this scheme all AAY cardholders will get 35 Kg. of Rice per month @ Re.1/-
per Kg and all BPL card holders other than AAY benefciaries will get 25 Kg. of Rice per month @
Re.1/- per Kg. The inmates of Government approved orphanages will also get Rice @ Re.1/- per Kg.
Subsidy amount required for meeting the expenditure under these scheme is furnished below in Table
14.74
Table 14.74
Subsidy amount required for implementing the scheme distribution of food
grains @ `.1/- & `. 2/-
Item
[Link] Benef-
ciaries In lakh
Quantity Al-
lotted in MT
(per month)
Rate of subsidy
per MT(Rs)
Subsidy
needed per
month (3 X 4)
(Rs. Lakh)
(1) (2) (3) (4) (5)
[email protected]/- 14.62 36,008 5200 1872.42
BPL-Wheat@ Rs.2/- 14.62 9438 2700 254.83
AAY- Rice @ Re.1/- 5.96 20,855 2000 417.10
APL Rice (Subsidy) @
Rs.2/-
42.8 38,416 6900 2650.70
APL Wheat (Subsidy) @
Rs.2/-
42.8 9937 4700 467.04
TOTAL 5662.09
Annual Requirement 679,45.02
Source: Directorate Civil Supplies
Economic Review 2011
488
National Food Security Act
14.296 The Government of India has decided to implement National Food Security Act in the country to
ensure food security for all citizens. The National Food Security Bill proposes to classify people as Pri-
ority households and General households. The Central Government may, from time to time prescribe
the guidelines for identifcation of Priority households, General households and exclusive criteria for
the purpose of entitlement. Every person belonging to Priority households shall be entitled to receive
7 Kg. of food grains per person per month and General householders entitled to not less than 3 [Link]
food grains per person per month at subsidised prices. The entitlement of priority category and general
category shall extend upto 75% of rural population and 50% of urban population
Anthyodaya Anna Yojana Scheme (AAY)
14.297 This scheme for distributing 35 Kgs of rice to the poorest of the poor families under BPL per
month, is being implemented since 25.02.2001. The number of benefciaries under the scheme was
initially fxed by the Government of India as 2,38,200 (15.33% BPL families). As part of tribal wel-
fare measures, all the eligible tribal families have been included under the scheme as per G.O. (Rt)
No.2853/2001/LSGD dated 13.09.2001. As decided by the Govt. of India during 2003 the number of
benefciaries under the Scheme has been enhanced to 3,57,400. As part of further expansion of the
scheme, the Government of India has enhanced the target to 5,95,800 (1,14,400 during 2nd phase
expansion and 1,24,000 during 3rd phase expansion). On completion of the 2nd and 3d phase of
expansion the Government of India is allotting 20,855 MTs of rice per month at the rate of Rs. 3/- per
Kg. The State Government is meeting the expenses towards transportation and handling charges. The
expenditure on this account comes to around `12 crore per year.
Annapoorna Scheme
14.298 The scheme initiated since February 2001 is meant for distributing 10 Kg. of rice per month
free of cost to the destitute who are of and above the age of 65 years. The Government of India has
fxed the target as 44,980 individuals, being 20% of persons who are eligible for national old age
pension but not getting the pension. From 2002-03 onwards the scheme has been transferred to the
State. For implementing the scheme, an amount of Rs.334 lakh is required, out of which Rs.280 lakh is
central Government share and Rs. 54 lakh State Government Share. Table 14.75 shows District wise
distribution of food grains under AAY & ANP schemes for the year 2010-11. Monthly distribution of food
grains under AAY & ANP Schemes is given in Appendix 14.50
Table 14.75
District wise Distribution of Food Grains under AAY and ANP Schemes 2010-11
[Link]
RICE (in Mt)
AAY ANP
Name of
District
Allot-
ment
Lifting Off-take
% of
off-take
against
allot-
ment
Allot-
ment
Lifting
Off-
take
% of
off-take
against
allot-
ment
1 TVPM 27540 27540 28034 102 380 380 404 106
2 Kollam 21565 21565 22443 104 236 236 202 85
3 PTA 10843 10843 11426 105 259 259 297 115
4 Alappuzha 19347 19347 18746 97 126 126 140 111
5 Kottayam 14958 14958 15261 102 207 207 218 106
6 Idukki 13916 13916 13326 96 125 125 136 109
7 Ernakulam 16896 16896 17249 102 338 338 317 94
Kerala State Planning Board
489
[Link]
RICE (in Mt)
AAY ANP
Name of
District
Allot-
ment
Lifting Off-take
% of
off-take
against
allot-
ment
Allot-
ment
Lifting
Off-
take
% of
off-take
against
allot-
ment
8 Thrissur 24274 24274 24849 102 156 156 150 96
9 Palakkad 20626 20626 20529 100 270 270 308 114
10 Malappuram 23387 23387 23410 100 390 390 307 79
11 Kozhikode 17281 17281 18094 105 289 289 251 87
12 Wayanad 15675 15675 16321 104 279 279 286 102
13 Kannur 15467 15467 15684 101 254 254 276 109
14 Kasaragod 8485 8485 8954 106 291 291 290 100
TOTAL 250260 250260 254327 102 3600 3600 3581 99
Source: Directorate of Civil Supplies 2011
14.299 At present then number of Annapoorna card holders is only 33709. The main problem of the
implimenting the scheme is fnding up of benefciaries. In Kerala almost all the people are covered un-
der any of the pension scheme. No one will forgo pension for 10Kg. of rice per month. Eligibility criteria
for indentifing Annapoorna benefciaries at to be relased so us to inclued more people in this scheme.
Issue of ration cards to families without house number
14.300 With the objective of bringing all the families under TPDS and to ensure food security, it has
been decided to issue ration cards to all families residing without house number on the strength of
residential certifcates issued by the member concerned of local bodies. Issue of renewed ration cards
affxing photo of head of family with laminated cover pages and barcode was completed by 31-3-2010.
Thereafter, applications for new ration cards have been accepted. Facility for submission of online
application for ration card also started with effect from 2-9-10.
Central Allotment of Sugar and Kerosen
14.301 Central allotment of sugar was restricted to BPL card holders alone from February 2001 on-
wards. During the year 2011-12 the allotment of sugar to Kerala was 20,567.50 MT (up to August
2011). In the case of Kerosene the central allocation to the State is reducing year by year. During the
year 2010-11 the allotment of Kerosene to Kerala was 2,25,096 KL (up to August 2011). Monthly dis-
tribution of Sugar and Kerosene from 2006-07 to 2010-11 is given in Appendix 14.51
Economic Review 2011
490
Fig.14.13
Source: Civil Supplies Corporation 2011
Fig.14.14
Source: Civil Supplies Corporation 2011
Kerala State Civil Supplies Corporation
14.302 The Kerala State Civil Supplies Corporation (SupplyCo) was set up in the state in 1974 with
a mission of food security for Kerala and acts as a second line of PDS in the State by distributing
essential commodities like rice, sugar, pulses and spices at reduced prices through a network of 3063
outlets spread all over the State. Prices of essential items distributed by SupplyCo, on an average, is
30% to 60% less than open market prices. The intervention of SupplyCo in the market in respect of
essential commodities is of immense relief to the people of the State. The number of customers visiting
the SupplyCo outlets, which was 52 lakh in 2006 has gone up to above one crore per month during
Kerala State Planning Board
491
2009-10. As per the SupplyCo report, the number of outlets has increased from 2997 in 2009-10 to
3049 in 2010-11 (See Table 14.76)
Table 14.76
Details of Outlets under the SUPPLYCO from 2006-07 to 2010-11
[Link] Outlets 2006-07 2007-08 2008-09 2009-2010 2010-2011
1 Maveli Stores 874 865 847 858 889
2 Super Markets 236 262 313 335 347
3 Peoples Bazar 2 10 13 13
4 Medical Stores 53 72 90 92 92
5 Petrol Bunks 11 11 12 13 13
6 LPG Outlets 3 3 3 3 3
7 ARD Sabari Stores 1636 1659 1672 1672 1672
8 Mobile Maveli Stores 8 8 17
9 Premium Stores 0 1 1
10 Hyper Markets 0 1 1
11 Apana Bazar 0 1 1
Total 2813 2874 2955 2997 3049
Source: Directorate of Civil Supplies 2011
Box 14.9
Electronic Purchase For SupplyCo
From the year 2007-08, the Corporation has been implementing a system of e-purchase
based on transportation model of linear programming. The system ensures total transpar-
ency, fairness and the least cost for purchases. Under the system there is no need for
physical submission of tender by the suppliers. Any person or frm or company interested in
making supply to the Corporation can access the web site from any corner of the world, fll
in the online tender which prevents any physical contact with the staff of the Corporation.
In order to prevent the binami persons applying, digital signatures are insisted upon along
with the bank details.
The Earnest Money Deposit and Security Deposit can also be made online. The selec-
tion of suppliers is made automatically by the computer software which leaves no scope for
any arbitrariness in deciding the supply source. The receipt of goods is also entered in the
computer and posted to Head Offce online by all depots. This prevents any delay on the
part of depots at the delivery points.
The payment to suppliers is also made through RTGS/NEFT directly into the bank ac-
counts. Also there is an integrated scientifc inventory management system with e-purchas-
es to ensure optimum level of stocks at all times.
The impact of the reforms is obvious from the four fold increase in turnover and the Cor-
poration is earning proft for the frst time in its history. All the depots have been converted
into proft centres.
Source: Directorate of Civil Supplies, 2011
14.303 The sales turnover of the Corporation during 2010-11was Rs. 2223 crore. It was Rs. 2322
crore in the year ago period. The level of turnover from 2006 -07 to 2010-11 is shown in fgure 14.15
Economic Review 2011
492
Fig.14.15
Source: SupplyCO
14.304 Table 14.77 reveals the proft and loss account of the Corporation from 2006-07 to 2010-11.
While the income accrued from various sources increased from Rs 1,022.91 crores in 2006-07 to Rs
2,264.16 crores in 2010-11, the expenditure also increased from Rs 1,041.35 crores to Rs. 2,256.03
crores. The Corporation earned a proft of Rs.18.25 crore during 2007-08 and it continued in the fnan-
cial year 2008-09 also by accruing a proft around Rs 22.62 crore. Corporation earned a proft of Rs
17.29 crore in the year 2009-10, and Rs 8.13 crore in the year 2010-11
Table 14.77
Proft & Loss account of SupplyCo during the year 2006-07 to 2010-11 (in Rs. Crores)
Name of District 2006-07 2007-08 2008-09 2009-10
2010-11
(Prov)
Income
Sales/[Link] 1,001.60 1,241.36 1,855.31 2,322.09 2222.90
Other Income 8.46 11.01 27.41 42.62 31.48
Increase in Stock in
Trade
12.85 24.95 24.42 46.17 9.78
Total 1,022.91 1,277.32 1,907.14 2410.88 2264.16
Expenditure
Material consumed 143.26 207.71 324.41 564.64 551.09
Purchase of Trading
goods
786.47 908.51 1352.96 1585.06 1455.19
Manufacturing and
other Expenses
106.86 135.88 190.35 226.18 229.45
Interest and Bank
charges
2.15 3.55 13.35 14.26 16.62
Depreciation 2.61 3.42 3.45 3.45 3.68
Total 1,041.35 1,259.07 1,884.52 2,393.58 2,256.03
Proft/(Loss) (18.44) 18.25 22.62 17.29 8.13
Source: Directorate of Civil Supplies 2011
Kerala State Planning Board
493
Box No. 14.10
Achievements of SupplyCo during 2010-11
Extended annual benefts of Rs.375 crores to the consumers of the State.
Sales turnover is Rs. 2223 crores.
SupplyCo holds more than 1 crore potential customers.
For extending the price beneft to more people, 52 outlets including 9 mobile maveli stores
were opened.
Introduced Web based e-paddy procurement of SupplyCo by which the Payments are
made directly to farmers Bank Accounts, with no scope for any middlemen.
Lowest purchase cost in the country is ensured through effcient e-purchase system.
The State is included one among in the list of States where the consumer price index is
the lowest.
Modernized all outlets with computer, electronic weighing scales, etc
Ensured an amount of Rs 150 crores to the Exchequer as various taxes.
Introduced a scientifc inventory, fnancial and purchase management system and seg
mental accounting.
Outlets made customer friendly by introducing a system of returning stocks purchased if
a customer is not satisfed with the quality.
Ensured availability of all items at the optimum requirement through better indenting and
inventory management by fxing economic order quantity, reorder level etc.
Converted supermarkets with sales above Rs. 25 lakhs per month to Peoples Bazaar
to enable the customers to fetch their life essentials under one roof with modern facilities.
Hypermarkets with ultra modern facilities are developed at Ernakulam, Thiruvanantha
puram and Kottayam
Source: Directorate of Civil Supplies, 2011
Mid-Day Meal Programme
14.305 The Mid-day Meal Programme, aimed at providing nutritional support to primary school going
children and to give boost to universalisation of primary education by increasing enrolment, reten-
tion and attendance was introduced in 1995 by the Ministry of Human Resource Development. The
centrally sponsored scheme originally covered the children of primary classes, I to V in Government/
Local bodies/Government aided schools. The scheme was further extended to the children studying
the Education Guarantee Scheme and Alternative Innovative Education centres also in October 2002.
During 2008-09 Government of India has extended the scheme to UP section (Std VI to VIII). The Mid
Day Meal Scheme is being implemented in the state with the fnancial support of State Government
in addition to the Central assistance. The Government of India provides 100 grams of rice to primary
children and 150 grams of rice to upper primary students per day. Government of India provides cook-
ing cost also @ Rs.1.58 for primary and Rs.2.10 for upper primary students per day.
14.306 The supply of commodities to schools for Noon-Meal scheme in Kerala is entrusted to
SupplyCo. The required quantity of rice has been taken from FCI and the pulses from their own stock.
The cost of food grains is met by Education Department. During 2010-11 the Corporation supplied
4,86,669 Qtls of rice and 1,19,354 Qtls of pulses to 12198 schools and about Rs. 27.79 lakh children
got the beneft of the scheme. Details of mid-day Meal Programme in the state during the last fve
years are given in the Table 14.78
Economic Review 2011
494
Table 14.78
Mid-Day Meal Programme 2006-07 to 2010-11
Sl.
no
Year
No. of
Schools
Children
benefted
Supply of food grains
(in Qtl)
Rice
Special
Rice
Pulses
1 2006-07 11480 2682644 227994.00 128523.97 110285.40
2 2007-08 11480 2682644 235546.20 208916.12 117107.78
3 2008-09 12457 3087558 272394.36 234095.77 135942.26
4 2009-10 12198 2902204 278531.67 289995.71 135421.76
5 2010-11 12198 2779118 486668.85 141675.31 119354.44
Source: Directorate of Civil Supplies 2011
Consumer Welfare Fund
14.307 As per G.O (P) no. 9/07/FCS&CA dated 07/03/2007 the State Government constituted a State
Consumer Welfare Fund similar to the Central Consumer Welfare Fund created as per the Consumer
Fund Rule 1992. The State Consumer Welfare Fund has taken voluntary efforts for promoting con-
sumer movement and strengthening the awareness activities through fnancial support, particularly in
rural backward areas.
14.308 The major percentage of population is not aware of the Consumer Protection Act and Con-
sumer rights. But the awareness campaign launched by the Government through electronic and
print media has been effective especially in rural areas. With a view to create awareness among the
consumers, it is decided to produce documentary flms of short duration to telecast in various visual
medias, through the Information & Public Relation Department.
Housing
14.309 Housing as a shelter, is one of the basic needs of mankind. Housing is a signifcant component
of the local, regional and national economy. Investment in housing is necessary as it serves to fulfl
several national policy objectives .It has the potential of becoming an engine of economic growth and
good housing ensures healthy life and safety to all people and helps in economic progress.
14.310 The state government is providing support through its various programmes to fll the gap be-
tween demand and supply of houses with special focus on weaker sections of the society. Kerala has
been a pioneer in the housing sector with the historic one lakh housing programme launched in
1972. This was followed by the programmes such as Single- family Affordable Solar Housing (SASH),
Maithri, Kairali, Thanal, Suraksha etc which became support and shelter for poor.
Demand for Housing
14.311 The housing situation in Kerala is far better than in the rest of the country, but growing popu-
lation in state demands more housing facilities in future. As per the Provisional census report 2011
population density of our state is 859 per square kilometer, three times the national average. Kerala
is one of the densest states in the country and it recorded a decadal population growth of +4.86. As
per census 2011 the population of Kerala is 3,33,87,677, the rural and urban population split up being
1,74,55,506 and 1,59,32,171, respectively. In other words, the rural population constitutes 52.28%,
and urban 47.72% of the entire population. The decadal percentage of urban population has increased
from 29.96% in 2001 to 47.72% in [Link] shows the high rate of urbanization taking place in Kerala
which is the third among the States in India having the highest share of urban population Housing
situation in our state has become a very important issue to be solved in [Link] states remarkable
Kerala State Planning Board
495
achievement in the sphere of social sector and human development are well refected in the general
housing situation of its mainstream society. But the housing problem of very poor household remains
unsolved. Considering the present trend in increase in population and housing, the population in 2011
is projected to be around 3.38 crore and number of households 83.42 lakh. It is also estimated that
housing need for the additional requirement for new population during the 12th plan period is as 6.5
lakh. In addition to this there is a need for reconstruction of 5.5 lakh units of dilapidated houses. The
state has to undertake a task of completing 12 lakh Housing units, of which around sixty percent are
the needs of the economically weaker sections of the society
Government Agencies in Housing Sector
14.312 Several agencies which are implementing housing schemes in the State include Kerala State
Housing Board, Kerala State Co-operative Housing Federation, Kerala State Development Corpora-
tion for SC/ST, SC/ST Development Department, Rural Development Department including Kudum-
bashree which implements Ashraya housing scheme for the destitute etc. Non-governmental agen-
cies such as COSTFORD and Habitat Technology Group, Co-operative Societies and Corporations
such as Kerala State Co-operative Housing Federation, Kerala Police Housing and Construction Cor-
poration etc. have also helped in constructing houses. In the recent government effort to rebuild dam-
aged houses for those who have been affected by Tsunami along the coast, several NGOs also have
contributed signifcantly. These agencies / departments have provided assistance to construct 5.32
lakh houses during the period from 2007-08 to 2011-12 upto 30.09.2011. Year-wise details are given
in Table 14.79
Table 14.79
Houses constructed by various agencies 2007-2011
Year Houses constructed
2007-08 130600
2008-09 140007
2009-10 121788
2010-11 92334
2011-12( up to
30.09.2011)
47321
TOTAL 532050
Source: Technical cell, Housing Department
Kerala State Nirmithi Kendra
14.313 Kerala State Nirmithi Kendra (KESNIK) was established in 1989 to actively engage in the
feld of housing and habitat development through the propagation of Cost Effective and Environment
Friendly (CEEF) technology. The objectives of Kerala State Nirmithi Kendra are transfer of technol-
ogy from lab to land, dissemination of CEEF technologies, training in alternative housing and building
material technologies, implementing/demonstrating CEEF technologies by undertaking construction
and consultancy projects. Kalavara a building material fair price shop launched during 2007-08 is a
novel venture in the feld of marketing building materials to curb the ever increasing price of building
materials in the State.
14.314 Schemes like Kalavara,CEEF production units and testing labs provide employment to la-
bourer in the local level. During 2010-11, 50 Artisan training programmes were conducted through
14 centres of KESNIK benefting 1950 benefciaries. 658 women were benefted by artisan training in
various trades like masonry, horticulture, building material production, painting ,carpentry ,plumbing,
home art and terracotta. Government has introduced 15% subsidy scheme to BPL benefciaries and
materials were distributed through 3 Kalavaras at Trivandrum ,Eranakulam and Kozhikode. Women
Economic Review 2011
496
production centre for building materials was completed and made operational at RNK Vattiyoorkavu.
14.315Laurie Baker International School of Habitat Studies (LaBISHaS) was established on 09.09.2009
as a research and academic initiative renaming the Laurie Baker Nirmithi Research Institute (LBNTRI).
The objectives of LaBISHaS include research based academic courses, training programmes, ex-
change of habitat culture and Post Graduate course in Habitat Technology. During 2010-11 LaBISHaS
organised three training programmes in Cost Effective And Environment Friendly Technologies in the
construction feld to students of various Engineering colleges.A two day technical training for the tech-
nical staff of District Nirmithi Kendra & Kerala State Nirmithi Kendra was also organised
Kerala Police Housing and Construction Corporation (KPHCC)
14.316 The Kerala Police Housing & Construction Corporation Ltd was established in 1990 with the
objective of taking up construction and maintenance of houses and offces for the Departments of Po-
lice, Fire & Rescue Services, Prisons, Vigilance and Anti-Corruption Bureau using government funds,
concerned department funds and raising loans from fnancial institutions. For the Police Department,
major projects that are presently being undertaken by the Corporation utilizing state funds are Police
Headquarters Complex at Thiruvananthapuram, Women Police Cells, Community Police Resources
Centres, repairs and maintenance of existing police offce buildings and police quarters, Police Com-
plex at Kochi etc. The details of projects completed upto 31.03.2011 are furnished in the following
Table 14.80
Table 14.80
Projects completed by the KPHCC during 2010-11
Sl. No Projects Completed
1 Electronic Networking/computerization 2
2 Lower Subordinate Quarters 55
3 Upper Subordinate Quarters 31
4 Commissioner offce and control room 1
5 Extension to Police Stations 5
6 Visitors Room 8
7 Works of other departments/PSUs 11
8 Kennels 6
9 Upgrading Dormitories at PTC/SBCID 2
10 Vanitha cell 2
11 District Police line 1
12 Prison Department Works 19
13 Police Aid Post/Out post 3
14 Safe house 1
15 Mess hall 1
16 Repair works 42
17 Coastal Security Police Station 5
18 Other Miscellaneous works 10
Source: KPHCC
14.317 The Corporation also undertakes works of other departments/ PSUs like Kerala Medical Ser-
vices Corporation, Tourism department, Kerala Livestock Development Board,KMML etc. The amount
of funds raised by the Kerala Police Housing & Construction Corporation for the last fve years is given
in the Table 14.81
Kerala State Planning Board
497
Table 14.81
Funds raised by KPHCC
(Figures in Rs. lakh)
Year
State budget
Plan Non Plan
2007-08 350.00 155.34
2008-09 450.00 160.00
2009-10 510.00 176.00
2010-11 600.00 193.60
2011-12(Up to
30.09.11)
750.00 213.00
Source: KPHCC
Kerala State Housing Board
14.318 Kerala State Housing Board established in 1971 with a view to the objective of formulating
and implementing various housing schemes and housing loan schemes has been acting as the nodal
agency of Govt. of Kerala for implementing housing schemes, in particular for the Economically Weak-
er Sections (EWS). The Board also undertakes schemes such as government directed schemes, slum
improvement schemes, construction works of other agencies, commercial cum offce complexes etc.
Major schemes undertaken by KSHB during 2010-11 and up to 30-09-2011 are given below.
a)Suraksha Housing Scheme
14.319 The Scheme is to give fnancial assistance for construction of houses to the economically
weaker houseless sections of people in both urban and rural areas. A Government subsidy of Rs
25000/- per house is granted for constructing a house with the help of voluntary organisations or
NGOs. The Board has constructed 279 houses during 2010-11 and 190 houses during 2011-12(up to
30/09/2011). The voluntary organizations/NGOs shall give assistance to the benefciary to build the
structure upto roof level and the government subsidy shall be disbursed on completion of the roof. The
fnancial pattern of the scheme is as follows:
Share of benefciary : Rs 25000/-
Share of voluntary organization : Rs 50000/-
Government subsidy : Rs 25000/-
Total : Rs 100000/-
b)M.N. Lakshamveedu Punarnirmana Padhathi
14.320 The one lakh housing scheme was launched in 1972 and a substantial number of houses are in
need of renovation/reconstruction. The scheme which has been renamed as MN Lakshamveedu Pu-
narnirmana Padhathi on 19.09.08 was envisaged for the reconstruction of houses constructed under
one lakh housing scheme of 1972-76 period. During 2010-11, 3134 houses were completed, for which
an amount of Rs 1286.66 lakh was spent. The estimated cost of renovation of one house has been
revised to Rs 1.25 lakh. The subsidy rates are also revised @ Rs 1.25 lakh, Rs 1 lakh and Rs 75,000/-
to ST, SC and general category respectively, of which 50% of the subsidy is the government share.
14.321 The balance amount required for satisfactory completion of the houses shall be met by the
Local Bodies / voluntary organizations/ philanthropic individuals/benefciary. During 2011-12, upto
30-9-2011, the Board has renovated 479 units and an amount of Rs 3.76 crore has been spent for the
scheme.
c) Innovative Housing Scheme
14.322 The scheme was envisaged in 2008-09 to provide residential fats in Government land to poor
Economic Review 2011
498
urban workers who are forced to stay far away from their workplace. Housing would be in the nature
of fats with necessary infrastructure and community facilities. A minimum of one third of the dwelling
units constructed would be allotted to women headed families who are single, deserted, divorced or
widowed. During 2010-11 board has constructed 24 fats at Kuttanelloor and 24 fats at Poojappura .
An amount of Rs 400.00 lakh is allocated during 2011-12 for implementing the scheme at Kuttanel-
lur (Thrissur) and Kozhikode near Medical [Link] year-wise details of fnancial assistance from
State Government are given below.
Table 14.82
Financial Assistance to KSHB from State Government
(Figures in Rs. lakh)
Year
Assistance from
State Govt
2007-08 1858
2008-09 750
2009-10 1700
2010-11 1972
Source: KSHB
Kerala State Co-operative Housing Federation
14.323 Kerala State Co-operative Housing Federation Ltd., registered on 23.09.1970 is the apex body
for fnancing the Primary Co-operative Housing Societies in the State. At present 206 Primary Housing
Co-operative Societies are affliated to the Federation. The main sources of funds to the Federation
are share capital contribution from member societies and State government and borrowings from LIC,
National Housing Bank and Housing and Urban Development Corporation. The main objective of the
Federation is to provide fnancing facilities for the affliated Primary Co-operative Housing Societies
for the construction of houses.
14.324 The Federation has received Rs 2518.08 lakh as share capital contribution from government
till 30.09.2011 leaving an outstanding balance of Rs 1696.62 lakh. The share capital contribution from
the members of the Federation was Rs 2383.90 lakh as on 31.03.2011 and a contribution of Rs 70.30
lakh was received from the members as on 30.09.2011. The outstanding balance to the members as
on date is Rs 2449.39 lakh. The details of borrowings from various sources of fund are given in Table
14.83
Table 14.83
Borrowings of Kerala State Co-operative Housing Federation
(Figures in Rs. lakh)
Source of Fund
O.B as on
3/2011
Receipt up to
09/2011
Repayment up
to 9/2011
Balance as on
9/2011
LIC 21441.62 4000.00 1631.76 23809.86
HUDCO NIL NIL NIL NIL
Debenture 75.00 NIL NIL 75.00
State Govt. NIL NIL NIL NIL
NHB 5133.68 NIL 473.26 4660.42
Canara Bank 8625.16 3000.00 515.12 11110.04
Federal Bank 3202.03 NIL 162.13 3039.90
Source: KSCHF
14.325 During 2010-11 up to 30-09-2011, an amount of Rs.149.13crore has been disbursed
for constructing 6392 housing units among EWS, LIG, MIG sections and others. Of this, MIG is the
largest benefciary group (2974 units). Details are given in Appendix14.52
Kerala State Planning Board
499
Central Government Schemes on Housing
14.326 The government of India has targeted social housing as one of its primary focus areas and
stressed the need special attention to the needs of the slum dwellers and housing for the weaker sec-
tions .Rural housing is one of the components of Bharath Nirman, launched in 2005-06 for building
infrastructure and basic amenities in rural areas. Under Phase one of the rural housing component of
Bharat Nirman 60 lakh houses were envisaged through the Indira Awas Yojana all over the country. In
order to stimulate housing and urban development in the country, the government of India has come
out with major policy initiatives like the National Urban Housing and Habitat Policy (NHHUP) 2007,
J awaharlal Nehru National Urban Renewal Mission (J NNURM), Interest Subsidy Scheme for Housing
the Urban Poor(ISHUP), Affordable housing in partnership scheme, Indira Awaas Yojana(IAY) and the
recently announced Rajiv Awas Yojana (RAY).
Indira Awaas Yojana(IAY)
14.327 IAY was launched as a sub-scheme of RLEGP and from April 1989, it became a sub-scheme of
the Jawahar Rozgar Yojana (JRY). On January 1st, 1996, IAY was fnally delinked from JRY and made
an independent scheme. IAY is a cash subsidy based programme, under which assistance is provided
to rural BPL families for constructing dwelling units on their own using their own design and technology.
The present per unit assistance is Rs. 25,000 in plain areas and Rs. 27,500 in hilly and diffcult areas.
Funding under IAY is provided by the Centre and the State in the ratio of 75:25.
VAMBAY Housing Scheme
14.328 VAMBAY, a Centrally Sponsored Scheme, is implemented to ameliorate the housing problems
of the urban slum dwellers. The objective of the scheme is primarily to provide shelter or upgrade
the existing shelter for the BPL people in urban slums. The expenditure is shared as 50:50 ratio by
the Central and State Government. The allocation per house under the scheme is Rs. 40,000/- for
ordinary towns, where the population is below 1 million, of which 50% of the cost is from the Central
Government. In the State of Kerala, the State Government and the concerned Urban Local Body
equally contribute 50% of the cost
Jawaharlal Nehru National Urban Renewal Mission (JNNURM)
14.329 J NNURM was launched by the government of India with the objective to give focused atten-
tion to integrated development of urban infrastructure and with the emphasis on urban poor and slum
improvement. The focus of J NNURM is on holistic development of slum areas.
Housing Scheme under JNNURM
14.330 The J NNURM was launched by the Central Government in December 2005 with two sub-
missions Basic Services for Urban Poor (BSUP) and Integrated Housing and Slum Development
Programme (IHSDP) under housing category. HUDCO has authorised to conduct the appraisal of
schemes in Kerala under BSUP and IHSDP. Kudumbasree is the state nodal agency for the schemes.
Interest Subsidy Scheme for Housing the Urban Poor (ISHUP)
14.331 Interest Subsidy Scheme for Housing the Urban Poor (ISHUP),launched with a view to enable
access of urban poor to long term institutional fnance is an additional instrument for addressing the
needs of the Economically Weaker Section(EWS) and low income group segment in the urban areas.
The scheme seeks to provide interest subsidy to the EWS/LIG benefciaries on availing loans from
banks /housing fnance companies to enhance affordability of these income segments.
Economic Review 2011
500
Rajiv Awas Yojana (RAY)
14.332 The lessons of J NNURM have led to the announcement of the vision of a slum free India by
encouraging states/Union territories to tackle the problem of slums in a defnitive manner .It calls for a
multi-pronged approach focusing on: Rajiv Awas Yojana which is a new scheme under J NNURM aim-
ing Slum Free Cities in India. Each State has to prepare a Slum-Free City Plan of Action (SFCPoA).
The preparatory phase of Rajiv Awas Yojana (RAY) that is preparing SFCPoA has been launched by
Kerala Government and Kudumbashree Mission has been nominated as State Level NodalAgency.
14.333 Government of India had given sanction to prepare Slum-Free City Plan of Action for 5 Cor-
porations (Trivandrum, Kollam, Kochi, Trichur and Kozhikode) of Kerala. At present the main work in
Kudumbashree under RAY is Preparation of Slum Free City Plan by conducting detailed MIS based
socio-economic survey, GIS based geo-referenced mapping including total station survey
Financial Institutions
14.334 A large number of fnancial institutions have been providing assistance for house construc-
tion along with the government agencies in the State. The fnancial institutions in this respect are
Nationalized Banks, HUDCO, HDFC, LIC Housing Finance Ltd, Sundaram Home Finance, GIC Hous-
ing Finance, HOUSEFED, Dewan Housing Finance, Canfn Homes, BOB Housing Finance, Kerala
State Co-operative Bank, Kerala State Co-operative Agricultural and Rural Development Bank Ltd,
and HSBC. Consequent to the growing competition among these agencies in bank deposit rate and
lending rates, the rates of housing loans are also changing within short spells of time. However counter
cyclical policies announced by the GOI and the Reserve Bank of India are likely to stabilize the effec-
tive interest rates on housing loans.
14.335 The interest rates of various fnancial institutions on housing loan as on 30-11-2011 are fur-
nished in Appendix 14.53. Among the lending agencies, HUDCO gives loans for the EWS housing
and LIG housing projects with low interest rate, i.e. 9% and 9.50% respectively. The interest rate of
housing projects for widows, SC/STs, legally handicapped, single woman above 35 years of age and
benefciaries of natural calamity affected areas is the lowest, i.e. only 9 per cent
HUDCO
Kerala State Planning Board
501
14.336 HUDCO has been extending fnancial assistance for housing and urban infrastructure schemes
all over India. HUDCO Niwas Home Loans units extended loan assistance to individuals for housing.
HUDCO also functioned as an appraisal agency for extending Central Govt. grant assistance in hous-
ing sector under BSUP, IHSDP, JNNURM, ILCS etc. HUDCO is one of the Central Nodal Agencies
for ISHUP launched by Central Government and has signed MoU with SBT for implementation of the
scheme in the State. Assistance was provided under HUDCO Niwas Home Loans to 124 applicants
for construction or improvement of houses .There are 53 projects running in Kerala coming under the
purview of IHSDP schemes. The IHSDP projects sanctioned during 2009-10 and 2010-11 are given
in Table 14.84.
Table 14.84
IHSDP proposals sanctioned in Kerala
(Figures in Rs. lakh)
Year
No. of pro-
posals from
Local Bodies
Project cost
(`Rs. lakh)
Grant form
GOI (Rs. lakh)
2009-10 17 8059 5529
2010-11 Nil Nil Nil
Source: HUDCO
14.337 Under Integrated Low Cost Sanitation Scheme, subsidy was extended by Central Govern-
ment to various Urban Local Bodies for individual sanitation schemes with Kerala Suchitwa Mission
as Nodal Agency. The ILCS schemes sanctioned during the last two years are given in Table.14.85.
Table 14.85
ILCS proposals sanctioned in Kerala
(Figures in Rs. lakh)
Year
No. of pro-
posals from
ULBs
Project cost
(`Rs. lakh)
Grant form
GOI (Rs. lakh)
2009-10 6 667 500
2010-11 Nil Nil Nil
Source: HUDCO
LIC Housing Finance Limited
14.338 During the year ended March 2011, the Company sanctioned and disbursed loans totalling Rs
22603 crores, & Rs 19912 crores, registering a growth of 25% & 34% respectively over the previous
year. Out of the total, Individual loan sanctions & disbursements were Rs 20227 crore & Rs 17512
crore , registering growth of 43 % & 41%.For the year ended March 2011, the Companys total income
was Rs.4869 crores as against Rs.3469 crores during the same period last year, registering a growth
of 40%. Net proft during this period was Rs.974.49 crores as compared to Rs.662.18 crores in the
corresponding period last year, showing a growth of 47%. The total income included Rs.168.81cr
as income from sale of investments. The Outstanding Mortgage Portfolio as on March 31, 2011 was
Rs.51090 crores as against Rs.38081 crores on March 31, 2010, thus registering a growth of 34%.
14.339 LIC Housing Finance Ltd. is one of the largest housing fnance companies in India, having
one of the widest networks of 205 offces across the country and representative offces at Dubai and
Kuwait. In Kerala, LIC Housing Finance Ltd. has fve branches located at Kochi, Kottayam, Kozhikode,
Thiruvananthapuram and Thrissur. The performance highlights of LIC Housing Finance Ltd. for the
year 2010-11 is indicated in the Table 14.86
Table 14.86
Economic Review 2011
502
LIC Housing Finance - Performance Highlights
(Figures in Rs. crores)
Items
Year ended
March 2011
Year ended
March 2010
Variation
Individual Loan Sanctions 20227 14151 Up by 43%
Individual Loan Disbursements 17512 12448 Up by 41%
Interest Income on Housing
Loans
4470 3283 Up by 36%
Net Interest Income 1372 887 Up by 55%
Total Income including other
income
4869 3469 Up by 40%
Net Interest Margins 3.08% 2.70%
Proft before tax 1294.16 911.27 Up by 42%
Net Proft after Tax 974.49 662.18 Up by 47%
Dividend 175% 150%
Gross NPA 242 263
Gross NPA% 0.47% 0.69%
Net NPA 15 46
Net NPA% 0.03% 0.12%
Outstanding Mortgage Portfolio 51090 38081 Up by 34%
EPS (Rs 2 paid-up) 20.53 14.69
1 crore =10 million
Source: LIC Housing Finance Ltd
Kerala State Planning Board
Local Self Governments and
Decentralised Planning in Kerala
C
H
A
P
T
E
R
506
Kerala State Planning Board
507
Keralas relative success in empowering local bodies following the 73rd and 74th amendments of
the Constitution in 1993 has been a recurring theme in any national discussion on decentralized gov-
ernance. There has been one too many enabling factors for the perceived good performance, not the
least being the socio-political milieu so typical of the State and the enactment of two legislations, the
Kerala Panchayati Raj Act of 1994 and the Kerala Municipalities Act of 1994. What they, in essence,
aimed at was a paradigm shift from partisan democracy to participatory democracy and from central-
ized governance to decentralized governance.
15.2 In a broader sense , this is part of a proces to make governance more responsive and caring
in tune with the changing aspirations of a highly informed and, hence, demanding, society. Which is
why modern-day governance is about serving the people more than the convensional benefciaries,
Ceasars and the Gods. No less importantly, it also focuses as much on good decision making as timely
delivery. The exercise initiated by the State needs to be viewed in this broader context.
15.3 Three Five-Year Plans (1Xth, Xth and X1th) later, the experiment is well set on its course, though,
admittedly, there still remain many grey areas which, indeed, are looked into. But there has been im-
pressive progress, particularly in peoples participation in decision-making on crucial issues. And they
have had their advantages. The process of implementation has been in phases spread over the three
Plans. While evolving a working methodology for participatory planning was one of the major priorities
in IX Plan, in the Xth Plan the focus was on institutionalizing the methodology of decentralized planning
evolved during the previous Plan. In the XIth Plan, the Government revamped the entire process with
a view to completing the process.
Some of the major achievements under the decentralized dispensation need special mention. For
one, it encouraged participatory methodology at various stages of planning process, implementation,
monitoring etc. For another, it initiated the transfer of about 25% of the Annual Plan allocation of the
State Plan to the LSGs in the form of untied Plan grant for implementing projects for local development
according to the wishes of the people. For yet another, it enabled the transfer of powers, functions and
personnel to LSGs. It also helped the people and their elected representatives understand and identify
planning priorities. And, fnally, it ensured transparency in the selection of individual benefciaries of
schemes based on some fxed criteria. Not to be overlooked were the improved management systems
and accountability that became part of governance and initiation of poverty reduction programmes like
Ashraya.
15.4 Relevantly, the XIth Plan too had envisaged enhanced social justice, quality of public service and
good governance to be achieved through LSGs. Towards this end, the Plan had fxed the following priorities.
Revival of agriculture and allied sectors, traditional and small-scale industries and promotion
of micro enterprises with special emphasis on employment generation and poverty reduction
Enhancement of the quality of special component plan, tribal sub-plan, women component
Local Self Governments and
Decentralised Planning in Kerala
Economic Review 2011
508
plan, anti-poverty sub-plan, etc. to bring greater social justice, especially to the socially and
economically marginalised and excluded groups.
15.5 Accordingly, the XIth Plan brought about signifcant changes in fund allocation and metho-dolo-
gies as listed below
The minimum ceiling prescribed to productive sector from the general sector Plan grant was
increased from 30% in the Xth plan to 40% in the XIth Plan.
For benefciary-oriented projects, it was prescribed that 3% of benefciaries would be disabled
people with a view to ensuring social security to them.
The Anti-poverty Sub-Plan, as per the methodology developed by Kudumbashree, was
included in the LSGs.
The Asraya project for destitute was extended to both rural and urban areas.
The Total Energy Security Mission was launched for implementing energy security through
integrated energy plans of LSGs.
The integrated housing programme, viz, the EMS Housing Programme was introduced for
providing shelter to all poor families having no shelter.
Grant-in-Aid to LSGs
15.6 The Third State Finance Commission had recommended certain reforms on the devolution of
grant-in-aid (Plan fund) to LSGs from 2006-07 to 2010-11 and the quantum of funds to be utilized
by LSGs from their own revenue for development purpose. As per the recommendation, the Rs
1400-crore earmarked as grant-in-aid for LSGs during 2006-07 would be increased by 10% per annum
in the succeeding years. Similarly, an anticipated amount of Rs. 803.29 crore had also been
earmarked in the State Plan budget from 2007-08 to 2010-11 as contribution of LSGs from their own
revenue in addition to the Plan grant from the Government. Thus, the total Plan share of LSGs during
2007-08 to 2010-11 totalled Rs.7950.29 crore. As a percentage of the total State Plan outlay during
this period, the share of LSGs came to 23.68%. In reality, however, it worked out a wee-bit less in view
of the mismatch in the incremental growth in annual Plan outlays of the State and the LSGs. In the
event, the grant-in-aid to LSGs, as a percentage of the outlays, declined from 25.76% in 2007-08 to
21.98% in 2010-11. The details of State Plan outlay and grant-in-aid to LSGs are given in table 15.2.1
Kerala State Planning Board
509
Table 15.1
State Plan Outlay and Grant-in-Aid to LSGs (` In crore)
Annual Plan State Plan
Outlay
Grant-in-Aid
to LSGs
Own Contri-
buton of LSGs
Total Plan Share
of LSGs
(3+4)
% to State
Plan Outlay
1 2 3 4 5 6
2007-08 6950.00 1540.00 250.00 1790.00 25.76
2008-09 7700.47 1694.00 183.51 1877.51 24.38
2009-10 8920.00 1863.00 222.13 2085.13 23.38
2010-11 10000.00 2050.00 147.65 2197.65 21.98
Total 33570.47 7147.00 803.29 7950.29 23.68
Source: Budget documents
Distribution of Grant-in-Aid
15.7 The budgetary provision of grant-in-aid to LSGs has three categories, viz, General Sector,
Special Component Plan (SCSP) and Tribal Sub Plan (TSP). For the intra-tier distribution of grant-
in-aid to different tiers of LSGs, a criterion was evolved. According to the recommendation of the 3rd
SFC, the amount earmarked for LSGs during 2009-10 was Rs.1863 crore. This was increased by 10%
to fx the total outlay in 2010-11. Accordingly, the share under each tier of LSGs for the three categories
was also increased by the same percentage from the amount given in 2009-10. Thus, the total Plan
fund allocated in the Annual Plan 2010-11 to LSGs for the three categories was Rs.2275.90 crore
which was what the 3rd SFC had recommended. In addition to this an amount of Rs.147.65 crore was
anticipated as contribution of LSGs from their own revenue. Consequently, the total Plan share of
LSGs during 2010-11 increased to Rs. 2197.65 crore which was only 21.98 % of total State Plan outlay.
Category-wise Allocation of Grant-in-Aid to LSGs
15.8 The details of category-wise allocation of Plan fund in 2010-11 are given in table 15.22.
Table 15.2
Category wise Allocation of Grant-in-Aid to LSGs during 2010-11 (` In crore)
Type of LSGIs General SCP TSP Total
1 2 5 6 5
Grama Panchayats 79730.77 31310.34 4375.56 115416.67
Block Panchayats 17068.79 10435.72 1748.57 29253.08
District Panchayats 17068.79 10435.72 2624.42 30128.93
Municipalities 13015.40 3656.17 98.02 16769.59
Corporations 10320.27 3111.46 0.00 13431.73
Total 137204.02 58949.41 8846.57 205000.00
Note:- Additional fund for Road renovation programmes is also included
Source: Appendix IV of the Budget 2010-11
Performance of LSGs in 2010-11
15.9 The grant-in-aid actually received by LSGs during 2010-11 was Rs. 2050 crore. As per the
Government decision, those LSGs which had attained 70% and above expenditure in 2009-10 were
permitted to retain the unspent balance of Plan fund remaining in their account of 2009-10 as opening
Economic Review 2011
510
balance. Thus, the total Plan fund available with the LSGs for allocating funds to various develop-
ment sectors during 2010-11 was Rs. 2882.50 crore. Of this, Rs.1917.04 crore was utilized, which at
66.51% was in sharp contrast to the 85 % touched 2009-10. The block panchayats, on the other hand,
utilized 67.96% during 2010-11. Compared to the performance in 2009-10, district panchayats and
corporations recorded less utilization of Plan funds during 2010-11. The Plan expenditure of district
panchayaths decreased from 70.79% to 54.12% and that of corporation from 66.15% to 61.59%. The
tier-wise details of outlay and expenditure of Plan fund during 2010-11 are given in Table 15.2.3.
Table No. 15.3
Grant-in-Aid to LSGIs - Outlay and Expenditure during 2010-11
(` In lakhs)
Type of LSGIs Budget
Outlay
Fund
Available
Expenditure % w.r.t col. 5
1 2 5 6 7
Grama Panchayats 112880.21 148018.83 104685.18 70.72
Block Panchayats 37662.37 42351.53 28782.24 67.96
District Panchayats 43611.99 54348.23 29415.18 54.12
Municipalities 18551.09 23029.34 16194.90 70.32
Corporations 14884.55 20502.65 12626.80 61.59
Total 227590.21 288250.58 191704.30 66.51
Source: IKM and appendix IV of the Budget 2010-11
15.10 By comparison, grama panchayats recorded the highest expendidture at 70.72% during
2010-11. Next came municipalities and block panchayats with 70.32% and 67.96%, respectively. As fo
utilization of funds under SCSP and TSP, block panchayats reported 70.12% expenditure in SCSP and
72.56% in TSP. Compared to the performance in general sector, the LSGs did not attain the desired
level in SCP in 2010-11. During this period, the LSGs utilized 71.34% of funds of the outlay provided in
general sector while in SCSP it was only 56.08%. This shortfall in expenditure of SCSP was a common
phenomenon for all tiers of LSGs in 2010-11. The shortfall was comparatively high in the case of
corporations and grama panchayats. In 2006-07, the percentage of utilization of SCP was 80 and
it declined to 74 in 2007-08 and to 64 in 2008-09. In the following year, 2009-10, a small increase in
utilization of SCP funds was seen.
15.11 The poor utilization of SCP funds by LSGs is a serious matter that requires immediate interven-
tion since one of the major objectives of decentralised planning is to improve the socio-economic sta-
tus of SCs and STs by enhancing the quality of SCP and TSP through LSGs. In other words, the Gov-
ernment ought to gear itself up to ensure effective implementation of these two plans. The category
-wise outlay and expenditure during 2010-11 are given in Table 15.2.4 and category-wise outlay and
expenditure during 2009-10 are given in Appendix 15.2.1.
Kerala State Planning Board
511
Table 15.4
Grant-in-Aid to LSGIs - Category wise Outlay and Expenditure during 2010-11
(` In lakhs)
General SCP
Type of
LSGIs
Budgeted
outlay
Fund
available
Expendi-
ture
% Bud-
geted
outlay
Fund
available
Expendi-
ture
%
1 2 5 6 7 8 11 12 13
Grama Pts 112880.21 148018.83 104685.18 70.72 31310.34 47370.79 25339.54 53.49
Block Pts 37662.37 42351.53 28782.24 67.96 10435.72 12699.53 8904.50 70.12
District
Pts
43611.99 54348.23 29415.18 54.12 10435.72 15052.87 8192.19 54.42
Municipal-
ity
18551.09 23029.34 16194.90 70.32 3656.17 5471.90 3143.70 57.45
Corpora-
tion
14884.55 20502.65 12626.80 61.59 3111.46 5719.76 2823.27 49.36
Total 227590.21 288250.58 191704.30 66.51 58949.41 86314.85 48403.20 56.08
Source: IKM and appendix IV of the Budget 2010-11
TSP Total
Type of
LSGIs
Budgeted
outlay
Fund
available
Expendi-
ture
% Budgeted
outlay
Fund
available
Expendi-
ture
%
1 11 13 14 15 16 18 19 20
Grama Pts 4375.56 6171.08 3961.23 64.19 112880.21 148018.83 104685.18 70.72
Block Pts 1748.57 2133.56 1548.21 72.56 37662.37 42351.53 28782.23 67.96
District Pts 2624.42 3561.75 2199.71 61.76 43611.99 54348.23 29415.18 54.12
Municipality 98.02 164.95 118.78 72.01 18551.09 23029.34 16194.91 70.32
Corporation 0.00 0.00 0.00 0.00 14884.55 20502.65 12626.80 61.59
Total 8846.57 12031.34 7827.93 65.06 227590.21 288250.58 191704.30 66.51
Source: IKM and appendix IV of the Budget 2010-11
1. Sector-wise performance
15.12 The total Plan fund available with LSGs during 2010-11 for allocation to the three sectors,
viz, productive, service and infrastructure, was Rs. 2882.50 crore. Of this, the allocation to produc-
tive sector constituted 15.46%, service sector 33.68% and infrastructure sector 23.23%. In addition
to this, the LSGs allocated 27.62% of their plan funds as mandatory provision to the implementation
of schemes/projects stipulated by the Government according to guidelines. The projects/schemes
included under this category belonged to service sector. Further, the share of the productive sector
(15.46%) declined in 2010-11 as compared to 2009-10 (19%). Also, the percentage of utilization in
productive sector declined from 69% in 2009-10 to 59.95% in 2010-11. This limited performance in
the productive sector during 2010-11 covered all the tiers of LSGs.
The role of LSGs in eradicating poverty at the local level by achieving local production, income and
employment is all too obvious. But their poor performance in the productive sector betrays their inabil-
ity to live up to this objective. This calls for a reshuffing of priorities and strategies of LSGs particularly
with regard to programmes relating to the productive sector.
Economic Review 2011
512
The sector wise allocation and expenditure details in 2010-11 are given in Table 15.2.5. The detailed
fgures in 2009-10 are given in Appendix 15.2.2
Table No. 15.5
Grant in - Aid to LSGs Sector- wise Allocation & Expenditure during 2010-11
(` in lakhs)
Type of
LSGIs
Productve Service Infrastructure
Fund Al-
located
Expendi-
ture
% Fund Al-
located
Expendi-
ture
% Fund Al-
located
Expendi-
ture
%
1 2 3 4 5 6 7 8 9 10
Grama Pts 26006.21 16786.74 64.55 52453.26 31389.54 59.84 20664.38 15813.26 76.52
Block Pts 6316.64 3978.61 62.99 11701.24 7439.92 63.58 11903.55 6695.76 56.25
District Pts 7981.79 4101.87 51.39 17669.89 9626.04 54.48 21992.02 9679.82 44.02
Municipali-
ties
2088.66 1018.99 48.79 7765.36 4802.25 61.84 6581.72 4469.41 67.91
Corporations 2187.44 841.90 38.49 7501.43 3849.13 51.31 5830.27 2623.47 45.00
Total 44580.74 26728.11 59.95 97091.18 57106.88 58.82 66971.94 39281.72 58.65
Projects excluded from
sectoral ceilings
Total
Type of
LSGIs
Fund Allo-
cated
Expenditure % Fund Allo-
cated
Expenditure %
1 11 12 13 14 15 16
Grama Pts 48894.98 40695.65 83.23 148018.83 104685.18 70.72
Block Pts 12430.11 10667.97 85.82 42351.53 28782.24 67.96
District Pts 6704.55 6007.45 89.60 54348.23 29415.18 54.12
Municipalities 6593.60 5904.25 89.55 23029.34 16194.90 70.32
Corporations 4983.53 5312.31 106.60 20502.65 12626.80 61.59
Total 79606.77 68587.63 86.16 288250.58 191704.30 66.51
Source: IKM
ALLOTMENT IN 2010-11
Productive Sector ,
14%
Infrastructure Sector,
20%
Projects Excluded from
Sectoral ceiling , 36%
Service Sector , 30%
Productive Sector
Service Sector
Infrastructure
Sector
Projects Excluded
from Sectoral
ceiling
Figure 15.1
Kerala State Planning Board
513
EXPENDITURE IN 2010-11
Projects Excluded
from Sectoral ceiling
, 36%
Infrastructure Sector,
20%
Productive Sector ,
14%
Service Sector , 30%
Productive Sector
Service Sector
Infrastructure
Sector
Projects Excluded
from Sectoral
ceiling
1.1 Productive Sector
15.13 A discernible trend in all the tiers of LSGs is the priority given to the revival of agriculture and
allied sectors that include paddy cultivation, animal husbandry, dairy development, fsheries etc. Out
of the total Plan fund made available to the productive sector by LSGs, as much as 65.48% had been
earmarked for the implementation of various schemes under agriculture and allied sectors. In fact,
LSGs had given more weightage to the cultivation of paddy and other food crops. Of the total fund
earmarked for agriculture and allied sectors, paddy and other food crops alone accounted for 51%
in 2009-10. There was a signifcant increase in allotment during 2008-09 and 2009-10 as the State
was facing food security problems. The second priority was given to enhancement of industries by
earmarking 19% funds meant for productive sector. The emphasis was on promoting co-operative
and industrial sector which together accounted for as much as 62% of the allotted funds. Under the
industrial sector, employment training schemes were given importance and grama panchayats were
asked to give major attention to their implementation.
15.14 During 2010-11, the percentage of utilization of LSGs in the productive sector was only 66.5%
which was lower than in 2009-10. The performance of grama panchayats was better in the productive
sector since they spent 72% of funds in this sector. At 72.26%, it was slightly higher in the case of
agriculture and allied sectors. The details of achievements during 2010-11 are given in Table 15.2.6.
The details of achievements during 2009-10 are given in Appendix 15.2.3.
Table No. 15.6
Productive Sector - Development Sector wise Allocation & Expenditure during 2010-11
(` in lakhs)
Development
Sector
Grama Panchayats Block Panchayats District Panchayats
Alloca-
ton
Expr. % Alloca-
ton
Expr. % Alloca-
ton
Expr. %
1 2 3 4 5 6 7 8 9 10
Agriculture & Al-
lied sectors
18986.42 13719.90 72.26 3118.27 2225.12 71.36 4550.37 2796.39 61.45
Soil and Water
Conservation, Ir-
rigation
2634.03 1251.72 47.52 1989.45 1092.25 54.90 1726.14 751.20 43.52
Industries 4217.87 1768.35 41.93 1207.11 659.59 54.64 1702.71 552.27 32.43
Environment 167.88 46.78 27.86 1.81 1.65 91.27 2.57 2.01 77.93
Total 26006.20 16786.75 64.55 6316.64 3978.61 62.99 7981.79 4101.87 51.39
Figure 15.2
Economic Review 2011
514
Development
Sector
Municipalites Corporatons Total
Alloca-
ton
Expr. % Alloca-
ton
Expr. % Alloca-
ton
Expr. %
11 12 13 14 15 16 17 18 19 20
Agriculture &
Allied sectors
1467.64 831.63 56.66 1070.82 603.37 56.35 29193.53 20176.42 69.11
Soil and Water
Conservation,
Irrigation
151.04 62.54 41.41 87.98 11.59 13.17 6588.64 3169.29 48.10
Industries 455.71 113.50 24.91 1023.74 225.92 22.07 8607.14 3319.63 38.57
Environment 14.28 11.32 79.25 4.90 1.02 20.84 191.44 62.77 32.79
Total 2088.67 1018.99 48.79 2187.44 841.90 38.49 44580.75 26728.11 59.95
Source: IKM
LSGs performance in Agriculture and Allied Sectors
120.28
135.45
141.92
192.14
260
310
291.93
77.21
90.8
124.2
151
190.8
242
267.28
0
50
100
150
200
250
300
350
2004-05 2005-06 2006-07 2007-08 2008-09 2009-10 2010-11
Year
R
s
i
n
c
r
o
r
e
s
Allotmant
Expenditure
Source: IKM
1.1 Service Sector
15.15 A review of the sub-sector-wise allocation under service sector showed that LSGs had shown
more attention to enhance the quality of basic services given to public through welfare- oriented
programmes with special emphasis on health and education. However, despite higher allocation,
actual expenditure on all major sub-sectors declined during 2010-11 as compared to 2009-10. As for
utilization of fund, the block panchayats performed well by achieving 63.58% of expenditure. Among
the developmental sectors in the service sector, education and allied services accounted for nearly
65% expenditure. As in the case of previous years, a major share of funds of LSGs in the sector was
earmarked for the implementation of programmes under social welfare for SCs and STs. Against
the total outlay in service sector, 63% of funds was earmarked for social welfare activities in which
the development of SC and ST development accounted for 37% and 7% respectively. Both rural and
urban local bodies gave more weightage to the implementation of housing scheme by earmarking
34% funds provided under social welfare. The achievement in housing sector was 67%. Though
there was paucity of resources, the initiative shown by the Government to provide house to all the
Figure 15.3
Kerala State Planning Board
515
houseless among the weaker sections of the population through LSG plans was commendable.
Sarva Shiksha Abhiyan (SSA), a fagship programme of the Union Government for universalisation
of elementary education was being implemented in the State through LSG by earmarking 20% of the
outlay for programmes related to education and allied services. During 2009-10, LSGs achieved 98%
expenditure in SSA. It was increased to 98.7% in 2010-11. The intervention of LSGs towards this
programme resulted in the creation of infrastructure facilities in Government schools.
15.16 Under the decentralized planning process, the LSGs had a major role in maintaining good
health status of the local community by improving the delivery of public health services. It was noted
that during 2010-11, 71.89% of the funds set aside for health and allied services was allotted for
upgrading drinking water facilities and sanitation system at local level and was nearly fully utilized. The
allocation and expenditure details in 2010-11 are given in Table 15.2.7. The detailed fgures in 2009-
10 are given in Appendix15.2.4.
Table No. 15.7
Service Sector - Development Sector wise Allocation& Expenditure during 2010-11
(` in lakhs)
Development
Sector
Grama Panchayats Block Panchayats District Panchayats
Alloca-
ton
Expr. % Alloca-
ton
Expr. % Alloca-
ton
Expr. %
Education. Culture,
Arts, Youth, Sports
3106.24 2151.73 69.27 644.75 448.23 69.52 3542.18 2198.97 62.08
Health & Allied
Services
9798.20 6124.87 62.51 2973.80 1584.45 53.28 3906.51 1896.18 48.54
Social Welfare 34571.77 19993.86 57.83 6837.33 4636.76 67.82 9107.33 5049.38 55.44
Women & Children
Development
2756.00 1809.30 65.65 810.29 464.04 57.27 901.17 374.34 41.54
Labour & Labour
Welfare
281.37 99.17 35.25 21.09 26.08 123.69 20.00 9.73 48.66
Other Economic
Services
1939.67 1210.61 62.41 413.99 280.36 67.72 192.70 97.44 50.56
Total 52453.25 31389.54 59.84 11701.25 7439.92 63.58 17669.89 9626.04 54.48
Source: IKM
Development Sec-
tor
Municipalites Corporatons Total
Alloca-
ton
Expr. % Alloca-
ton
Expr. % Alloca-
ton
Expr. %
Education. Culture,
Arts, Youth, Sports
672.69 402.38 59.82 835.73 508.01 60.79 8801.58 5709.32 64.87
Health & Allied
Services
1087.95 763.12 70.14 830.65 603.93 72.71 18597.11 10972.55 59.00
Social Welfare 5039.91 3042.18 60.36 5190.38 2361.89 45.51 60746.71 35084.07 57.75
Women & Children
Development
444.70 226.17 50.86 349.70 142.12 40.64 5261.86 3015.97 57.32
Labour & Labour
Welfare
15.71 14.77 94.05 71.12 71.10 99.98 409.28 220.87 53.96
Other Economic
Services
504.40 353.64 70.11 223.84 162.08 72.41 3274.64 2104.10 64.25
Total 7765.36 4802.26 61.84 7501.42 3849.13 51.31 97091.18 57106.88 58.82
Source: IKM
Economic Review 2011
516
1.3 Infrastructure Sector
15.17 Out of the total outlay in the Annual Plan 2010-11, 23% of funds had been earmarked for
infrastructure sector as against 10.8% in 2009-10. The expenditure during 2010-11 dipped to 59%
from 73% in 2009-10. But block panchayats and municipalities could utilise only 56.25% and 68%
respectively. Schemes aimed at energy security had a much better record with 68 per cent of the
allotted money having been spent. During 2010-11, all tiers of LSGs gave high priority to strengthening
transportation facilities by earmarking and spending more amounts than in the previous year. Against
the total allotment made in the infrastructure sector, 94.5% of the fund was earmarked for this purpose
and the corresponding achievement was 58.5%. For transportation and building sectors, LSGs had
earmarked 98% of the total outlay meant for the infrastructure sector. Many assets were created
during the last decade of decentralization. But the tendency of LSGs to focus on creation of new
assets without considering their up-keep called for correction. The allocation and expenditure details
in 2010-11 are given in Table 15.2.8 and the fgures in 2009-10 are given in Appendix 15.2.5.
Table No. 15.8
Infrastructure Sector- Development Sector wise Allocation & Expenditure during 2010-11
(` in lakhs)
Development
Sector
Grama Panchayat Block Panchayat District Panchayat
Alloca-
ton
Expr. % Alloca-
ton
Expr. % Alloca-
ton
Expr. %
Energy 660.54 536.52 81.22 34.71 32.53 93.70 23.62 16.20 68.57
Transportation 19101.62 14715.48 77.04 11641.16 6524.30 56.05 21797.67 9624.97 44.16
Building 902.23 561.26 62.21 227.68 138.93 61.02 170.74 38.65 22.64
Total 20664.39 15813.26 76.52 11903.55 6695.76 56.25 21992.03 9679.82 44.01
Projects ex-
cluded from
sectoral cealing
48894.98 40695.65 83.23 12430.11 10667.97 85.82 6704.55 6007.45 89.60
Development
Sector
Municipalites Corporaton Total
Alloca-
ton
Expr. % Alloca-
ton
Expr. % Alloca-
ton
Expr. %
Energy 186.89 152.20 81.44 487.54 208.85 42.84 1393.30 946.30 67.92
Transportation 5807.52 3907.41 67.28 4927.72 2258.87 45.84 63275.69 37031.03 58.52
Building 587.30 409.80 69.78 415.01 155.75 37.53 2302.96 1304.39 56.64
Total 6581.71 4469.41 67.90 5830.27 2623.47 45.00 66971.95 39281.72 58.65
Projects excluded
from sectoral
cealing
6593.60 5904.25 89.55 4983.53 5312.31 106.60 79606.77 68587.63 86.16
Source: IKM
2. Performance Under Special Sector Plans
15.18 Implementation of special programmes like the Women Component Plan and Plan for
Disadvantaged Groups (aged, children and disabled) since the Xth Plan had been a refreshing feature
of the States experiment with decentralization. According to the guidelines, LSGs were to earmark a
minimum of 10% of their total Plan outlay exclusively for projects which addressed the special problems
of women and 5% for disadvantaged groups. In the year 2010-11 also, LSGs adhered to it. They
Kerala State Planning Board
517
earmarked 17% for WCP and 10.9% for disadvantaged groups. The expenditure in WCP declined
from 72% in 2009-10 to 58% during 2010-11 and from 82 to 76% in the case of disadvantaged groups.
There had been other welfare-oriented schemes, like the Anti-poverty Sub Plan, meant for BPL
families. A review of the money spent on them showed that rural local bodies performed much better
than their urban counterparts during the period under review. Though Kerala achieved a breakthrough
in participatory poverty reduction programme through kudumbasree under the leadership of LSGs, the
benefts of anti-poverty policies and programmes did not reach the absolutely poor. So the mission
had to sensitize LSGs about their new role in poverty eradication. Ashraya was another innovative
project introduced under LSGs plan during Xth Plan period. It was a package for the destitute families
so as to avoid their social exclusion by improving their capacity and confdence. During 2010-11, an
amount of Rs.`1436.61 lakh was earmarked for this programme of which 70% of the share was that of
grama panchayats. Except for slum development and Ashraya, an increasing trend in spending during
2010-11 was noticed in all the sectoral plans and projects listed in the table below. The expenditure
in solid waste management increased from 54.13% in 2009-10 to 56.35% in 2010-11. As far as
LSGs were concerned, the implementation of solid waste management system was one of their prime
responsibilities in providing quality service. Therefore, conscious efforts had to be made at the level of
each local self-government for effective implementation of the system. The EMS housing programme
was a new initiative of the Government in the XIth Five-Year Plan of LSGs to provide shelter to all
houseless poor families. According to the fgures furnished by IKM, ` 422.79 crore was allocated in
the Annual Plan 2010-11, for this purpose of which as much as 83.5% was spent. Detailed fgures of
allocation and expenditure during 2010-11 are given in Table 15.2.9 and the fgures in 2009-10 are
given in Appendix 15.2.6
Table No. 15.9
Grant-in-Aid to LSGIs - Allocation & Expenditure of special sector plans during 2010-11
(` in lakhs)
Development
Sector
Grama Pts Block Pts District Pts
Allcn. Exp. % Allcn. Exp. % Allcn. Exp. %
Women Compo-
nent Plan
20651.10 12477.34 60.42 6744.08 5289.13 78.43 5213.27 2182.22 41.86
Aged 2469.74 1590.10 64.38 531.66 319.08 60.02 664.95 138.33 20.80
Children 8298.61 7503.67 90.42 2708.58 2460.03 90.82 1523.26 878.94 57.70
Economic Review 2011
518
Development
Sector
Grama Pts Block Pts District Pts
Allcn. Exp. % Allcn. Exp. % Allcn. Exp. %
Disabled 2595.34 1725.68 66.49 562.31 392.61 69.82 1013.69 434.64 42.88
Anti poverty sub
plan
16202.25 10975.79 67.74 5942.93 4696.54 79.03 4674.91 3164.34 67.69
Ashraya 1010.78 561.55 55.56 85.27 59.15 69.37 110.00 85.90 78.09
Solid Waste Man-
agement
136.83 64.31 47.00 8.60 2.88 33.49 135.31 95.45 70.54
Slum
development
290.29 149.15 51.38 87.26 28.00 32.09 345.16 162.49 47.08
E.M.S.
Housing
24164.86 19161.81 79.30 8808.67 7683.62 87.23 3248.07 2876.78 88.57
Sectors Municipalites Corporatons Total
Allcn. Exp. % Allcn. Exp. % Allcn. Exp. %
Women
Component
Plan
3200.12 1750.32 54.70 2875.66 659.51 22.93 38684.23 22358.52 57.80
Aged 180.90 112.85 62.38 236.96 82.22 34.70 4084.21 2242.58 54.91
Children 1316.31 1154.56 87.71 1251.50 1004.46 80.26 15098.26 13001.66 86.11
Disabled 302.63 263.02 86.91 469.95 230.98 49.15 4943.92 3046.93 61.63
Anti poverty
sub plan
1770.73 1081.67 61.09 1348.50 613.11 45.47 29939.32 20531.45 68.58
Ashraya 124.12 77.14 62.15 106.44 35.00 32.88 1436.61 818.74 56.99
Solid Waste
Management
53.15 25.50 47.98 0.00 0.00 0.00 333.89 188.14 56.35
Slum
development
3658.18 2715.00 74.22 2556.60 996.06 38.96 6937.49 4050.70 58.39
E.M.S.
Housing
3729.22 3376.72 90.55 2328.22 2226.67 95.64 42279.04 35325.60 83.55
Source: IKM
Financing of LSGs plans
15.19 The total Plan size of LSGs during 2010-11 was `8220.27 crore of which the Plan grant from the
Government constituted 35%. LSG own contribution constituted 11% and the contribution of the State/
Central, including externally aided source, came to 10%. LSGs mobilized the balance 44% of funds
as voluntary contribution, loan, benefciary contribution etc. There was an increase in the total Plan
size during 2010-11. LSGs took initiative to mobilize resources through other components, especially
from own funds. The quantum of own fund increased from Rs.878 crore in 2009-10 to Rs. 914 crore
in 2010-11, which was 43% of the expenditure against 51% in 2008-09. The break-up showed of the
total expenditure, Plan grant share was 54%, own fund share 9%, sponsored schemes together with
externally aided source 6% and the balance from other sources. Even though there was a 10% hike
in Plan grant to LSGs in the Annual Plan 2010-11, no proportionate increase was noticed in the Plan
grant utilization. There is need to strengthen and enable the local government to evolve a realistic
development vision and prepare a perspective plan to realize the vision. Source wise funding details
in 2010-11 are given in Table 15.2.10. The fgures in 2009-10 are given in Appendix15.2.7.
Kerala State Planning Board
519
Table No. 15.8
Infrastructure Sector- Development Sector wise Allocation & Expenditure during 2010-11
(` in lakhs)
Name
of LSGIs
Grama Pts Block Pts District Pts
Allocaton Expn. % Allocaton Expn. % Allocaton Expn. %
1 2 3 4 5 6 7 8 9 10
Develop-
mentfund
148018.83 104685.18 70.72 42351.53 28782.24 67.96 54348.23 29415.18 54.12
Own fund 75402.27 29654.11 39.33 1690.22 908.91 53.77 2886.89 819.31 28.38
State
Sponsored
18494.12 2048.35 11.08 765.48 121.73 15.90 804.85 161.99 20.13
Centrally
Sponsored
11571.49 3295.75 28.48 28862.72 14751.55 51.11 4105.04 633.77 15.44
Loan from
Co-Opera-
tive
52929.09 16365.07 30.92 6622.08 1011.05 15.27 7588.64 569.93 7.51
Externally
Aided
5618.07 724.17 12.89 484.76 153.41 31.65 909.17 46.82 5.15
Institu-
tional
Finance
41723.65 10134.83 24.29 8777.58 3733.43 42.53 7161.30 4.50 0.06
Voluntary
Contribu-
tion
1377.77 211.71 15.37 12.63 4.69 37.13 92.91 2.86 3.08
Benef-
ciary
contribu-
tion
19295.09 8026.44 41.60 2127.59 755.36 35.50 3295.96 1030.85 31.28
Others 126630.88 38519.29 30.42 23148.70 10307.53 44.53 15451.38 6403.86 41.45
Total 501061.26 213664.90 42.64 114843.29 60529.90 52.71 96644.37 39089.07 40.45
Name
of LSGIs
Municipalites Corporatons Total
Allocaton Expn. % Allocaton Expn. % Allocaton Expn. %
11 12 13 14 15 16 17 18 19 20
Develop-
mentfund
23029.34 16194.90 70.32 20502.65 12626.80 61.59 288250.58 191704.30 66.51
Own fund 5241.34 771.84 14.73 6221.15 264.95 4.26 91441.87 32419.12 35.45
State
Sponsored
1674.68 36.06 2.15 868.58 0.00 0.00 22607.71 2368.13 10.47
Centrally
Sponsored
5066.32 133.05 2.63 2384.64 104.94 4.40 51990.21 18919.06 36.39
Loan from
Co-Operative
6892.78 153.40 2.23 13262.61 0.00 0.00 87295.20 18099.45 20.73
Externally
Aided
597.36 16.23 2.72 92.60 0.00 0.00 7701.96 940.63 12.21
Institu-
tional
Finance
3968.29 1.00 0.03 443.71 0.00 0.00 62074.53 13873.76 22.35
Economic Review 2011
520
Name
of LSGIs
Municipalites Corporatons Total
Allocaton Expn. % Allocaton Expn. % Allocaton Expn. %
Voluntary
Contribu-
tion
124.79 1.38 1.11 668.85 0.00 0.00 2276.95 220.64 9.69
Benefciary
contribu-
tion
886.60 146.12 16.48 723.25 20.65 2.86 26328.49 9979.42 37.90
Others 6527.84 4598.22 70.44 10301.02 3928.66 38.14 182059.82 63757.56 35.02
Total 54009.34 22052.20 40.83 55469.06 16946.00 30.55 822027.32 352282.07 42.86
Source: IKM
The sub sector wise allocation and expenditure under productive and service sector during 2010-11
are given in Appendix 15.2.8 & 15.2.9 respectively.
Kerala State Planning Board