Maxim Is Ing The Reuse and Recycling of Clothes and Textiles
Maxim Is Ing The Reuse and Recycling of Clothes and Textiles
Technical Report
This report has been prepared by: Nick Morley, Ian McGill and Caroline Bartlett Checked as a final copy by: Reviewed by: Date: Contact: Katie Deegan Nick Morley 22 December 2009 [email protected]
Oakdene Hollins provides clients with technical and economic studies concerned with: management of wastes for recycling or energy recovery measurement of environmental impacts including LCA (life cycle assessment) policy analysis in the resource efficiency and global warming arenas innovation management, especially of clean technologies statistical analysis and interpretation in-depth market studies. For more information visit www.oakdenehollins.co.uk
Printed on recycled paper
December 2009
Contents
Glossary Acknowledgements 1 Introduction 1.1 Background 1.2 Scope and definitions 1.3 Aims and objectives Methodology Legislation and Policy 3.1 National 3.2 Definition of waste 3.3 Transfrontier shipment regulations 3.4 Door-to-door collections 3.5 Local Authorities 3.6 Recommendations Material Flow 4.1 Consumption 4.2 International trade in worn textiles 4.3 Textiles entering the waste stream 4.4 Textiles diverted from the waste stream 4.5 Summary of fates of discarded textiles Quality of Textiles 5.1 Quality of textiles in waste stream 5.2 Birmingham trial 5.3 Summary and recommendations Collection, Sorting and Reuse 6.1 Historical introduction 6.2 Motivating factors for disposal and exchange 6.3 Direct donation, exchange or sale 6.4 Bring schemes 6.5 Doorstep collection schemes 6.6 Sorting 6.7 Reuse markets 6.8 Models of clothing discard and exchange 6.9 Collection systems for other textiles 6.10 Conclusions and recommendations Overseas Examples 7.1 Japan chemical recycling 7.2 Finland whole life service
3 4 5 5 5 6 7 8 8 9 11 12 14 15 17 19 22 23 25 30 33 33 36 37 39 39 41 43 46 49 52 56 58 59 65 68 68 71
2 3
For Defra
Page 1
December 2009
France extended producer responsibility Germany design for end-of-life USA carpet recycling initiative
72 73 73
Barriers and Opportunities for Recycling 8.1 Design for Disassembly 8.2 Mechanical recycling of fabrics and clothing 8.3 Composting 8.4 Chemical recycling of post-consumer textiles 8.5 Textile recycling (carpet and rug) 8.6 Carbon impact of end-of-life options 8.7 Conclusions and recommendations
78 80 80 89 92 93 106 111 114 114 116 118 118 119 119 120 120 122 123 124
Quality Standards and Protocols 8.8 Collection of post-consumer textiles 8.9 Other material standards 8.10 Potential issues for developing standards for textiles 8.11 Recommendations 9 Summary of Recommendations 9.1 Legislation and policy (Section3) 9.2 Quality of textiles (Section 5) 9.3 Collection, sorting and reuse (Section 6) 9.4 Barriers and opportunities for recycling (Section 8) 9.5 Quality standards and protocols (Section 9)
References
For Defra
Page 2
December 2009
Glossary
ACS BATC BFA BIR BMW CA CAT C&I CRR CSR Defra DCSF DMT ECJ EfW EoL EU HWRC IL LATS LA LARAC MRF MSW NIEA NIRI NMMO OU PPE SATCoL SBR SEPA TFS TRA TRAID WCA WDA WFD WRAP
AssociationofCharityShops BritishApparelandTextileConfederation BritishFootwearAssociation BureauofInternationalRecycling BiologicalMunicipalWaste CompetentAuthority CharitiesAdvisoryTrust CommercialandIndustrial CentreforRemanufacturingandReuse CorporateSocialResponsibility DepartmentfortheEnvironment,FoodandRuralAffairs DepartmentforChildren,SchoolsandFamilies Dimethylterephthalate EuropeanCourtofJustice EnergyfromWaste Endof(First)Life EuropeanUnion HouseholdWasteRecyclingCentre IonicLiquids LandfillAllowanceTradingScheme LocalAuthority LocalAuthorityRecyclingAdvisoryCommittee MaterialRecoveryFacility MunicipalSolidWaste NorthernIrelandEnvironmentAgency NonwovensInnovation&ResearchInstituteLtd NmethylmorpholineNoxide OpenUniversity PersonalProtectiveEquipment SalvationArmyTradingCompanyLimited Styrenebutadienelatexrubber ScottishEnvironmentProtectionAgency TransfrontierShipment TextileRecyclingAssociation TextileRecyclingforAidandInternationalDevelopment WasteCollectionAuthority WasteDisposalAuthority WasteFrameworkDirective WasteandResourcesActionProgramme
For Defra
Page 3
December 2009
Acknowledgements
Thanksareduetomanyorganisationsandindividualsforassistingwiththis study,butinparticular: MembersoftheTRAandtheTRAsSecretary,MrAlanWheeler. SalvationArmyTradingCompanyLtd,TRAID,ClothesAid,Bag2School andothernonTRArecyclingorganisations. All other members of the stakeholder steering group, as listed in Appendix3.
For Defra
Page 4
December 2009
Introduction
1.1
Background
This project is one of three projects commissioned by Defra as part of the Sustainable Clothing Roadmap1. Studies on the environmental impact of products,notablytheEIPRO2report,identifyclothingashavingasignificant environmental impact over its lifecycle. Maximising reuse and recycling of clothinghelpstoreducethisimpact. Previous studies on UK clothing reuse and recycling34 have indicated that this is relatively low (between 14% and 22% of MSW). In addition the percentageoftextilesdiscardedaspartofhouseholdwastehasbeenforecast to rise more rapidly than other products or materials, albeit from a modest base5. These factors have led to consideration of policies such as extended producerresponsibilityonclothing67.
1.2
Thisprojectconsiderstheendofaproductsfirstlife(EoL),withascopethat includes domestic and commercial textiles such as carpets, corporatewear andtextile rental products,aswell asdomestic clothing.Itsscope includes closed loop recycling of textiles, but not textiles made from nontextile recyclates such as plastic bottles. Nor does it include postindustrial scrap suchasgarmentcuttings,butonlytextilesdiscardedafteruse. Textiles in this study are defined to comprise common consumer textiles such as clothing, carpet, bed linen, towels, whether they are provided via a corporate organisation (e.g. NHS uniforms) or purchased by the end consumer. Reuse of textiles is defined as the original product function (e.g. clothing reused as clothing to cover a body), whereas recycling is use of the
1
2
See http://www.defra.gov.uk/environment/business/products/roadmaps/clothing.htm
Environmental Impact of Products Institute for Prospective Technological Studies, European Commission May 2006 3 Well Dressed? Cambridge University, 2006 4 Recycling of Low Grade Clothing Waste Oakdene Hollins Ltd, Salvation Army Trading Co. Ltd., Nonwoven Research Institute, Defra WS Project WRT152, 2006 5 Modelling the Impact of Lifestyle Changes on Household Waste Arisings Maunder A. et al. Paper presented at Waste 06, Stratford upon Avon, September 2006 6 Clothing Recycling and Producer Responsibility Morley, N. et al. Paper presented at Waste 06, Stratford upon Avon, September 2006 7 Geffroy, V. Cas des dchets textiles des mnages en France : La responsabilit largie des producteurs Paper presented at Confrence Internationale Responsabilit des producteurs
For Defra
Page 5
December 2009
clothing material properties (e.g. absorbancy in a wiper; as a fire retardant nonwoveninamattressspringcover).Recycledtextilescanbeupcycledinto higher value or more technically demanding applications, or downcycled into less demanding, lower value applications. Such applications include shoddy, fabric made from the recycling of knitted products; mungo, fabric made from the recycling of woven products of consequently lower fibre length;andcottonragpapermadefromrecycledcellulosicfabrics.
1.3
For Defra
Page 6
December 2009
Methodology
The project is comprised of a desk and interviewbased study with some empirical work related to quality of clothing. It will follow on from the previous report by Oakdene Hollins on the recycling of low grade clothing waste(DefraWSProjectWRT152).Wealsodrawupondataandinformation that has beengathered fortheproject on corporatewearreusebeingcarried out by the Centre for Remanufacturing and Reuse, which is operated by OakdeneHollins. A literature/data review and survey of key stakeholders was carried out to clarify the information gathered and identify key themes. Quantities of clothingandtextilescollectedforrecyclinganddisposedofinthehousehold wastestreamwereestimatedusingavarietyofsourcesincludingsurveysby theAssociationofCharityShops,industryestimatesbykeyparticipants,and previous research on waste management statistics. In addition MEL Research were contracted to identify the quality of the textile waste stream disposed of in household waste and its suitability for reuse and recycling an evidence gap that was identified in the 2006 study. This was done not only by interrogation of MELs previous survey work on waste composition,butalsobyasortingtrialinBirminghamusingtextilerecycling andreusegradestocategorisetextilesfromresidualhouseholdwaste. Informationwasobtainedfromanumberofsourcesincluding: Internet searches i.e. business, academic, UK and overseas trade and industryassociationwebsites. Literaturesearchesi.e.tradeandacademicjournals,companyliterature, greyliteratureanddatasets. Clothing Roadmap stakeholders. Their input and feedback formed an important part of this study and was obtained partly through a stakeholderworkshopheldtopresenttheinterimresultsoftheresearch. Other key stakeholders who are not directly involved in the Defra ClothingRoadmapwhereappropriate(e.g.CarpetRecyclingUK,Reeds Recycling,SpruceCarpetTiles,etc.). SitevisitssuchastoIGCohen,WilcoxTextileRecycling. Therobustnessoftheevidencegatheredwasassessedintermsofcredibility, reliability and objectivity. Once collated, the information (qualitative and quantitative)wasanalysedtoformthebasisforthedevelopmentofaseries ofkeyrecommendations,devisedbyOakdeneHollinsandcirculatedamong ClothingRoadmapstakeholdersforcommentandreviewandthenincluded inthefinalreport.
For Defra Page 7
December 2009
3.1
National
Therelevantlegislationaffectingthesecondarytextilesindustryhaschanged very little in recent years; a summary of the major regulations is listed in Table3.1andTable3.2.
Table 3.2: Other Regulatory Measures affecting the Secondary Textiles Industry
Measure Landfill Tax Escalator Waste Framework Directive Information Currently (2008/2009) 32 per tonne, and increasing to 40 per tonne in April 2009. Currently 2006/12/EC in force, however, as of 12th December 2010, Directive 2008/98/EC to be fully implemented Financial incentive to WDAs to reduce landfilling. Recycling/reuse credits to collectors and re-processors.
For Defra
Page 8
December 2009
3.2
Definition of waste
ThedefinitionofwasteinforceintheUKisthedefinitioninArticle1(1)(a)of theWasteFrameworkDirective(WFD)(2006/12/EC)anditprovidesthat: wasteshallmeananysubstanceorobject...whichtheholderdiscardsorintendsor isrequiredtodiscard. The WFD is an EUwide directive, with each Member State responsible for translation into national law. In the case of the UK, Defra is responsible. Whether any particular substance falls within the scope of this definition is something that must be determined on the facts of each case, and the interpretationofthelawbytheCourts.Thereisnowasubstantialbodyof Case Law by the European Court of Justice on the interpretation of the WFDs definition of waste and the meaning of discard. The definition of wasteasregardsthetextilesdisposalstreamiscomplex. The issue arises as to when donations of clothing and textiles qualify as waste.Materialsreceivedfromdoortodoorcollectionsandthosedeposited atcharityshopsaredeemedasnonwaste,astheperceptionisthattheyare donated with the intention of reuse, as well as being of high quality and suitable for wear or reuse. Materials leaving charity shops, however, are expected to contain items too soiled or damaged to be suitable for reuse. Theseareclassifiedaswasteuntilsortinghasoccurred. Collections from textile banks are frequently incorrectly perceived by industrytobeclassifiedaswaste,astheyareexpectedtocontainunsuitable (e.g. soiled) material, or deposits of unwanted foreign objects. Interviews with industry members have highlighted confusion and uncertainty surrounding the matter. The Environment Agency, however, iterates that bankscollectingqualitytextilesareregardedascontaininglargelyreusable items,andthereforedonotfallunderthedefinitionofwaste. TheEnvironmentAgency8hasgivenadviceontheissue,thus: Secondhandclothesaredeemedtobeuseable,andthereforenotawaste,providing theyare: i. suitableforcontinueduseasclothes;and ii. beingexportedforsaleand/oruseasclothes. The Environment Agencys view is that textiles that are collected as secondhand goodsforcontinuedusefortheiroriginalpurposearenotwaste.Thiscouldinclude
Personal communication, Alan Owers, Environment Agency, 2009
For Defra
Page 9
December 2009
donations to charityshops,doorto door collections and textiles placedinbanksfor thispurpose. AccordingtoDefra9,severalyearsagotheEuropeanCommissionrequested Member States views on a draft information sheet (i.e. guidance) on the classification as waste ofused clothes.The responsefrom the UK included thefollowingextracts: After consultation with representatives of the organisations which are mainly responsibleforthecollectionofusedclothesintheUK,theresponsewasthatthese organisationsoperatethecollectionbanksonthebasisthatusedclothesareputinthe banks with the intention that they should continue to be used for their originally intendedpurposeasclothes;andthattheintentionofthosemakingthedonationsis thattheclothesshouldeitherbesoldasclothesorgivenforuseasclothestopeople who need them. These intentions are confirmed by the proportion of clothes which aftersortingissentbythecollectingorganisationsforcontinueduseasclothesand theproportionwhichisdisposedofaswaste.Defrawereadvisedthataftersorting onlyabout7%ofthecontentsofcollectionbanksforusedclothesaredisposedofas wasteintheUK;andthatasignificantproportionofthis7%comprisestheplastic bagsandothercontainersinwhichtheusedclotheswereputinthecollectionbanks. On the basis of this information, and taking account of the judgments on the definitionofwasteincasesconsideredbytheECJ,itistheUKsviewwasthatwhen usedclothesareputinacollectionbankwiththeintentionthattheyshouldcontinue to be used for their originally intended purpose as clothes then they have not been discarded as waste within the terms of the definition in Article 1(1)(a) of the Directive. In consultation with stakeholders elsewhere in the industry, this 7% is believedtorefertotruewaste,i.e.theproportionsenttolandfillnotsentfor recycling.Iftherecyclingproportionisalsoconsidered(officiallyclassedas waste until processed into a useful product), a higher percentage is considered to be present. Clothing exported for use as wipers or fibre recovery is classified as a waste, and carriers must abide by the TFS Regulations (see section below). However, if exported for sale as clothing, wasteregulationsshouldnotapplyandthereforetextilebankcollectionsare not listed as waste and are considered exempt from waste regulations. Whilst the findings of this report concur with 7% only of textile bank collection material going to landfill, it has been stressed by members of the UK sorting industry that this overlooks the ca. 3040% of textile bank contents that are not suitable for reuse, but only for recovery via recycling. Thedefinitionofwasteinregardtotextilebanksthereforedoesstillleadto confusion among industry members. The key issue appears to be whether thetextilesaredonatedinthebeliefthattheyaretobereused.
9
For Defra
Page 10
December 2009
The subject is further confused due to disagreement between the environmentalbodiesofdifferentcountries.TheEAhasacontrastingview toSEPAandNIEAontheissue:thelattertwoclassifytextilebankmaterials asawaste,causingproblemswithintheUKalone. It is important to note also that the WFD has recently been revised, with a new Directive (2008/98/EC) adopted in December 2008. The revisions will not, however, become transposed and implemented until December 2010. The revised WFD does not alter the definition of waste, but does include a range of measures to give greater emphasis on prevention of waste and maximisingthereuseandrecyclingofwastethatiscreated. There is some potential contention with this issue from other sectors, as operators of other recyclate banks may feel justified in asking for classificationasnonwaste.Theserecyclatebanksarenotseenascomparable however,asitisonlytextilebanksthatreusethemajorityofproductasis, ratherthanbreakdownthematerialforrecycling.
3.3
For Defra
Page 11
December 2009
Theissueisfurthercomplicatedbyinternationalregulations.Textilesappear on the European Waste List, and it is up to the Competent Authorities in eachofthecountriesoftheEUtodecidewhentextilesare,orarenot,waste. Therefore, clothing and textiles exported out of the UK legally may be deemed waste by another Competent Authority, leading to legal complicationsandpossibleimpoundingofgoods.Thisishighlightedwhen consideringtheUKalone,whereEnglishandScottishEnvironmentalbodies disagreeontheexactdefinitions. RevisionoftheWasteFrameworkDirective,however,isexpectedtoinclude textiles on the priority list of wastes for consideration under the End of Waste Mechanism, meaning an EUwide definition may be forthcoming within the following two years10. The Bureau of International Recycling11 iterates that the European Commission is due, in the near future, to start defining the exact criteria for when a waste becomes such and when it is still a product. The beginnings of these findings are expected within the year, with textiles alongside other materials and products such as metals, tyresandglass.Thisshouldsignificantlyreducethecurrentconfusion.
3.4
Door-to-door collections
TheCharityCommissionisthebodyresponsibleforregisteringcharities.If these registered bodies then wish to operate doortodoor collections of textiles,theymustrequestalicencefromeachindividualLocalAuthority(or in the case of London, the police) to collect in a particular area. Organisationsoperatingonanationwidescaleonregularoccasionsareable toapplyforaNationalExemptionOrderfromtheOfficeoftheThirdSector, meaning they are still bound by the same regulations, but do not have to apply in each authority district for each collection. Entirely commercial organisations wishing to collect textile donations in this manner, are not, however,boundbytheseregulations.Howeverthoseactinginpartnership with a charity (typically using the charity name/branding on bags and leaflets,andthenpayingthecharityapricepertonnecollected),arerequired tocomplywithcharitylegislation. The Charities Act is currently under review, and the regulation of these collections is potentially due to change. In a discussion with the Commission12 regarding the change in the Act, it was suggested that the regulationsarenotlikelytobeadjustedsubstantially,withtheonlypotential alterationbeingtheremovalofresponsibilityfromtheLocalAuthoritiesand
10
11
Personal correspondence Alan Wheeler, Textile Recycling Association, Dec 2008 Personal communication with Steven Mann at Charity Commission, Feb 2009
12
For Defra
Page 12
December 2009
police.CurrentinvestigationsarebeingcarriedoutbytheOfficeoftheThird Sectorassessingtheresourceimplicationsofsuchamove. Oneprobablereasonforthispotentialchangeofpositionistheoccurrenceof boguscollectors(organisationsmisrepresentingthemselves,forexampleas charitablewhen they arenot) andtheft,which iscausing asignificant issue forregisteredcollectors.Arecentstudybyindustrymembers13suggests14 20,000tonnesoftextileswerecollectedbyunregisteredorganisationsin2008. Collectionbycommercial,unregisteredorganisationsispermissible,butsuch organisations often try to appear charitable and are thus regarded by charities as bogus collectors. Industry estimates up to 3 million lost to charities each year due to this issue14 and high frequency of bogus collections(particularlyincertainhotspotareas)isperceivedtoreducethe inclination to donate textiles by households. Whilst there is some evidence that the public are generally better aware of how to recognise bogus companies,largelythrougheducationalcampaignsbyorganisationssuchas theAssociationofCharityShopsandClothesAid,theremaybeaperception of donor fatigue. A reduction in collection tonnage via this method may make it increasingly difficult for authorised organisations to continue in a sustainable manner; however no evidence was presented or was located to substantiatethisclaim. AccordingtotheCabinetOffice(OfficeoftheThirdSector)15,theaimofthe newlegislationispromotionofstrongerselfregulationbyindustry.Itisnot felt that resources available to the Office are going to be sufficient to police theentirecountry,particularlyinregardstotheftofcollections,asthisfalls under the bounds of criminal law, if, for example, one charitys bags are collected by another collector. Details are still being evaluated, however, withfrequencyofcollectionsbeingoneareaofinvestigation.Resultsofthe researcharenotdueuntilDecember2009. Ourowncontactswithlocallicensingauthoritiesindicateveryfewinstances ofrefusal.Thereappearstobelittleornoenforcementofregulationsandthe current management of frequency of collections in particular areas appears variable. The possible alterations to the Charities Act help regulate the situation, but only if the power to enforce is increased, which is unlikely. RemovalofLocalAuthorityresponsibilityisalsounlikelytocomeintoeffect until201011,andtheamendmentsdonotresolvetheissueofregulationof noncharity organisations. The use of an industrywide standard for collectors(charities,partnershipsandpurelycommercial),suchasastampof certification,maybeagoodwayofcontrollingcollections,thoughagreement as to what this should cover may be contended by different industry
Study carried out by ClothesAid, 2008 Association of Charity Shops and ClothesAid survey 2007 Personal communication with Mubin Jaigirdar, Cabinet Office, April 2009
13 14 15
For Defra
Page 13
December 2009
members. The use of a recognisable stamp on collection vehicles, may also allow the public greater opportunity to report thefts, which are often not noticed by the public. Charities with shops already have a code of good practiceforcollectionstheCodeofCharityRetailing.Thishasbeeninforce for nearly a decade and is a mandatory requirement for members of the Association of Charity Shops (ACS). A similar, but more widely incorporating,codeisrecommendedforagreaterstandardisationacrossthe wholeindustry.Suchacodeshould,forexample,clearlystatewhetherthere isanycharitablegainfromcollections,andifsohowmuch.Thiswouldbe mostsuccessfulifmarketedwellandthegeneralpublicaremadefullyaware ofthedetailsofsuchascheme. TheACShavealsodrawnupawidercollectioncodeforcharitiesthatdonot run shops, but wish to benefit from collections operated by a commercial partner. This is in a stage of consideration by the legal team and at Board level.Thismaygosomewaytowardsresolvinganumberoftheissues,buta codecoveringnoncharitycollectionsalsoisstillrecommended. Another potential method to reduce theft of bags, suggested by some industrystakeholdersthemselves,istoorganiseanindustrydrivenpolicing service.Whilstthismaybecostly,ifanumberofindustrymembersteamed togethertoprovidethissortofsetup,thenanyorganisationscaughttaking textile bags that did not belong to them could be arrested with the textiles reclaimed to the rightful collector. The savings made from prevented loss can be put towards the policing system, with the ultimate ideal being the organisationsbecomingtowaryofarresttocarrytheriskofstealing. Whilstthissortofsystemmayworkonasmallscale,itseemsunlikelytobe abletorun on a nationwide,ongoingbasis,withoutthetotalcostnegating anypreventedlossesmade.
3.5
Local Authorities
Local Authorities have specific targets set for reduction of household waste to landfill, through the Landfill Regulations. Targets for biodegradable wasteinparticulararedrivingtheincreaseofkerbsidetextilecollections,as 50%ofusedtextilesareregardedasbiodegradable.Astextilescanoftenbea challengingmaterialtocollect(comingledcollectionscancausesoiling,and reduce reuse/recycling potential for example), Local Authorities often involveexternalorganisationstoaidcollection. Third party credits Local Authorities can opt to pay third party organisations credits for diversion of materials from landfill, in the form of either recycling or reuse
3.5.1
For Defra
Page 14
December 2009
credits. (The option of reuse was introduced in 2006, to attempt to incentivise this higher waste hierarchy recovery route.) The payment of either of these is voluntary, however, so utilisation around the nation is irregular.AquestionnairesenttoallLocalAuthoritiesin2006gavearesult of49%ofrespondentspayingcreditsfortextiles,thoughthiswasfelttoover representthetruepictureasthoseLocalAuthoritiespayingcreditswerefelt tobemorelikelytorespond. Reuse credits do not appear to be a great incentive for textiles, and a small surveyofLocalAuthoritiesknowntoofferreusecreditsfoundonlyasingle Authority that paid these for textiles and this was only as a combination withfurniture.Theaveragepricepaidwas47.71,witharangeof44.1652. Theuseofcreditsisnotastrongmotivationgiventhehighcurrentpricefor textiles.Howeveritmaybemoreimportantinthefutureiftextilerecycling becomeseconomicallymoremarginal.
3.6
Recommendations
The legislation in place affecting the secondary markets and collection of textiles has changed very little since the previous report. However, the issuesraisedin2006donotseemtohavebeenresolvedadequately,withthe mainproblemsoccurringaroundtheclarityandenforcementofregulations involved.Specificrecommendationsareasfollows: Greater clarity is needed on waste definitions, particularly in regard to textile banks. Where the content is reusable, this is not defined as a wasteandassuchisexemptfromwasteregulations,andthisshouldbe more clearly disseminated to industry members. However, clothing which is exported unsorted should become more traceable, with recycling and reuse rates published by individual recyclers or industry bodies, in order to ensure responsible recovery methods are being carriedout. The TFS Regulations require stronger enforcement. Where textiles are deemed as waste, regulations need to be adhered to. This will discourage inappropriate export of unsorted garments, and will both stimulate UK sorting, and may reduce the occurrence of unregulated collections.
Currenthighpricesanddemandhaveprovidedastrongerincentivefor collectionthanLocalAuthoritycredits,andnorecommendationisgiven forgreaterinvestmentinthissystematthepresenttime.However,itis important to note: should current prices drop, this situation may be reversed.
For Defra
Page 15
December 2009
Increased communication between charities, legitimate commercial collectors and public authorities in regards to identification of bogus collections, and proper enforcement actions once these organisations havebeenrecognised. Development of a universal code of practice with regard to doorto door collections, to regulate frequency and, if marketed well, to enable the public to better both recognise and report bogus collectors and thefts.Thisneedstoincorporatebothcharitableandcommercialsectors. RemovalofthelicensingofdoortodoorcharitablecollectorsfromLocal Authoritycontrol. Focus on Trading Standards as the most appropriate enforcement authorityforboguscollectors.
For Defra
Page 16
December 2009
Material Flow
The different collection mechanisms are discussed in depth in Section 5. These,alongwithsomeofthetonnagesprocessed,canbeseenrepresentedin the map in Figure 4.1 overleaf. Commercial and exhibition carpet is not included in the process map, because it enters the nonmunicipal waste stream,andalsoastherecoveryopportunitiesavailablevarytosomedegree. SeeSection6.2.5foragreaterdiscussionofEoLoptionsforcarpet. The evaluation of tonnage of textiles consumed in the UK was challenging. PreviousreportshavebeenabletousedatasuppliedbytheBritishApparel and Textile Confederation (BATC), and the Office of National Statistics (ONS)todetermineunitnumberandvaluesforallcategories.Accordingto the ONS16, an increasing percentage of UK manufacturers have opted to suppress certain figures due to commercial sensitivity, as manufacture moves overseas. This has resulted in some data gaps in individual textile categories. Most collected textiles go towards reuse, either in the UK or abroad. The typical collection option has a number of secondary markets available to it, be they direct use themselves (e.g. charity shops reselling locally), sale to textile reprocessors in the UK, or export to be sorted and distributed overseas.Littleisknownaboutthefinaldestinationofexportedgoods,and thereforethetonnagetoresale(316,000tonnes)islikelytoactuallybelower, with some material unsuitable for wear, and some too badly soiled or damaged for any recovery and ultimately ending up in landfill. The proportion of recovered material is highly contended, with some industry membersbelievingittobelowerthan inthe UKresultingin asignificant quantityoftextilestoforeignlandfill.However,itismorelikelythat,dueto theinherentvalueoftextilesandtheinfrastructuresknowntobeavailablein anumberofthemorepopularexportcountries,anyunusableitemsarelikely tobereclaimedifpossible. Not all pathways had enough available data to provide breakdown of figures,butthosethatdidhavebeenincluded.ThefigureforUKsortingis difficulttoquantify,asmosttextilescollectedhavesomeverymarginalsort process, even if just to remove bulky foreign matter. Even if sorted in the UK,asignificantproportionisexported,tobesortedfurther.Thefigureof 100,000tonnesisanapproximationofthemoreindepthsortthatresultsin textilegradesbeingsegregated.
Personal communication with Nicola Smith of ProdCom, 2009
16
For Defra
Page 17
December 2009
For Defra
Page 18
December 2009
4.1
4.1.1
Consumption
Apparel FiguresonvolumesofapparelproducedintheUKinrecentyearshavebeen verydifficulttocomeby,withdataavailablebyvalueonly.Salesvaluesof newproductsfor2006accordingtotheBATC,areshowninTable4.1.
Table 4.1: Consumption of new apparel in the UK, in 2006 Sales by Value (m) 3,871 12,077 2,859 13,089
4.1.2
Household textiles Consumption of household textiles in the UK is shown in Table 4.2. This includesbedlinens,blankets,towelsetc,butdoesnotincludecarpetswhich arecoveredinSection4.1.3.
Blankets Bed linen Table linen Toilet/kitchen linen (incl. towels) Bedding articles Soft furnishings (incl. cushion covers) Sleeping bags Cloths/dusters etc Other Total Consumption (000 tonnes) 28.5 73.8 5.8 44.5 50.8 14.2 5.4 14.4 27.5 265
For Defra
Page 19
December 2009
4.1.3
Carpet 186 million metres of domestic carpet were sold in 2007 in the UK17. The average domestic carpet mass is 2kg/m2, giving a total of 372,000 tonnes consumedbyhouseholds. Total consumption of carpet in the UK for 2007 was 570,000 tonnes18, commercial and event carpet use is therefore taken to be 200,000 tonnes. DetailsofcarpetconsumedaregiveninTable4.3below.
4.1.4
Other arisings Whilstfootwearisnotofficiallyincludedwithinthisstudy,textilecollections often include these in total tonnage, and therefore arisings are noted for reference.Itisalsolistedforcomparabilitywiththeprevious(2006)report. TheBritishFootwearAssociation19reportedsalesfor2008at6billion.Atan average priceof 20 per pair, a totalof around 300million pairs weresold. The average mass of a pair of footwear is 500g, bringing a total of 150,000 tonnesoffootwearenteringthemarket(an11%decreasefromthe2006figure of 169,000 tonnes). The industry estimate is that only 5% of these are recoveredatendoflife. Mattress sales in the UK in 2007 had a value of 522.7m, or approximately 7.5m individualunitssold. Thisequatestoover160,000tonnesofmattress material sold, comprised of metal, wood and textiles, in both the covering fabricandfoamorsoftfabricstuffing. HealthcareThemassbalanceworkcarriedoutfortheNHSin200420gives textile consumption as 36,400t. This includes uniforms, bedding, towels, blankets and other textile products. This is not included as an additional arising, however, as it is believed that these items are accounted for
17 18 19 20
Carpet Recycling UK data, 2008 ONS data, 2007 Personal communication, Richard Kottler, 2009 Material Health, Best Foot Forward ltd, 2004
For Defra
Page 20
December 2009
4.1.5
elsewhere.Itwasfeltusefultoinclude,however,asitgivesanindicationof areaswherethetextilesarebeingused. Sales index UsinghistoricBATCdata,thegrowthinvolumeofnewclothingandtextile sales in the UK is displayed in Figure 4.2. Although the data are only available until 2005, the trend line is extrapolated to present an estimate of salesvolumeintheUKfor2007of2.04milliontonnes.Thisisamaximum tonnage, as the recent crisis affecting the global economy may have had an impact on sales, though most effects of this are believed to have occurred during 2008 onwards. Sales value has been steadily decreasing over a numberofyears,asimportsandvalueretailersoffergarmentsatlowprices.
180.0 160.0 Index (Year 2000 = 100) 140.0 120.0 100.0 80.0 60.0 40.0 20.0 0.0 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 Year Retail sales volume Retail trend
Usingthisfigureof2.04milliontonnes,andthearisingsinotherareas,itis possible to determine the approximate sales of clothing in 2007. Table 4.4 shows the breakdown of textile consumption in 2007. The clothing figure wasdeterminedusingthetotalgiveninFigure4.2andsubtractingfiguresin otherareas.Thesplitbetweenmens and womenssalesispresumed tobe the same as in the previous report. Only domestic carpet figures are included for the BATC index used, but commercial arisings are included below.
For Defra
Page 21
December 2009
Textile Mens clothing Womens clothing Household fabrics Domestic carpet Footwear Subtotal Commercial and event carpets Total Consumption (000 tonnes) 538 713 265 370 150 2,036 200 2,236
Total clothing sales are seen to be 1.25 million tonnes, an increase of 70,000 tonnesfromthe2003data.
4.2
Figure 4.3: Annual imports of worn clothing and other worn textiles per year, by country
120 100 USA Value ($million) 80 60 40 20 0 2001 2002 2003 2004 2005 2006 2007 Year Japan Poland Italy Germany UK Germany (05 data)
For Defra
Page 22
December 2009
The UK has more than doubled the value of intake of worn textiles since 2003,from$20mto$43.3min2007.Themoresizeableexportofusedtextiles also increased, climbing from $176.4m in 2003 to $360.5m in 2007, though dataisgivenin$,resultingincurrencyfluctuation(seeSection6.7.2).These trendsarepartlyduetogeneralincreasesinglobaltradeflowscausedbythe opening up of formerly closed markets such as Eastern Europe, and partly caused by the specific movement of textiles sorting into overseas markets andtheconsequentreimportofcertaintextilecategories.
4.3
4.3.1
Figure 4.4: Household waste composition, by waste category, 2005 and 2020
30%
25%
20%
2005
2020
15%
10%
5%
0% Garden Paper and Kitchen and board general household Glass Wood Scrap metal/ white goods Plastic Textiles Metal Packaging
Source: Maunder et al (2006) Modelling the impact of lifestyle changes on household waste arisings.
21 22
Mapping of Evidence on Sustainable Development Impacts that Occur in the Life Cycles of Clothing ERM for Defra
For Defra
Page 23
December 2009
Inasurveyofover1000streets,acrosstenyears,MELResearchstudiedthe composition of waste disposed of by households. Table 4.5 shows the average proportion of textiles in the household waste stream. This shows thatthepercentageoftextileshasbeenincreasing,butatalesserextentthan the decrease of total waste. This is likely to be due to increased recycling rates across other sectors reducing the quantity that households throw out, yet, whilst textile recycling has been increasing, it is at a slower rate than theseothermaterials.ThefullMELreportcanbefoundinAppendix1.
Table 4.5: Textile contribution to household waste since 2000. Year 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 Total Waste (Kg/hh/week) 12.57 14.98 13.87 16.37 14.04 11.22 12.94 10.70 9.86 9.54 Textile Percentage 2.83% 3.34% 3.61% 3.63% 4.14% 3.72% 4.13% 3.80% 3.79% 4.10%
TheapproximatenumberofhouseholdsintheUKis 26.5million23,givinga total textile quantity in the household waste stream of 539,900t per year. Textile arisings at HWRC sites are included in Section 4.4.5, but additional arisings occur in bulky collections, street sweepings and nonhousehold textiles. Data from Resource Futures puts this as estimate of 86,000t for England alone, though there is a believed overlap between nonhousehold waste and the commercial carpet waste accounted for elsewhere. Total additional textile waste for the UK is therefore estimated at around 75,000t, bringingnonHWRCwasteupto614,900t. Corporateclothingoftenhasashortservicelife,duetofrequentchangesof corporateimageandclothingcontractrenewals,anddesignusuallychanges every 24 years. The UK corporatewear sector was valued at 446m at wholesale prices in 2007, with 33.4m garments in use24. Approximately 11,000tonnesofapparelaredisposedofeachyear.Thisisnotincludedasan additional arising, however, as the textiles involved are typically discarded
23 24
M E L Research, 2009
Corporatewear UK Market Study, 2007-2012, 6th edition, Company Clothing
For Defra
Page 24
December 2009
4.3.2
tohouseholdwaste,thoughcorporatetakebackschemesarebecomingbetter established. Mattresses Mattresses are composed of metal, wood and fabric, and the covering and stuffing,whichmaybefoamorsoftfabrics.Between135and160,000tonnes of mattresses enter the waste stream per year, with this figure expected to rise to 160215,000 tonnes by 201625. These are a particular problem to dispose of due to their bulky nature and the difficulty of handling once soiledandwet.Atpresent,onlytwocompaniesintheUKappeartorecycle mattresses. One of these, Dreams, who also manufacture, express an inabilitytoobtainanendmarketforthetextile proportionduetoitslisting ascontaminatedonceitisusedasbedding.
4.3.3
Carpet 186 million metres of domestic carpet were sold in 2007 in the UK26. Assumingcarpetisreplacedassold,thesamefigurewillbeusedasentering thewastestream.Theaveragesquaremetreofdomesticcarpetweighs2kg, givingadomesticarisinginthewastestreamof372,000tonnes. A problematic carpet arising is that for the event industry. Much of this is used only for a single day, or week; typically no longer. According to industry sources, approximately 6,7508,025 tonnes of event carpet are laid each year, which equates to 5060,000m3 of landfill space. Whilst this is relatively small as regards to the overall figure of carpet, the short usage periodleavesthisinhighqualitycondition,andrecoveryshouldthereforebe prioritised. Commercial carpet raises the total quantity of carpet entering the waste streamtoaround570,000tonnesperyear27.
4.4
4.4.1
25 26 27
CRR Mattress Recovery Report, 2008 Carpet Recycling UK data, 2008 ONS data, 2007
For Defra
Page 25
December 2009
total of 250,000 tonnes of textiles processed through stores in 2008. This includes all donations to stores, whether directly from the public, or via doortodoor or textile bank collections. The breakdown of end use is summarisedinTable4.6.
Table 4.6: Fate of charity shop processed textiles, in 2008
End Use Resale in shop Sale to textile recycler Disposal to landfill Total Tonnage 62,500-72,500 175,000-185,000 2500 250,000 Percentage of Total 25-29% 70-74% 1% 100%
4.4.2
The Charity Finance Shops Survey 2008 had a similar order of throughput, though smaller. In discussion28, it was noted that the survey size was of a lowernumberofshops(5,591)andanumberofstoresdidnotgivefulldata; they were confident that 250,000 tonnes for all was a fair estimate, in agreementwiththesurveyfigures. The textiles sold on as rag, whilst not being suitable for resale within the UK, are often of high enough quality for resale overseas. The fate of these willbediscussedlaterinthechapter,Section4.5.Thisfigureisanecdotally risingduetotheperceivedreductionofqualityasaresultofcheaper,more widely available clothing, though the true extent of this is undetermined. The percentage of rag has increased from 68.7% reported in the 2001 ACS survey,toaround72%in2008,althoughthisactuallyappearstoarisefroma reduction in quantity to landfill than decrease in resale. Recent anecdotal evidencefromindustrymemberssuggeststhatsalesofsecondhandclothing through charity shops have actually seen an increase over the past months, due to lack of disposable income causing the public to be more cautious in spendingbehaviour.Publicdonationsareperceivedtobedecreasing,dueto lack of free money to replace clothing with new. Whether this becomes significantthroughouttheremainderoftheyearisyettobeseen. Textile banks As well as shop sales, charities are also responsible for a number of textile banks. Collections from these that pass through retail outlets are included within Table 4.6, but this is felt to be a small percentage of the total, dependentontheorganisation.Approximately6,500banksareoperatedby charitieswithshops29,andthesereceivearound60,000tonnesoftextilesper
28 Personal communication with Gareth Jones, Charity Finance, 2009 29 Personal communication with Lekha Klouda, ACS, 2009
For Defra
Page 26
December 2009
4.4.3
year. The industry projection is for a total of 11,000 banks around the UK; and taking an average of 9.23 tonnes per bank every year gives a total of 102,000tonnescollectedacrosstheUK.Thisalsocorrespondswiththetotal estimatedthroughthetonnagecollectedbytheleadingtextilebankoperator multiplied by the market share held. The results of a survey of textile reprocessors produced a larger quantity sourced from textile banks, of 165,000 tonnes. This is likely to be due to an overrepresentation of collectionsfrombanks,withanumberofthemajoroperatorsincludedinthe samplesurvey. For the purpose of this report, the total of 102,000t is to be used, as this is believedtobemoreaccurate. Door-to-door collections Many doortodoor collections by charities alone are sent to shops to be processed and therefore, to avoid double counting, are not listed here. However, a number of charities will partner with a commercial enterprise, allowing better recognition and reliability for the company, whilst allowing the charity to gain funding without having to organise and execute the collection itself. The textiles collected are largely sent directly overseas for reuse,withnoinvolvementofUKshops.Resultsofasurveycarriedouton textilereprocessorsin2009suggestthat78,000tonnesoftextilesarecollected inthismanner.
4.4.4
Local Authority collections AccordingtoanOpenUniversitystudy,thepercentageofhouseholdsinthe UK that are served by textile recycling has increased from 16.8% in 2002 to 31.8% in 2007. This correlates with the actual tonnage collected by Local Authorities(LAs),whichisshowninFigure4.5. 2007 saw a collection tonnage of 103,000 tonnes of textiles. However, as discussedinSection3.5.1,LAsoftenusethirdpartiestocollectthematerials, thoughitcountstowardstheir recycling target. These third partiesmay be commercial waste carriers, charities, or other organisations, and therefore double counting may be an issue. In the small sample of LAs questioned, only1522%ofcreditswerepaidtononcharityorganisations.Thisisagain obscured, however, as many LAs do not pay credits to commercial organisations,andthereforethepercentageofnoncharitycollectionsislikely to be higher. As charity collections are included in either shop or textile recycling figures, they are omitted here. A conservative estimate of 40% is taken,givingthetotaltonnageoftextilescollectedbyLocalAuthorities,tobe 41,200tonnes.
For Defra
Page 27
December 2009
120
100
Tonnage (000s)
80
60
40
20
4.4.5 HWRCs Household Waste Recycling Centres (HWRCs) are typical deposit sites for bulkiertextiles,suchascarpet.TheMELstudyshowsthattextilesatthese sites have been increasing as a proportion of total residual waste (Table 4Table 4.7). According to industry data, 310,000 tonnes of domestic carpet ends up in municipal landfill or EfW, both end paths likely to be largely through depositatHWRCs. Assuminga 5% household wastedisposal (i.e. in bin), from offcuts and small pieces of carpet, a total of 295,000 tonnes of carpet is estimated to pass through these centres. Using the 2007 data of carpets comprising 63% of textiles at sites, a total textile at HWRC figure is determinedof466,000tonnes.
For Defra
Page 28
December 2009
Year 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 Avg % Textile Waste 4.48% 2.27% 1.33% 7.22% 13.28% 15.34% 13.99% 12.71% 9.94% 17.57% Avg % Carpet Proportion no data no data no data 66.59% no data 70.57% 75.15% 76.30% 63.14% 65.32%
4.4.6
Schools Collections of textiles from schools is becoming increasingly more popular, withschemessuchasBag2School(runbyBag2TheFuture)andtheSalvation Army Trading Company Ltd Schools Collection Scheme having great success. Industry estimates place the tonnage collected at up to 20,000 tonnes. Local Authorities often pay third party credits (typically recycling, notreuse)toschools,andthereforethetonnagesarefrequentlyincorporated into LA figures. Other organisations collecting from schools have been included within TRA figures, and therefore this tonnage is believed to be accounted for elsewhere in the report, and is not included to avoid double counting. Carpets Thebreakdown ofdomestic carpet givenbyCarpet RecyclingUKisshown inTable4.8.
4.4.7
Table 4.8: Domestic carpet EoL management in the UK, in 2007 End Use Retained Recycled/reused Energy recovery Landfill (MSW) Landfill (trade) Total Tonnage 18,600 1,860 15,996 293,694 41,850 372,000 Percentage 5% 0.5% 4% 79% 11% 100%
For Defra
Page 29
December 2009
4.4.8
Direct reuse Afairlyrecenttrendinreuseistheresaleordonationofitemsdirectly,with nomediator.WebsitessuchaseBayandFreecycleofferindividualsmeansto sell or give away garments or other textiles with little traceability. The popularityofthesesitessuggeststhattonnagespassingalonginthismanner aresignificant,butactualtonnagesaredifficulttoquantify. Data from bigwardrobe.com on the typicalnumberoftradesincomparison to listings, gives an average of 2.6 items sold per kg of clothing listed. Allowingfordoublecountingoforganisationsincludedelsewhere,andend oflineclothing,around1,000tonnesofclothingperyearappearstobesold throughwebsitesecondarymarkets.SeeSection5.3.2forgreaterdiscussion ofthesesales.
4.5
Resale in UK Export reuse Wiper grade UK Export for wiper Recycling - UK Export for recycling Waste Total
Table 4.9 shows the tonnage of textiles recovered in the past few years has increased by around 200,000 tonnes. Over 140,000 tonnes of this is an
For Defra
Page 30
December 2009
4.5.1
increaseintextilesbeingexportedforreuseoverseas,thoughresaleintheUK has also shown a substantial growth. The final fate of the textiles exported forreuseisnotfullyunderstoodhowever,andaproportionofthe316,000tis likelytobeunsuitableforwear,andthereforeeitherrecycledordisposedof to landfill. Without greater transparency in the industry, it is difficult to determinethesizeofthissegment.Overall,reuseaswipersandrecyclingof fibres has seen a decrease, though export tonnages for each have displayed anincrease.ThetenthousandtonnesgivenforrecyclingintheUKmaybe slightly misleading,however,asthe actual recyclingoftextilesintheUKis higherthanthis,believedtobearound27,000t.However,muchofthetextile issourcedfromforeigncountries,orisexportedasclothingandreimported backforprocessingintheUKafterithasbeensortedandbestqualitypieces takenoutforresale.Industryestimatesputthesefiguresasfollows: TotalUKsourcedtextiletorecycling38,000t o 10,000tUKsourced,UKsortedandUKprocessed o 21,000tUKsourced,overseassortedandprocessed o 7,000tUKsourced,overseassortedandreimportedtoUK. TotalnonUKsourced o 10,000toverseassourced,UKprocessed. Thisgivesatotalof27,000tthatisavailabletoprocesswithintheUK. Summary of arisings and fates Table4.10summarisesthedifferentmethodsofEoLmanagementoftextiles in the UK, in 2007. For comparison with the previous reports figures, and also due to the fairly varied disposal route (through C&I waste stream), commercialandexhibitioncarpetisexcludedfromthistable. 523,000 tonnes of textiles were collected in the UK for recovery in 2007, a substantialincreaseoverthe2004/5dataofthepreviousstudy.Only25,000 tonnes of the textiles collected (1% of total consumption) were deemed unsuitable for any recovery option, and therefore were disposed of to the wastestream,resultingin498,000tonnesactuallyrecovered. Anadditional100,000tonnesarebelievedtobegivenawaydirectly,between family members and friends, but as this process does not involve a third party, and is basically a life extension of the garment, the figure was kept separatefromtheotherrecoveredtextiledata. The figure for textiles to trade waste is largely due to domestic carpet collectedbytradespeoplefordisposal,andthisfigurealsoconcurswiththe CarpetRecyclingUKdata.
For Defra
Page 31
December 2009
000 tonnes Apparent consumption of new textiles Imports of used textiles Consumption of used textiles Total consumption Textiles entering the MSW waste stream Textiles collected for resale and recycling Of which: Resale for reuse in UK Exported for resale for reuse Recycled in UK Exported for recycling Rubbish, returned to waste stream Net textiles diverted from waste stream Textiles directly given away Textiles to trade waste Textiles unaccounted for Textiles already accounted for 2,036 24 206 2,266 1,081 523 106 316 23 52 25 498 100 44 310 206 23 4 2 14 9 100 47 24 000 tonnes % of new consumpt ion
Theoverallconsumptionisshownat2,266,000toftextilesperyear. Dueto thereuseofclothing(206,000t)alreadybeingwithinthesystem,thisdoesnot increasethetonnagetobedisposedofasthereisanissueofdoublecounting. The actual quantity of textiles to be disposed of therefore lies at the 2,060,000t,andusingthisfigureastheactualconsumptiongivespercentage totalofdisposalmethodsas100%,buttheconsumptionofsecondarytextiles wasfelttobeimportanttohighlightasaninput,hencethetotalEoLoptions areshownas91%ofthetotalconsumed,with9%accountedforalready. As found with the previous report, a considerable quantity of textiles was unaccounted for, and believed to be part of the national wardrobe. This tonnage has decreased from 397,000 tonnes in 2004/5 to 310,000 tonnes in 2007.Apartofthisfiguremayalsobeaccountedforbyincorrectlyrecorded disposalroutes,potentiallyincreasingfiguresforlandfilland/orincineration.
For Defra
Page 32
December 2009
Quality of Textiles
5.1
30
ONS Labour Force Survey (LFS)
For Defra
Page 33
December 2009
10 9 8 % TEXTILE WASTE 7 6 5 4 3 2 1 0 2000 2001 2002 2003 2004 2005 2006 2007 2008
REUSABLE CLOTHES & SHOES KG/HH/WK RESIDUAL KERBSIDE WASTE OTHER TEXTILES MIXED TEXTILES
Figure 5.2: Textiles discarded according to socio-demographic group
For Defra
Page 34
December 2009
basedon2001censusdata,andsinceregularlyupdated.Thesurveysorted households into six broad categories A to F with A broadly being the most affluent householders and F the least affluent. The system was further upgraded and classifies households on a rating of between 1 and 5; again with1broadlybeingthemostaffluenthouseholdersand5theleastaffluent. TheMELreportgivesafulldescriptionoftheAcornclassificationsystem, includingdetailsofeachcategorywithinit. Usingsociodemographicdata,itappearsthathouseholdsinthelowerAcorn groups discard the greatest tonnage of textiles (Figure 5.2) and the highest percentage of textiles as proportion of total waste. From the compositional analysis it is seen that each household appears to be producing between 0.15kg/hh/wk(Acorn1)and0.91kg/hh/wk(Acorn5)oftextilewasteintheir residualsacks. Figure5.3showsthatthepercentageoftextilewasteatHWRCsiteshasbeen increasing fairly sharply over the decade, though year by year the values vary. As discussed in Section 4.4.5, carpet is known to be the largest percentageoftextilewasteatHWRCsites(65%in2008)andthereforecarpet wasteoffersopportunityforimprovedcollectionandrecovery.
Figure 5.3: Average kerbside residual waste generation rates
20 18 16
KG/HH/WK KERBSIDE RESIDUAL
% TEXTILES KERBSIDE RESIDUAL WASTE % TEXTILES HWRC RESIDUAL WASTE KG/HH/WK KERBSIDE RESIDUAL WASTE
14 12 10 8 6 4 2 0 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008
20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0
% CONCENTRATION TEXTILES
For Defra
Page 35
December 2009
5.2
Birmingham trial
MELcarriedoutanassessmentofhouseholdwastediscardedbyresidents inBirminghaminJanuary2009.TheMELResearchcollectionteamvisited the designated streets on the same day and as near as possible to the same time as the usual collection. Waste from approximately 50 properties was collectedfromeachstreetusingbulkbagsandtakenawaytobesortedatthe designated waste site. Textiles present were sorted into specific grades for recycling,asshowninTable5.1.
ACORN % Recyclable textiles in residual waste Proportion of textiles potentially recyclable Clothing for re-use / export Material for rags Flocking materials Jazz materials Selfshade materials Wool Shoes (pairs) - 14 Misc recyclable accessories 1 2 3 4 5 Combined Bham weighted 3.65% UK weighted* 3.08%
0.79%
2.74%
3.43%
2.14%
5.44%
3.01%
45.23%
30.27%
91.91%
52.17%
62.08%
56.87%
61.15%
60.80%
Recyclable element of residual textiles 51.38% 8.87% 0.00% 8.26% 8.87% 0.00% 17.43% 5.20% 36.31% 22.36% 3.76% 0.00% 0.00% 0.00% 36.31% 1.25% 16.99% 1.41% 0.00% 8.27% 9.60% 3.52% 58.54% 1.67% 57.87% 6.38% 0.00% 8.70% 11.69% 0.00% 8.89% 6.47% 47.25% 4.65% 0.28% 5.18% 10.47% 0.00% 30.07% 2.09% 42.46% 6.25% 0.49% 6.08% 9.43% 0.68% 31.73% 2.88% 42.11% 5.12% 0.34% 6.14% 9.96% 0.73% 32.96% 2.65% 39.79% 5.32% 0.37% 6.29% 9.62% 0.96% 35.04% 2.61%
There are numerous grades of recyclable textiles, but overall categories can bedescribedasfollows: Flocking materials a fairly generic term when used in the rag trade, which does not identify quality or wool content. Can be mungo (a fibrousmaterialmadeinthewoollentradebypullingneworoldhard wovenormilledfabricorfeltinragform)orshoddy(fibrousmaterial madefromoldknittedorlooselywovenfabricinragform). Jazzmaterialsacrylic orsyntheticmixedcolourknittedmaterial.The fibres are usually finer than some other outer garments and the yarns usedaregenerallysofterwithlowertwistlevels.
For Defra
Page 36
December 2009
Selfshade(unicolour)materialstraditionallyusedforrespinningand remanufacturingintoknittedgoods,orforweavingintoblankets.The fibre composition is most likely to be made up of wool, cotton, viscose andacrylicinvaryingamounts.
Across Birmingham around 6% of residual waste is due to textiles; the equivalentof0.50kg/hh/wk.Around61%ofthesetextilesareofarecyclable typeandthesematerialsrepresent3.7%or0.31kg/hh/wkofresidualwaste. All of the sorted textiles were grouped into subcategories ranging from thosesuitableonlyforlandfilltothosewithlowgradeusessuchasindustrial ragsandfinallyclothingwithimmediatereusepotential. Of the textile waste analysed from the Birmingham samples 42% of recyclable textile waste is reusable clothing with an additional 33% due to pairs of shoes together these contribute three quarters of all recyclable materials. OverhalfoftherecyclabletextilesinAcorns1and4wereseentobereusable clothesandinAcorn3almost60%ofrecyclabletextileswereduetoshoes. The concern that lower quality fast fashion sales are likely to reduce the opportunityforreuseseemslargelyunfounded,asthereappearstobeample available textile still suitable for reuse being discarded to bins. If it is unsuitable for wear, there is significant opportunity for further recovery through recycling processes, and therefore this is an area which would be worthfocusingontotrytodiverttheuseableresourcefromlandfill.
5.3
For Defra
Page 37
December 2009
worthwhile and should be encouraged, particularly that lower value textilesarestillworthrecycling. Targeting of lower sociodemographic households will yield higher percentages of textiles. Partnerships with textile collectors should therefore ensure that higher sociodemographic households are not selectedattheexpenseofothers.
For Defra
Page 38
December 2009
6.1
6.1.1
Historical introduction
Reuse ThereuseofclothingintheUKhasalongtraditiondatingbacktoatleastthe sixteenthcentury.Until relatively recently, materialgoodssuchasclothing retainedmanyofthefunctionalelementsofmoney,asmediumsofexchange and repositories of practical value31. The trickle down of clothing from the morewelltodocombinedwiththeviewofclothingasnotonlyasdesirable initsownrightbutalsoasaninvestmentwhoseliquiditywasassuredbya network of brokers and pawners. Centres of apparel dealing became established in Elizabethan times in places such as Thieving Lane, Westminster and outside Londons city walls in Houndsditch. Changes in fashion could damage this investment, leading to the need to seek out secondarymarketswherefashionschangedmoreslowly,bothwithintheUK amongpoorerpeoplewhohadlesschoiceovertheirpurchasedecisionsand overseas.Inthenineteenthcentury,frockcoats,wigsandbuckskinbreeches allfoundmarketsinruralIrelandand(then)BritishNorthAmerica,having become unfashionable in England32. With the growth of an increasingly monetised middle classes, such purchases became restricted to poorer parts ofsocietyandthedealingnetworkslikewisedeclined.
Thereductionintherealvalueofclothinginthetwentiethandtwentyfirst centurieshasmeantthatclothesnolongerrepresentasignificantlyrealisable investment, although there does remain a latent desire for reward and a feeling of intrinsic value in the clothing. However the current patterns of clothing reuse, both within the UK and overseas, should be seen as arising from the evolution of a long historical tradition of second hand clothing flows,ratherthanasarecentintroduction. During the late twentieth century, the reuse markets became of greater importancetothefateofsecondhandclothing.Thiswasduetoanumberof factors: Thedeclineofthetraditionrecyclingmarketsfortextilessuchaswipers, caused by the decline of traditional industries such as engineering and shipbuilding.Thishasledtoagreaterneedfornewmarkets.
31
The Second Hand Trade in England c. 1600-1850 Lemire, B. in Old Clothes, New Looks: Second Hand Fashion Palmer, A., Clark, H., (eds), Berg 2005 pp29-47 32 Lemire, ibid
For Defra
Page 39
December 2009
Thegrowthofarelativelyprosperousmiddleclassinmanydeveloping countries, demanding better quality or fashion than available from indigenoustextilesuppliers,butunabletoaffordnewimportedclothing. The growth and liberalisation of international trade, making exports to countriessuchastheformerSovietBloceasier. TheincreasingexposureofdevelopingandformerSovietBloccountries to western culture, either through television/advertising or direct experienceofvisiting/working,leadingtoanacceptanceoforaspiration forwesternfashionsandbrands.
6.1.2 Recycling The collection of used textiles for recycling has also had a long history. In 1808,aletterfromapapermillintheDerbyshirePeakDistrictinaMethodist Magazinecomplainedyourpetitionerhumblyconceivesthattheinhabitantsof theUnitedKingdomarenotsufficientlycarefultopreservetheirrags.,reflecting thepositivevalueofmostusedtextilesasfeedstocksforlowergradeclothing such as shoddy or mungo, or as feedstock for industrial processes such as papermaking,orforwipingrags.Someoftheserecyclingapplicationsstill exist (or have only recently ceased) in the UK, although they are more prevalentindevelopingcountries. Collection for recycling continued via rag and bone merchants and the informal recycling sector alongside the later development of charity organisationsandconventionalwastemanagement.Factorsinfluencingthe recyclingmarketsinclude: the uptake of more synthetic polymers such as acrylics and polyesters, someofwhichlackrobustrecyclingmarkets the greater use of fibre blends (e.g. with elastane) which has made recyclingmoredifficult newapplicationsinwhichrecycledtextilescanbeused(e.g.automotive sounddeadening) thedeclineoftraditionalhistoricalUKmarketsforwiperssuchasheavy engineering,duetostructuralchange,andprinting,duetotechnological change. MarketsforrecycledtextilesaredescribedinmoredetailinSection8.
For Defra
Page 40
December 2009
6.2
Research on the public perception of sustainable clothing36 identified the followingbehavioursingettingridofclothes: Mainlyperiodicdisposalpatternsduetoclearoutsorlifechanges.
33 34 35 36
Second Hand Cultures by Gregson, N., Crewe, L., p119 Berg 2003 Gregson et al, ibid Oakdene Hollins Ltd, 2006 ibid Public Understanding of Sustainable Clothing Defra 2008
For Defra
Page 41
December 2009
Hence, fromthis research,opportunitiesfor increasingrecycling/reuserates wereidentifiedas: increasingtheconvenienceofcollection communicatingthatcharitiescanbenefitfromunreusableclothing beingrecycledasfibre promotionofmoredirectexchangeofclothingbetweenindividuals. Evidencefromearlierstudiesonsecondhandgoods37indicatesthattheroute chosenmaydependuponanindividualsdispositiontowardsphilanthropy (helpingcharitiesandotherpeople);desireforsustainability,socialequityor lackofwastefulness;orthedesiretomakesomemoney. Different reasons for disposal/exchange exist for the other nonconsumer clothinggroupswithinthisstudy: Corporate clothing: change of corporate style/identity; physically wearingout;replacementafteraspecifiedtimeperiod. Carpet: physical wear/staining; refurbishment (particularly contract carpets); change of house or office; change of fashion e.g. to laminate flooring Linens,bedsheetsetc:physicalwear;replacementafteraspecifiedtime period(contract/textilerental).
37
Only those clothes deemed fit for reuse are given to charity. There is littleawarenessoffabricrecycling. Charity shops and doorstep collection are seen as most convenient, rather than selling. When recycling/reuse is inconvenient, clothes are liabletobethrownaway. Cheapclothesaremorelikelytobediscardedtothebin,butexpensive goodsaremorelikelytogotocharity. Cheap clothes are more likely to be thrown away after a short period. Thereislessevidencethatfashionaffectslengthofuse. Families and women sometimes swap clothes. Childrens clothes are frequentlypassedon. Unwantedclothesarerarelysold,buteBayisanemergingmarket. Therewasnosignificantvariationbetweendifferentconsumersegments asregardsgreenpurchasingbehaviour. Alatentdesireforrewardforthedonationofgoodqualityclothes.
For Defra
Page 42
December 2009
6.3
Method of disposal
Source: Identity, Mobility and the Throwaway Society Gregson, N., Metcalfe, A., Crewe, L., Unpublished paper, 2008
For Defra
Page 43
December 2009
Ashortquestionnairestudyin2006,albeitwithnonrandomisedselectionof 250respondents,identifiedbroadlyconsistentbehaviour.
Figure 6.3: Fate of clothing on having a clear out
70% 60% Percentage of clothing 50% 40% 30% 20% 10% 0% Taken to charity shop Given to friends/family Clothing bank/thrown away Sold
Disposal method
Source: Recycling of Low Grade Clothing Waste Oakdene Hollins et al, 2006
6.3.1
Direct donation Direct donation appears significant, but is not as high as charity donation. SinceitappearsthatthesurveyrespondentsinFigure6.3underestimatedthe volumes of clothing sent to waste, the best comparator is likely to be the volumes sent to charity shops and textile banks. In this case, the approximateratioofclothingdonatedtofriendsandfamilywasjustundera third of that donated to charity in both studies. This equated to around 100,000 tonnes per year in 2006. No data on trends in direct donation are available, but expectations over the long term are that donations between friendsandfamilyaredecliningdueto: geographic dispersal of extended families making exchange within familiesmoredifficult greateraveragewealthcombinedwithlowerrealclothingpricesmaking clothingdonationlessvaluedbytherecipient morefrequentchangestothestylingofschooluniforms(whichareone of the categories believed to be donated frequently) sold by major retailers and supermarkets such that unfashionable uniforms from previousyearsarereadilyidentifiableandthereforelessattractive.
For Defra
Page 44
December 2009
6.3.2
Howeverdonationofitemsbetweenunknownindividuals,mediatedbythe internet through sites such www.freecycle.com, has shown strong growth Freecycleclaimsa35%increaseinmembershipin2007/08,givingatotalUK membershipofaround1.5mpeople. Direct selling and swapping Sellingorswappingclothingappearstobeoflowsignificanceinthestudies cited. However recent innovations, including internet mediated sale or exchange, are a growing area: selling clothes on eBay is mentioned in a number of studies38, and in the clothing questionnaire survey referenced in Figure6.3above,theproportionofrespondentsunderthirtyyearsoldselling on eBay rose to 5% compared to 2% for the sample as a whole. The main mechanismsare: Auction sites: eBay dominates this area, with around 2.14m listings of clothing in April 2009. This compares to the next largest UK sites www.cqout.com (51,000 clothing listings) and www.tazbar.com (7,000 clothing listings). eBay contains individuals selling their own clothes, traders in second hand clothes with electronic stores (e.g. for vintage clothes), and traders selling end of line or otherwise obtained new clothing. Swap and sale internet sites: This is a strongly growing segment: www.bigwardrobe.com claims to be growing at 20% per month, with 32,000 listings in April 2009, mainly of womens clothes and bags. Approximately75%ofclothingisswappedand25%issoldonthissite. Mostoftheclothingisgenuinelysecondhand(asopposedtoothersites suchaseBaywhichhaveendoflinenewclothingaswell).Someitems are listed on both its site and on eBay39. Other sites include www.whatismineisyours.com (which claims 22,000 regular users and 33%growthinswapswithintwomonths)andwww.fashionspace.com. Swapeventssuchasvisaswap(www.visaswap.com)whichisorganised in collaboration with the charity TRAID, a major clothes collector and seller, and swishing parties organised by or inspired by the work of sustainability public relations company Futerra (www.swishing.org). Volumesswappedphysicallyareverylowintonnageterms,forexample the last visaswap event involved 2,151 items of clothing, or around 0.8 tonnes. However such events raise the public awareness and possibly theimageofclothesswapping. Classified advertisements, which may be via the internet (e.g. Gumtree.com, vivastreet.co.uk, adtrader.co.uk, preloved.co.uk) or via hardcopysuchaslocalnewspapers,orfreeclassifiedpublicationssuch
38
Public Understanding of Sustainable Clothing Nottingham Trent University and Sheffield Hallam University, Defra, November 2008 39 Bigwardrobe.com, private communication
For Defra
Page 45
December 2009
asFridayAd(whichisalsoonline).Muchoftheclothescontentofthese sites appears to be endofline rather than used clothing i.e. they are similartoonlinemarkettradingstalls. There are also car boot and garage sales, although anecdotally the clothescontentofthesetendstobelow.
Hybrid approaches are also evident: for example some charities will sell items on their eBay sites on behalf of individuals, retaining a percentage of the sale price. In addition, charities will list the better items (including vintage)ontheirownwebsitesoroneBay. Generally the lowering of advertising and transaction costs, made possible bytheinternetandinnovationsinlowcostelectronicpayment,hasmadethe sale, donation or exchange of even lowcost clothing possible via web sites. Theincreasingfamiliarityandtrustofinternetbasedfacilitationmeansthat this approach is likely to increase in popularity. A continuation of average price decreases in clothing would affect this approach negatively, as would increasingrelativewealth.
6.4
6.4.1
Bring schemes
Charity shops Charity shops are a major collection and sale point for clothing. The total numberofcharityshopsintheUKisaround7,500.Almostalloftheseactas collectorsofusedclothing,althoughwith,anincreasingnumberofspecialist shops,notallsellclothing.Charityshopoperatorsalsousetextilebanksand doorstep collection methods, which are discussed later. Thrift shops collectingandsellingusedschooluniformsarealsoincludedinthiscategory. Certain charityshops haveintroduced intermittentor permanent incentives for the return of clothing. This includes swap shops where the public receivescreditsforitemsreturnedtoacharityshopwhichcanthenbespent in the shop. A recent high profile scheme has been the issue of Marks and Spencer(M&S)vouchersbyOxfamforM&Sclothingreturnedtotheirstores. This has approximately doubled the volume of M&S clothing handled by Oxfam,withnodecreaseinquality40.Cannibalisationofdonationstoother charity shops is likely, so that the figures cannot be simply extrapolated to estimatetheschemesimpactonrecyclingandreuse. Although there may be some physical limitations on those shops that carry outbackofstoresortingasopposedtoregionalorcentralisedsorting,there
40
Oxfam, Private Communication
For Defra
Page 46
December 2009
6.4.2
appear to be few barriers to increased volumes of used clothing being collectedthroughcharityshops. As outlets for resale, charity shops have increasingly diversified into items other than clothes, such as books, toys and fairly traded new items, as increasing competition in clothing emerges from lowpriced new clothing suppliers such as Primark and George. However the recent high price of charity rags (the proportion of clothing sold on to textile recyclers after the cream has been removed for sale in the charity shop) has benefited charity shopsasmajorcollectorsofusedtextiles. Charityshopshavepreviouslycomplainedabouttheincreasingcostofwaste disposal andthedegreeto which customershave giventhem itemsonly fit for residual waste disposal. Therefore the communication of a desire for cheap and even damaged textiles which can be mechanically recycled, but avoiding textiles which are damp or are so contaminated they must be treatedasresidualwaste,mustbecarefullymanaged. Therecenteconomicdownturnappearsalsotohavebeenhavinganaffecton charity shop donations. Anecdotal evidence suggests that the public are holding on to clothing due to lack of disposable income to replace it with new.Forsimilarreasons,purchasesofsecondhandclothinghaveincreased atthesametime.Thiswasreported41tohaveresultedinaproductforthe sorteroftextilesthatislowerinqualityandsmallerinquantity. Textile and clothing banks The number of textile and clothing banks in the UK is around 11,00042. Combined with approximately 7,500 charity shops and also HWRCs there are approximately 18,000 bring sites for textiles which form around 3% of householdwaste.Thiscomparesto5060,000bottlebanksavailableforglass which forms around 6% of household waste. This might indicate scope to increase the number of bring sites for textiles, however the different consumerbehaviourintextiledisposal(associatedwithmoreconsideredand periodicclearouts)mustalsobeconsidered. Temporary banks are also established by charities and contractors such as SalvationArmyTradingCompany,forschoolcollections.Anotherexample is Bag2School, who offer a scheme whereby children are given bags to take home:allthebagsarereturnedonaparticularday,whenacollectionvehicle willtransportthemawayfromthepremises.Thisreducesneedforstorage space at the school premises. Whilst not technically a bank, the scheme is
41
Bureau of International Recycling (BIR) June press release available at: http://www.bir.org/biruk/press/322PostDubaiTextiles.pdf 42 Average estimate from industry, including Salvation Army and ACS, 2009
For Defra
Page 47
December 2009
6.4.3
includedhereasitworksinasimilarway,withanumberofindividualsall bringingdonationstoasetpointforcollection.Suchschemesarebelievedto accountforaround15,000tpaofusedclothing,collectedfromaround20,000 schools. Most of this clothing is shipped virtually unsorted (after preliminaryinspection)overseas. Barriers to increasing the number of textile banks are identical to those for other types of banks for materials and products. Banks are familiar and widespread, and the barriers to increased deployment are comparatively low.Similarlytocharityshops,thereisgreatimportanceinobtainingtextiles that are dry and uncontaminated, as many of these will then have to be disposedofaswasteaftercollection. In-store collection Collectionofclothinginstorehasbeenpilotedbyanumberofretailerswho wish to make a direct impact on improving the environmental effect of textiles,butnottoanysignificantextentintheUK.Volumesarelow(totals of a few tens of tonnes), and the collections are sometimes made on a campaign basis. Some of the schemes are associated with the chemical recycling of polyester garments back to polyester yarn by key polyester or nylonmanufacturers.Examplesinclude: Patagonias Common Threads Programme: garments manufactured using Teijin polyester are collected instore or by mail for chemical recycling via Teijins ECOCIRCLE Programme at a factory in Japan (see Section 7.1). This scheme is also being expanded to some nylon products. Uniqlo: this Japanese retailer has operated two campaigns per year for the collection of Uniqlo clothes at its Japanese stores since 2006. An earliertrialachieved92%reuseofclothingindevelopingcountries. Takashimaya: a Japanese department store chain that has run once yearlyreturncampaigns,resultinginanaveragereturnof6.5itemsper person,andatotalofaround93,000items,or28tonnes. Mountain Equipment Coop in Canada accepted clothing with greater than90%polyestercontentfromitsownbrand,Polartec,ECOCIRCLE orPatagoniagarments. Boomerang in Canada sells a mixture of reused and new items. Items are returned to the shops for sorting and resale for which the seller receives a percentage of the final price. There are a number of independentshopswiththisbusinessmodelintheUK,oftenorientated aroundchildrensclothing. Interestingly, the Mountain Equipment Coop (MEC) system was discontinuedafteratrialperiod.Thereasonsgivenforthiswerethat:
For Defra
Page 48
December 2009
evenafteradoublesort(atthestoreandthenatthedistributiondepotto which the clothes were returned), only 25% of the remaining clothes were accepted by the recycler, the rest being rejected due to impurities (e.g.elastane) manyoftheproblemswereduetoidentificationlabelsthatweremissing or had become unreadable over time. For example in underlayer garmentsmanypeoplecutoutthelabelforcomfortreasons.Also,heat sublimatedlabelsdonotlastsufficientlylong.
HenceMECscurrentstrategyistofocusonreducingpostindustrialtextile wasteinitssupplychain,whilstencouragingtheuseofmoredurablelabels inordertorevisitinstorecollectionatalaterdate43. Barrierstothefurtheruptakeofinstorecollectioninclude: organisational complexity, space requirements and reverse logistics withintheretailer difficultiesin identificationof fibre content(forchemicalrecycling) and consequentrelativelyhighcosttotheretailerforthisroute chemicalrecyclingschemesareoftendependentuponpurchaseofvirgin fibrefromthemanufacturerandonlyacceptingownfibreforrecycling. Enablersforthistypeofschememaybetheincreasedfamiliarisationwithin store takeback schemes that is likely to occur when battery collection schemesbecomemorewidespreadastheBatteriesDirectiveisimplemented. Collection of clothing is under consideration by producer responsibility compliance organisations such as Valpak, who have experience of store collection. However any voluntary strategy is yet to be determined and is dependentupontheinterestandcommitmentofitsmembers.Noenforced EPRschemeislikelyfortextilesintheUKintheimmediatefuture.
6.5
43
MEC, private communication
For Defra
Page 49
December 2009
100% 90% 80% 70% Percentage 60% 50% 40% 30% 20% 10% 0% 2002 2003 2004 Year
Source: Open University Household Waste Study 2008
2005
2006
2007
6.5.1
Reasons for this include the relatively small volume of this waste stream compared to other recyclates; the existence of a substantial bring system of banksandcharityshops;operationalproblemsforMaterialRecoveryFacility (MRF) operators when comingled with other recyclates and door to door collections by charities and commercial operators. However there are advantages in Local Authority supervised textile collections, including the inclusion of whole geographic areas which might otherwise be cherry pickedbycharitiesorcommercialoperatorsforthehighestqualityclothing only and increased confidence of the public in a nominated collector supportedbytheLocalAuthority. Co-mingled collections Modellingofkerbsidecollectioncostshasshownthattheadditionoftextiles tocertainformsofvehiclecanreducethecostoftheoverallcollectionservice (i.e.createanincomefortheLocalAuthorityorcontractor)44.Howeverifthe textile is collected with the other recyclates (comingled collection) the qualityofthetextileisreducedthroughcontaminationanddampness,which can make it worthless to textile recyclers. Additionally MRF operators are
44
Kerbside Recycling: Indicative Costs and Performance WRAP Project ROT-024, June 2008
For Defra
Page 50
December 2009
6.5.2
often reluctant to take textiles as they can damage certain kinds of sorting equipmentandreduceMRFproductivity.Hencetextilesareoftenexcluded fromcomingledcollections. Feedback from the textile recyclers within the project stakeholder group conflicted to an extent on this issue, but generally held textiles from co mingled collections to be of very low attractiveness. Comingled collection formed approximately 25% of all kerbside collection in 2005/645, and is forecastedtocontinuetogrowasapercentageofallkerbsidemethods46. Therefore in order to increase textile recycling and reuse from domestic sourcesitisimportanttoofferamethodofexclusionoftextilesfromtheco mingledrecyclates.Itisveryimportantthatthetextilesshouldbeenclosed inabag,eitherprovidedbythehouseholderorthecontractor.Optionsthat havesuccessfullybeenusedinclude: separatecollectionoftextilesbyatextilerecyclingcontractororcharity, oftenfollowingtherecyclingvehicle.Bagsdistributedseparatelybythe textilerecyclerbeforehand. Comingled collection of glass/plastic/cans but collection of paper and textiles (or textiles only) in a single use bag for separate sorting at the MRForforsendingtoatextilerecycler. Other collection methods Thereisageneralpreferenceforsystemsotherthancomingled.Successful doorstep collection schemes indentified by contractors that produced high quality,desirabletextilesincluded: bagssuppliedbythecontractor rebaggingifnecessarytokeepdryandtoidentifycorrectly storageseparatelyundercoveratMRF/transferstation possiblecollectionwithpaper,butnootherrecyclate. Readyidentificationofthecontractorsbagsalsohelps somewhattoreduce the collection of textiles by other parties. Given the current high value of used textiles, the problem of collection by opportunistic third parties was mentionedbyindustrystakeholdersinvolvedincollection.
45 46
An Analysis of MSW MRF Capacity in the UK WRAP Report BUS013, June 2007 WRAP, Private Communication, February 2009
Page 51
For Defra
December 2009
6.5.3
Reduction of waste The waste hierarchy clearly defines that, above reuse and recycling, the initial reduction of waste is typically the more environmentally beneficial option. Whilst difficult to quantify, there are a number of opportunities availabletoreducewastecreatedinthetextileindustry.Thereareclearpost industrial resource efficiency measures available, but this study focuses on postconsumer, and therefore product life extension is most likely the key opportunity. By designing and producing high quality garments, that are efficientlycutandthereforefitanindividualwell,theconsumerislesslikely to dispose of an item casually, and therefore does not need to replace it so quickly. This is also true of garments with durable fibres selected for manufacture, particularly in those garments that will get heaviest wear suchassomeuniformsandcorporatewear. Another potential lifeextending opportunity is the laundering of damp or contaminatedclothingfoundinMRFs.Thisisacomplexissue,withindepth trials recommended for any realistic understanding of opportunity in this area.
6.6
6.6.1
Sorting
Sorting infrastructure There has been a generally accepted decline in the amount of sorting of textiles that takes place in the UK and a consequent growth in the sorting that takes place overseas, notably in former Soviet Bloc countries such as Poland, Lithuania, Estonia and Ukraine. UK companies carry out different degreesofsorting,forexample: full sorting to include recycling grades/wipers, cream, export grades, carried out by companies such as Wilcox, LMB, Nathans, Oxfam, Wastesavers partial sorting with fewer categories, for example as carried out by IG Cohen scanningtoremoveobviousrubbishonlybeforeshipment,forexample ascarriedoutbySalvationArmy/KetteringTextiles. This has been influenced by the lower cost of sorting overseas, and the growth in overseas demand for UK clothing relative to UK demand, particularlyforrecyclinggrades. The stakeholder group was of the opinion that sorting capacity within the UK was useful in achieving environmental goals, in that it gave greater flexibility in the directing of textiles to reuse or recycling, and therefore
For Defra
Page 52
December 2009
6.6.2
greaterresiliencetomarketchanges.Therearesomeparallelstothegrowth in overseas demand for UK recyclates such as mixed plastics and paper, muchofwhichisshippedtoChinaforreprocessing.Whilstthisisfrequently themostprofitableroute,withlowadditionalenvironmentalimpact,itdoes expose the UK to more volatile swings in demand that may act against the establishmentofstablemarkets. Interviewswithindustryrecyclersgavedifferentopinionsastothedegreeof useoftheclothingwhenitwassortedoverseasthatitcouldleadtolessor to more recycling/reuse. It was not possible to obtain data from overseas recyclers to refute or validate these claims. However, since in developing countries such as India and China there are known to be very highly developed textile recycling industries with very little wastage, it might be expected by extrapolation that countries such as Poland which are more developed, but less wealthy than the UK, would have a recycling infrastructurethatwaswelldeveloped. Sorting economics The situation for recycling and reuse outlined in Section 4 is of continuing strongdemandforsecondhandclothingfromSubSaharanAfrica,therecent historical markets for UK clothing, combined with strong demand from the formerSovietBloccountries.Thesecountriesalsoincreasinglyoffersorting facilities, encouraging the decline of UK sorting. The overall very strong demandforusedclothinghasledtohistoricallyhighpricesasofApril2009. It should be noted however that the textile recycling market is cyclical in nature and that cycles of high and low prices have been experienced previously. The strong overseas demand has currently more than offset other negative trends in UK used clothing such as the decline of certain recycling markets, competition from cheap virgin clothing and lowering of thequalityofusedclothing.Itremainstobeseenwhetherthesamefactors of economic slowdown that adversely affected the other recyclate markets dependent upon overseas demand such as paper and mixed plastics, will alsocauseareductionindemandforclothing.Ourviewisthatthedriversin the case of clothing are less dependent upon commodity and raw material demandandmoredependentuponthesizeandprosperityoftheemerging middle classes, who form the bulk of the overseas markets for UK clothes. Thereforealthoughtheremaybesomereductioninpricing,wedonotexpect the abrupt reduction in pricing and in demand experienced by some recyclates. Anecdotal evidence47 suggests traditional buyers in Africa are strugglingwithforeigncurrencyexchangeandsecuringsales.Thereissome industryconcernthismaystarttopushdownpricesforthefutureasitmay bethatclothingpricesarecurrentlyatthepeakoftheircycle.
47
Terry Ralph, former president of TRA, as reported in BIR June press release, available at: http://www.bir.org/biruk/press/322PostDubaiTextiles.pdf
For Defra
Page 53
December 2009
Prices paid for charity rags those clothes left after the charities have selectedtheclothesfor UKresalehaveriseninthepastfewyears.Inthe longerterm,themarketshowscyclesofhigh andlow pricing,asshownby thedatagoingbackto1990Sampledataislimitedbefore2001duetolackof available historical data from TRA members. This is shop collections, which is a slightly different measure to charity rags, but almost exactly correlated.Thereforeitappearshighlylikelythatatsomepointthecyclical natureoftheindustrywillresultinlowerprices.
Figure 6.5: Variation in price of charity rags from 2001 to 2007
300
200
150
100
50
Mar-01
Mar-02
Mar-03
Mar-04
Mar-05
Mar-06
Sep-01
Sep-02
Sep-03
Sep-04
Sep-05
Sep-06
Mar-07
Source: letsrecycle.com
Figure 6.6: Variation in price of shop collections from 1991 to 2009
Ja
Date
Source: TRA
For Defra
Page 54
December 2009
Thesecharityragsarepurchasedandsortedbytextilerecyclersandthensold ontoachievetherangeofpricesshowninTable6.1.
Table 6.1: Rag sales prices
Sales price per tonne Recycling Grades White wipers Other wipers Wool knits Uni-colour acrylic knits Filling materials Clothing Grades Clothing for reuse Africa Clothing for reuse Pakistan
Source: Industry estimates
Thisshows areductioninpricesforrecyclinggradesthatisconsistentwith the static or declining UK recycling markets and the better performance of reusedclothingsentoverseas. Problematicgradesinclude: Denim recycling grades. There are very limited outlets for this short fibrematerial,whichonlycommandverylowprices. Personal protective equipment (PPE) for which overseas markets are only just starting to appear (except in some special cases such as firemensclothing). Waxjackets,forwhichthereisnomarket. Polyester, polyester/cotton mixes and acrylics where the only market is usuallyinflockingorshoddy. Ragscontaininghigh proportionsof wool aredesirable,dueto applications such as mattress flocking where the natural flame retardancy of wool removes the need for synthetic flame retardants. Combined with the reductionintheweightandavailabilityofwoollenclothing,theserecycling grades have performed better than most. Existing and new markets for recycledtextilesarefurtherdescribedinSection8. Without intervention it appears probable that an increasing amount of sortingwilltakeplaceoverseasduetorelativelyweakUKrecyclingmarkets andUKreusemarketsthatarelikelytoweakeninthelongterm.Howevera proportion of UK sorted clothing does appear to be beneficial as regards marketstability.Possibleinterventionsinclude:
For Defra Page 55
December 2009
6.7
6.7.1
Reuse markets
UK markets ThedirectUKmarketforreusehasbeendescribedinSection4.Almostall othersalesintheUKarethroughcharityshops,comprisingthecreamthat is removed from charitable donations for UK sale prior to the residue or charity ragsbeingsoldontocommercialrecyclers. This hasincreased in percentageandinabsolutetermssince2003. CompetitioncomesmainlyfromlowcostclothingsupplierssuchasPrimark, George and Tesco. Reductions in the prices of these clothes and the increasing popularity of these chains has meant consequent reduction in marginsofcharityclothes,althoughclothingsoldintheUKremainshighly profitablecomparedtothatsoldoverseas. Overseas markets Aswithmanyotherrecyclates,themainoverseasmarketsforusedclothing haveshownsubstantialgrowth.ThisisinlinewiththeincreaseinUKtextile recyclingandreuseandtheincreasingexportofunsortedclothing.Tradein used clothing generally has increased, but exports from the UK disproportionately so compared to other countries, with exports more than doublingbetween2003and2007:
6.7.2
For Defra
Page 56
December 2009
Source: ONS
For Defra
Page 57
December 2009
Themainconcernswithpromotingoverseasmarketshavebeentheadverse effect of used clothing on indigenous clothing manufacturers in developing countries. This has been raised from time to time by charities such as Tearfund.Theseconcernshavebeenresearchedinanumberofstudiesthat have been reviewed previously48. The conclusions are generally that the secondhandtradecreatessubstantiallocalemploymentthroughdistribution andtradingandisofnetbenefittothecountriesstudied.Theviewoftextile researchers active in developing countries is that used clothing is a contributortothedemiseoflocalmanufacturing,butthatotherfactorssuch ascheapvirginclothing,managementcompetencyandnationalgovernance alsowereimportant.Forexampleinsomecountriestherewasthebeliefthat the quality of imported used garments was likely to be better than locally manufacturedgoods49 Social science researchers also note that second hand clothing is not dumped into developing countries, but that it undergoes a process of transformation into local clothing. What begins as charity with donations of used clothing in the West becomes a whole industry that draws in countries like ZambianotaspassivereceiversoftheWestssurplusclothingbutactivelyinvolved in shaping the nature of the trade. The relationship revolves around a process of recommodificationinwhichthemeaningofsecondhandclothingisredefinedinlocal terms50
6.8
48 49
Oakdene Hollins 2006 ibid Second Hand Clothing in the Philippines Milgram, B.L. in Old Clothes, New Looks ibid p 149 50 Crafting appearances: the Second Hand Clothing Trade and Dress Practice in Zambia Hansen, K.T., in Old Clothes, New Looks ibid p116 51 Rubbish Theory: The Creation and Destruction of Value Thompson, M. , Oxford University Press, 1979
For Defra
Page 58
December 2009
Second hand
0
Depreciating, transient item
Time
Typesofdirectsaleandexchangesuchbigwardrobe.comandeBayavoidthis reassignment and allow a more transparent renegotiation of value between buyerandseller.
6.9
6.9.1
For Defra
Page 59
December 2009
6.9.2
Corporate clothing Corporate clothing and uniforms comprised around 33m garments purchased, with an average contract length of around 24 years52, ranging fromtheconstructionindustryforworkwearandPPE,toretailforcorporate uniforms. There are also very large individual users such as the NHS for nursesuniforms,sheetsandcurtains/drapes.Thetotalvolumedisposedof isaround11,000tonnes,witharecyclingandreuseratemuchlowerthanthat forconventionalclothing;thoughttobelessthan10%.Particularissuesfor corporateclothinginclude: high levels of fibres such as polyester and nylon which are included to givehardwearingclothing use of blends such as small quantities of elastane for fit and fashion reasons theneedtoremoveoratleastcontrolcirculationof clothingwithlogos for security and branding reasons. Some customers insist of complete shredding/destructionforsecurity. theneedtodisposeoflargequantitiesofidenticalclothingoverashort periodoftime the requirement by HMRC for a prominent and permanent logo or otherindicationthatthecorporatewearisindeedauniform.Thisisoften metbytheuseoftaxtabswhichcanbediscrete.Amajorproblemis the differing interpretation of this rule by different tax offices and inspectors. Thesefactorstendtorestricttheattractivenessofcorporateclothingtotextile recyclers. Often such clothing is blended away in small quantities with conventional clothing at the sorting stage, but large quantities are usually refused by recyclers, and must be landfilled/incinerated if they cannot be recycled mechanically. In addition some clothing, notably PPE, has almost no overseas market due its lack of use in developing countries. Thus the recycling/reuse rate for corporate clothing is much lower than that for conventionalclothing. Corporateclothingthatisrequiredtobedestroyedforsecurityorbranding reasons is usually collected by the client and then passed on to a textile recycler (or sometimes a security shredding company) for shredding and then is either mechanically recycled into nonwoven products, or is incinerated/landfilled. Whilst some options are available for delogoing branded garments, these tend to be very resource and timeintensive, and therefore not currently
52
Source: Company Clothing Magazine
For Defra
Page 60
December 2009
6.9.3
economically viable on a large scale. Often the process of removing a logo candamagethematerial,makingreusevaluelower. Arecentstudyontaxationissues53explainsthat,whilesomecorporatewear purchasersmayseetherequirementforalogoortaxtabasquiteoutdated, theHMRCstressestheneedforsuchitemstoensurethatprivateclothingis notfalselyclaimedasbusinesscorporatewear.Forthereasonsgivenabove, thiscausesasignificantbarriertoreuseofclothing,yetnoalternativehasyet beenaccepted. There are factors within the corporate clothing market that give it potential forimprovedendoflifemanagement: Corporate clothing customers (particularly those with public facing operations) increasingly accept responsibility for clothing issued to employeesaspartoftheirCSRrathersimplybeingleavingemployeesto disposeofit. Managing agents who are controlling clothing for a variety of clients havetheopportunityandlogisticstotakebackclothingandtodirectit downanumberofdifferentreuseorrecyclingroutes. The potential for receiving back a large number of clothing items with the same fibre composition makes chemical recycling routes, which are generallymoreintolerantofotherfibresthanmechanicalrecycling,more attractive. Collection,recyclingandreuse systems forcorporateclothingaredescribed ingreaterdetailintheCorporateClothingProjectundertakenbytheCentre for Remanufacturing and Reuse (www.remanufacturing.org.uk or www.uniformreuse.co.uk) and completed in April 2009. This includes research on logo removal (which is also being taken forward in a separate projectoriginallyfundedbytheCentreandnowbytheTechnologyStrategy Board); on sustainable fibre choice; on debondable seam construction; and bestpracticecasestudiesonusedclothingmanagement. Textile rental Textile rental includes much of the corporate clothing described above but tendstorequiremoreregularormorethoroughcleaning.Examplesinclude chefsuniformsandengineeringoveralls.Alsoincludedareotherhospitality linens such as hotel bed linen, restaurant tablecloths and napkins; entrance mats;andspecialistclothingsuchascleanroomoveralls.Inthiscase,allof thetextilesarereturnedtothetextilerentalcompanyatendoffirstlife,when theyareusuallyrecycledintowipers(thefateofmuchbedlinen)ordisposed oftolandfill/incineration.
53
Taxation issues in Corporatewear, 2009, CRR
For Defra
Page 61
December 2009
Problematicmaterialsfortextilerentalcompaniesinclude: Mats, which are usually nylon, polyester or cotton bonded to a rubber backing.ThereiscurrentlyaEuropeanprojectexaminingthecollection of these, but disposal is only to incineration. There has also been recycling of the mats at pilot plant scale in the UK using cryogenic technology. Clean room uniforms, due their antistatic properties which make conventionalrecyclingdifficult. Engineering overalls: There has been previous (unsuccessful) experimentation in Scandinavia by one of the large textile rental companies in reusing the overalls from aerospace engineering for automotive engineering, but the difficulty of logo removal meant that securityconcernsendedthetrial. Providedthattechnical problems canbeovercome,textile rental provides a good testing ground for textile recycling, due to the reverse logistics that alreadyexistfromthecustomertothetextilerentalcompany. Carpets and carpet tile collection, remanufacturing and reuse CollectionofusedcarpetisinitsinfancyintheUK.Sincethefailureofthe Wrace carpet recycling company on Merseyside about seven years ago, carpet manufacturers have been reluctant to back another initiative. HowevertheformationofCarpetRecyclingUKhasgiventhisnewimpetus. CompaniessuchasGreenbackhavebeenestablishingrecyclingfacilitiesthat canacceptcarpetfromHWRCs(thedisposalpointformostcarpetthatisnot disposed of as construction waste in a skip, or as C&I waste by the contractor). According to Carpet Recycling UK a number of investors are joining established companies such as Greenback and Spruce Carpets to investinidentification,sortingandsizereductionequipmentthatwillcreate geographicallydispersedcarpetrecyclinglocationswithapredictedcapacity of20,000tpabymid2009(comparedtototalUKarisingsofaround570,000t). Direct reuse of carpet is usually limited by the condition of the uplifted carpet:mostcarpetbeingupliftedatthepresenttimeis,onaverage,10years oldormore.Hencereusestrategiesoccurmoreoftenwithcarpettiles,where it is easier to uplift, refurbish and sell on. The refurbishment process includes cleaning and retexturing, but can also include deodorising and overprinting. Major carpet tile manufacturers Interface Floor and Milliken are heavily involved with initiatives to increase reuse (and recycling) of carpettilesbothindividuallyandasmembersofCarpetRecyclingUK.
6.9.4
For Defra
Page 62
December 2009
InadditiontoitsEvergreenleasingsystem,Interfacehasacarpetreclamation process: ReEntry54. Through this scheme, Interface will arrange for any Interface carpet tile to be collected from the customer for a small fee. Reclaimed products are then refurbished through two social enterprises: GreenWorks in London and Spruce Carpet in Glasgow. Products that are considered unsuitable for the refurbishing process are, where possible, recycled into new products or downcycled into lesser value applications. Onceprocessedthroughthepartneringorganisations,therefurbishedcarpets are donated or sold on to the voluntary sector, schools and churches, or refurbished tiles are used in small businesses and or even specified by commercialarchitects.TheReEntryschemehasbeeninplaceforfiveyearsin the UK and Interface are now expanding into other European countries, namelyFrance,GermanyandHolland.SincebeinglaunchedintheUSAin 1994theReEntryschemehasdivertedmorethan7millionmofcarpetfrom landfill worldwide. In the UK the ReEntry scheme prevented 126,000 m frombeingsenttolandfillin2008,anincreasefrom94,000min2007. Milliken has introduced an Earth Square programme which reclaims used commercialcarpettilesandremanufacturesthemtoasnewcondition.This is achieved through a three step process that cleans, retextures and overprintstheoriginaltileswiththeMillitrondyeingprocesstodisguiseany irregularities or marks. Customers can either have their own tiles renewed for reuse or specify and purchase renewed carpet tiles from Millikens ModularResalestock.Onedrawbackofthisprocessisthatpatternscanbe added but not taken off, as this involves the use of substantial amounts of bleachwhichwouldbecounterproductivetotheoverallaimofreducingthe environmental impact of the product. However the Millitron overprinting technique works well and can update the look of any interior simply and effectively. This process allows for the product to achieve multiple lifecycles and also incorporates a 10 year guarantee at the beginning of the next usage period. At present endoflife carpet tiles are shipped to the Milliken plant in the USA for processing. The Earth Square scheme is currently operating on a relativelysmallscaleintheUKalthoughdemandisgrowingeachmonth.If a critical mass of Earth Square tiles can be collected in the UK it is possible thatMillikenwillsetupaprocessingfacilityintheUK. Spruce Carpets was established in 2004 to refurbish carpet and carpet tiles from the greater Glasgow area and sell them on to voluntary sector organisations, small businesses and schools. Processing approximately 6,000m of carpet and 2,000m of carpet tiles per year, Spruce Carpets were responsible fordivertingaround150tonnesofcarpet wastefromlandfillin 2007.Theserviceisadvertisedbylocalcarpetfittingcompaniestocustomers
http://www.interfaceeurope.com/Internet/otherfiles.nsf/Lookup/ReEntry_EN/$file/ReEntry_EN.pdf
Page 63
54
For Defra
December 2009
having new carpet fitted who then telephone Spruce to arrange for the old carpettobecollected.Wastecarpetisalsoacceptedfromfitterswhoareable to avoid landfill costs by donating the carpet for recycling. As previously mentioned,InterfaceandMillikenalsodonateupliftedcarpettilestoSpruce Carpetsforrefurbishing.Thecarpettileprogrammehasbeenrunningsince May2006andaround1015palletsofcarpettilesarereceivedfromInterface eachmonth,equatingtobetween5and7.5tonnes,anditisanticipatedthat this will increase to between 15 and 20 pallets per month in the future. Approximately60%ofthetilesareabletobereusedandtheremainderare advertised on the Glasgow Freecycle website. Tiles are sold either through theirowndedicatedeBaysiteorthroughtheirshowroomatthefactorysite. Other products include a weed suppressant made from offcuts of wool carpetwithnaturalfibrebacking. RecentlyLaunchpadinScotlandannouncedtheintroductionofanewcarpet uplift and refurbishment scheme in the Perth and Kinross region. The HouseandHomeservice,fundedbytheScottishExecutiveStrategicWaste Fund, provides a free removal and collection service for endoflife carpet and floor tiles. They accept donations of quality, reusable carpet and once refurbished,thesearesoldonatdiscountedpricestopeopleonlowincomes. Any carpets that are unable to be refurbished are recycled if possible, and mostdonationswillbecollectedfreeofcharge.55 Reuseofcarpetotherthaninthesocialenterpriseandcharitysectoroperates on a small scale although there is evidence of this occurring. BioRegional have produced a number of case studies on reclamation and reuse of buildingmaterialsindemolition56.Oneproject,thedemolitionofWembley Conference Centre, resulted in a number of items being reused, including carpet. With assistance from NISP, materials were matched to suitable end usersandthereclaimedcarpetwasreusedatthelocalHiltonHotel. Withregardstocommercialcollectionofusedcarpetproducts,therearefew services currently on offer in the UK. FullerGray Carpet Tiles (formerly Carpet Tiles R Us), based in Cambridgeshire, was established in 2004 to supportthereuseofcarpettilesaswellassupplynewones.Offeringafree kerbside collection service to SMEs and building and construction contractors, carpet tiles are refurbished and donated to charities, schools, community centres and churches with 95% of carpet tiles collected being reused. Carpet tiles are also accepted as part of Millikens Earth Square programme.Thisisaninterestingexampleofonsitecollectionandalthough currently operating on a small scale this could easily be replicated and similarinitiativescouldbesetupinotherregionsoftheUK.
Launchpad Enterprise and Training http://www.launchpadtraining.org/Press/tabid/204/Default.aspx Reclamation Led Approach to Demolition, BioRegional, July 2007
55 56
For Defra
Page 64
December 2009
Recyclingandthecreationofnewmarketsforrecycledfibrearediscussedin more detail in Section 8. Markets under investigation by Carpet Recycling UKincludenewusesforwoolbasedfibresuchaspeatreplacement,compost and land remediation. Barriers to their adoption include the need for environmentalandhumanhealthriskassessmentsandpossiblytheneedfor standardsandendofwastecriteria.
For Defra
Page 65
December 2009
problems with consumer awareness, identification/labelling and the consequent costs. Familiarisation with other instore collections (e.g. batteries)maychangeretailerperceptions. Theavailabilityofkerbsidecollectionofusedtextileshasalmostdoubled since2002toover30%,butisstillonlyhalfofthatforglass,plasticsand metals.Previousconsumerbehaviourstudiesshowthatconvenienceisa major factor in increasing recycling/reuse rates for clothing. A greater proportion of LAs should offer kerbside collection of textiles so that recyclingavailabilitymatchesthatofotherrecyclates The growth of comingled household collections is a threat to greater recycling and reuse of textiles, as textiles are unattractive to MRF operatorsandthecollectionmethodsresultinthepoorconditionofthe textiles.Wherecomingledcollectiontakesplace,LAsshouldintroduce alternative textile recycling offerings such as partnerships with commercialtextilerecyclingcompaniestocollecttextilesseparatelyand ingoodcondition Lower levels of UK sorting and the direct shipping abroad of unsorted clothing is increasing, encouraged by robust overseas reuse and recyclingmarketsanddecliningorstableUKrecyclingmarkets.Alevel of UK sorting is desirable in order to service UK markets and also to reduce risk of exposure to overseas trading markets. Experience with other recyclates has shown that such markets can be volatile, although this can be reduced by offering higher quality products/materials. Greater transparency on fates of clothing is required from individual companies and from trade organisations. Interventions such as innovation funding, demonstration projects and capital equipment grantsshouldbeusedtocreatenewmarketsforrecycledfibreintheUK. Collection and reuse/recycling of corporate clothing at end of life is lower than with conventional clothing due to the large volume of identical clothing, security and branding concerns and tax treatment. There are also opportunities due to its consistency, the increasing managementbycompaniesatendoflifeandincreasingawarenessofits environmentalimpact.Useofpublicprocurementinitiativestoincrease theoverallsustainabilityofcorporateclothingusedinthepublicsector, including improved endoflife management. This might include a demonstrationofclosedlooprecyclingorreuse.Greaterconsistencyin the application of tax rules to corporate clothing, with more detailed guidance on what constitutes acceptable corporate identification that also maximises the potential for reuse. Increased collection of used corporateclothingbycompaniesortheiragentsisrecommendedrather thanencouragingemployeestodisposeofclothingthemselves.
For Defra
Page 66
December 2009
Textilerentalalreadypossessesthecollectioninfrastructureforefficient recycling.Particularproblemsremainwithsomeproductssuchasmats and specialist uniforms such as for clean rooms. Market development via innovation or demonstration funding for specific problem products willhelpincreaserecyclingratesinthissector Acarpetcollectioninfrastructureisbeingcreatedtoacceptcarpetsfrom HWRCs, albeit from a small base, facilitated by Carpet Recycling UK. Thereisasmallexistingcollection,sortingandreuse/recyclingindustry, often based on social enterprises and often supported by a large carpet tile manufacturer. There are also larger scale recycling and reuse opportunities in carpet tiles, currently shipped to the USA. Market development via innovation, demonstration or capital equipment funding will assist in creating more robust markets for the carpet fibre and backing that will be produced from collection and sorting and for investmentinremanufacturingtechnology.
For Defra
Page 67
December 2009
Overseas Examples
7.1
The ECOCIRCLE recycling system requires a number of participants to enableittobeeffective.Teijinisatthecentreofthesystem,andbesidesthe production and recycling of ECOCIRCLE fibres, they also manage the system and take care of its administration. ECOCIRCLE Members are apparel manufacturers or retail stores that supply products using ECOCIRCLE fibres. The endusers of these products are called ECOCIRCLEPartners.58 ResponsibilityforcollectionandsortingofendoflifeECOCIRCLEtextiles lies with the ECOCIRCLE Members. They are also responsible for organisingandfinancingthedeliveriesoftheECOCIRCLEproductsback to Teijins recycling facility in Matsuyama, Japan. In order to ensure the process functions effectively, a labelling system is in place. Each ECOCIRCLE product must carry an ECOCIRCLE Product Mark along
57 58
100th Member Joins 2008; Teijin Limited Annual Report 2008, 16. ECOCIRCLE General Operation Rules s.a.; ECOCIRCLE: The Meaning s.a.
For Defra
Page 68
December 2009
withthenameandcontactdetailsoftheECOCIRCLEMemberresponsible fortheproduct.59 Besides those companies manufacturing or supplying uniforms, other ECOCIRCLE members are either manufacturers or suppliers of school clothes, interior furnishings, sports and fashion wear, bags and polyester materials.In2005,TeijinstartedpartneringwithAmericanoutdoorclothing manufacturer Patagonia to deliver a consumerfacing closedloop recycling programme. This was the beginning for Patagonias Common Threads GarmentRecyclingProgram.Thefirstproductgroupthatwascollectedfor recycling from Patagonia was Capilene Performance Baselayers, but Patagonia has widened the programme to cover some other garments as well. In the USA, the endoflife Capilene garments are collected at Patagonias Service Centre in Reno, Nevada and shipped to Japan for recycling. At the moment customers can either post their used garments directly to Reno or leave them at Patagonias Retail Stores or Performance BaselayerDealerstobetransportedtoRenoscentre.60 Cooperation with Patagonia was an important step in introducing the ECOCIRCLE system to wider geographical markets. Currently around 90% of the ECOCIRCLE Members are Japanese. Besides expanding international collaboration, Teijin is also looking to secure new members beyondtheclothingsector.61 7.1.1 The ECOCIRCLE Process Closedloop polyester recycling enables an endoflife polyester garment to be turned back into a raw material form that is of similar quality to the original raw material. This is then able to be manufactured into new products. AchemicalprocessisutilisedintheTeijinECOCIRCLEsystem.However, beforechemicalrecyclingprocessestakeplace,theECOCIRCLEpolyester products are broken down and granulated into small pellets. These pellets are decomposedusing chemicals andreturned intotherawmaterial(DMT, dimethyl terephthalate) which can then be polymerized again and finally spun into new ECOCIRCLE polyester fibres. As zips and buttons are separatedduringthechemicalrecyclingprocess,thereisnoneedtoremove them beforehand. As well as 100% polyester fabrics, some polyesterrich fabric mixes can be recycled within the system. However at least 80% of a garments weight must be polyester, which excludes many polyester/cotton mixes.Materialsthatcannotbeusedatallincludepolyurethane,acrylicand
59 60
ECOCIRCLE General Operation Rules s.a. Common Threads s.a.; FAQ s.a.; Patagonias Common Threads, s.a. 61100th Member Joins 2008; Teijin Limited Annual Report 2008, 16.
For Defra
Page 69
December 2009
animal materials such as wool or leather. Elastane is also a problematic materialfortheprocess. EnvironmentalBenefits Teijin has calculated that by replacing the use of virgin material with recycled polyester it is possible to reduce energy consumption by 84% and CO2 emissions by 77%. To address concerns over the transportation of garments from the USA to Japan, Patagonia calculated the environmental impacts arising from the recycling of used Capilene garments under the CommonThreadsscheme.EnergyuseandCO2emissionswerecalculated forthreedifferentscenarios: A. Teijinsproductionofpolyesterfromvirginmaterials B. Teijinsproductionofpolyesterusingrecycledgarmentsthatwere locallycollectedinJapan C. TeijinsproductionofpolyesterusingPatagoniasrecycledCapilene garmentsthatwerecollectedintheUSA62
Table 7.1: Energy use and CO2 emissions per tonne of DMT produced
Category Distance Fuel for Transport Energy (Production) Energy (Transport) TOTAL ENERGY CO2 Emissions (Production) CO2 Emissions (Transport) TOTAL CO2 EMISSIONS Option A Teijin w/out Recycling ** ** 72,422 ** 72,422 4.18 ** 4.18 Option B Teijin w/Local Recycling ** ** 11,962 ** 11,962 0.98 ** 0.98 Option C Teijin with Capilene Recycling 7,000 38 11,962 5,771 17,733 0.98 0.226 1.20 Units Miles Gallons Mega Joules Mega Joules Mega Joules Metric Tonnes Metric Tonnes Metric Tonnes
Note: ** These environmental impacts in Option A and B are factored into Teijins production energy use
Source: Patagonias Common Threads Garment Recycling Program: A Detailed Analysis. http://www.patagonia.com/pdf/en_US/common_threads_whitepaper.pdf
The results showed that collecting garments in the USA and transporting themtoJapanforclosedlooprecyclingresultedinasmallincreaseincarbon emissionscomparedtocollectionandrecyclingwithinJapan.
62
For Defra
Page 70
December 2009
7.1.2
Future possibilities Many of the corporatewear garments that are currently used in the UK are manufacturedusingpolyesterorpolycottonblendedfabrics.Technically,it ispossibletousetheECOCIRCLEchemicalrecyclingsystemformanyof the polyester rich fabrics that contain at least 80% polyester. However, according to an industry source, compared to the cost of manufacturing polyester from virgin materials, it is about 1020% more expensive to produce recycled ECOCIRCLEpolyester.Thisextracostisdue tohigher production costs and investment costs for new systems and machinery. Therearealsootherassociatedcostssuchassortingandtransportationthat havetobeaddedtothetotalcostofjoiningtherecyclingsystem.Theseare likelytobelessforapplicationssuchascorporateclothingthanforgeneralor mixed textiles, despite customer education about the limitations of the process.
7.2
For Defra
Page 71
December 2009
7.3
63
Recycling of Low Grade Clothing Waste Oakdene Hollins Ltd, Salvation Army Trading Co. Nonwoven Research Institute, Defra WS Project WRT152, 2006
Ltd.,
For Defra
Page 72
December 2009
7.4
7.5
For Defra
Page 73
December 2009
in encouraging carpet recycling but probably due to financial and industry/governmentsupportrestraintsislimitedinwhatitcanachieve. InJanuary2001,inrecognitionofthevastamountofcarpetbeingdisposedof tolandfillintheUSA(approximately2,000,000tonnesperyear),theCarpet andRugInstitute(CRI)togetherwiththeMinnesotaOfficeofEnvironmental Assistance signed a Memorandum of Understanding (MOU) for manufacturersandGovernmentto: negotiate a schedule for the eventual elimination of carpet and rug disposal to landfill and incineration and establish reuse and recycling targets encouragethecarpetindustrytoestablishathirdpartyorganisationthat wouldberesponsibleforachievingthenegotiatedscheduleofrecycling andreuse establishprocurementguidelinesforpublicentitiestoadopt.
After a two year negotiation process between the carpet industries, representativesofgovernmentagenciesatthefederal,stateandlocallevels, and nongovernment organisations, a further MOU64 was signed in January 2002 which established the National Agreement on Carpet Recycling. This agreementsetoutaplantochangehowcarpetwasmanagedintheUSAand consistedofthefollowingaims: Alandfilldiversiongoalof40%tobeachievedby2012 Avoluntaryagreementbetweenthecarpetindustry,stategovernments, the US Environmental Protection Agency, and nongovernmental organizations(NGOs) To promote product stewardship by asking manufacturers to assume responsibility for funding the overall effort and meeting the goals for recyclingandreuse Toovercomebarrierstorecyclingandreuseofpostconsumercarpetand to develop systems that treat discarded carpet as a resource instead of waste To establish a third party organisationfunded bythecarpet industry andresponsibleformeetingthenegotiatednationalrecyclingtargets Tonegotiateanew10yearplanin2010.
Table 7.2 shows the negotiated targets agreed in 2002 (values from the originaltablehavebeenconvertedfrompoundsweighttotonnes)
64
http://www.carpetrecovery.org/pdf/CARE_MOU/MOU-January%202002.pdf
For Defra
Page 74
December 2009
2002 2003 2004 Tonnes Total Discards Reuse Recycling W2E Cement Kilns Landfill Recycling Rate Landfill Diversion Rate 2,040,259 3.8% 3.8% 180 21,772 20,412 2,121,905 2,189,944 2,059,949 2,285,199 11,340 160,118 22,280 45,359 2,045,702 7% 10% 24,040 2,386,350 2005 2006
Original data was presented in pounds weight but has been converted to tonnes
Table 7.2 continued.
2007 2008 2009 20010 2011 2012
Tonnes Total Discards Reuse Recycling W2E Cement Kilns Landfill Recycling Rate Landfill Diversion Rate 25,401 2,535,582 2,559,168 51,256 281,227 25,401 136,078 2,064,753 11% 19% 26,762 2,670,298 2,730,626 95,708 409,594 27,216 90,718 2,107,390 15% 23% 29,937 2,995,978 3,071,728 92,079153,768 614,164769,932 30,844 90,718 2,182,687 20-25% 27-34%
Original data was presented in pounds weight but has been converted to tonnes
Source: 2007 Annual Report Carpet America Recovery Effort
The MOU established the organisation CARE65 (Carpet America Recovery Effort) as the third party organisation. The group, with members from the
65
http://www.carpetrecovery.org/index.php
For Defra
Page 75
December 2009
carpet industry and government is funded and administered by the carpet industry and is responsible for monitoring, evaluating and assessing progresstowardtheNegotiatedOutcomeGoals.Thisnationalagreementon carpetrecyclingisavoluntaryagreementbetweenthecarpetindustry,state governments, the US Environmental Protection Agency, and non governmentalorganizations(NGOs). CAREs mission is to find market driven solutions to the diversion of post consumercarpetfromlandfillstomeetthetimesensitivegoalsoftheMemorandum ofUnderstanding(MOU)forCarpetStewardship. Theorganizationhasatotalof55facilitiesactivelyacceptingandprocessing postconsumer carpet waste for recycling and reuse, and most US carpet manufacturers achieve zerotolandfill targets each year which has been enabled by the development of an extensive collection and processing networkofcompaniesandthedevelopmentofendmarketsfortheproducts. Since its inception in 2002, CARE has reported a total approaching 470,000 tonnes of carpet that have been diverted from landfill. However, from the recent 2007 annual report66, it is clear that the target of 40% diversion from landfill by 2012 will not be achieved. The following figure shows the progressinrecyclingandtotallandfilldiversionbetween2002and2007.
Figure 7.1: MOU carpet diversion from landfill and recycling tonnages against targets
66
For Defra
Page 76
December 2009
CAREhasalsoproducedanumberofprocurementdocumentsforproducts containing postconsumer carpet to help stimulate the market for these end products.Companiesidentifiedasprovidingproductsfromrecycledcarpets include: GeoHay67aportfolioofbarrierfiltrationproductswhichaidthecontrol ofsoilerosionandsedimentationrunoff.Producedfrom100%recycled carpet fibres the products have been shown to be more effective than otherproducts,includingnaturalhaybales68.AttheendoflifeGeoHay willtakebacktheproductandremanufactureit. INVISTA69AntronEcoSoftCarpetCushion CarpetBurnsLtd70surfacecoverings,panellingandbackerboards Infiltrator Systems Inc71 Chambers for septic and storm water management IRockCompositesSoundbarriersandlandscapewallsystems Nycong72Concrete,asphaltandplastic LosAngelesFibreCo73.Carpetcushionproducts WellmanInc74Automotiveparts.
According to the CRIs Sustainability Annual Report for 200875, the carpet industry produces nearly 1,800 million m2 of carpet each year with almost 90%ofthiscarpetbeingmanufacturedinGeorgia.ThedatausedbytheCRI comes from 83 production facilities and approximately 90% of the 113 CRI members.
67 68
For Defra
Page 77
December 2009
Whilst the waste hierarchy indicates reuse as the preferable endoflife management option to recycling, energy recovery or disposal, this is not always feasible for all textiles. Logistics sometimes result in other routes being more suitable. Reuse overseas involves transportation costs, and frequently, when sorting does not occur before export, lower grade textiles can be transported out of the UK only to be transported back in, once the cream of the textiles have been removed. UK sorting therefore gives a betterenvironmentalprofile,aswellasgivingeconomicresilienceifoverseas markets become temporarily closed, as has happened with other recyclates recently.Inordertostimulatethis,strongerUKmarketsforrecyclinggrade textilesareneeded. Thetotalofavailablerecycledtextilesin2008was27,000tonnes.Muchofthis materialwasmechanicallyrecycledintofibreformattressesandupholstery, carpet underlay and products for the automotive industry such as acoustic damping, panelling and interior upholstery. A smaller amount of this available recycled fibre was used for the manufacture of a range of diverse products such as horticultural basket liners, capillary matting, and thermal insulation.Thesetraditionalmarketsforrecycledtextilesarematureandare perceivedtoofferverylittleopportunityforaddedvaluebytextilerecyclers.
Table 8.1: Available recycled textiles in the UK
Recycled Grade Source Recycled in UK UK Exported for Processing and Returned to UK Non-UK Sourced Total
Source: This study (see Section 4.5)
There has been a decline in the recycling of fibre within the UK since a previous study in 2006, and almost certainly before this date as well.. This haslargelybeenattributedtothegreaterattractivenessofvirginnaturaland manmade fibres in textiles due to attributes associated with the appearance of recycled fabrics. As regards flocking in mattress applications, it is increasingly difficult to source woolrich UK product as sorting moves abroadandasthewoolcontentoftextilesdeclines.
For Defra
Page 78
December 2009
Downcyclingoftextilestolowervalueproductstypicallyneedslessstringent physical, mechanical and compositional property requirements placed on those recyclate fibres that are specified for higher value products. As was mentioned in the Oakdene Hollins 2006 report, innovation in the textile recycling sector is almost absent. Work that was carried out by the Nonwovens Innovation & Research Institute Ltd76 (NIRI) examining new technologies to add value to recycled material has made little progress. Work is still continuing but in general the research and development cycle andtheuptakeofnewtechnologyislongerterm. Recycling of textiles to higher value applications is likely to require the minimisationoravoidanceoffibreblends,andincreasinguseofsinglefibre typesintextiles.Theadvantagesofsuchapproachesattheendoffirstlifehas tobebalancedagainstpossiblyperverseimpactsatotherlifecyclestages,as wellastechnicalperformanceandcustomeracceptability.
76
http://www.nonwovens-innovation.com/
For Defra
Page 79
December 2009
One of the issues that continues to be a barrier to developing addedvalue technologiesfromrecycledtextilesisthelowqualityandvariationinquality offeedstock.Ingeneral,theavailablestockisintheformofmixedfibreand thislimitstheengineeringofnewmaterialsbecauseofvariabilityinphysical and mechanical properties. It is believed that more research should be directed further upstream at the mechanical or chemical separation stage. However, this requires significant capital investment and without the clear demonstration of addedvalue technologies and product demonstrators, thereislittlechanceofthisinvestmenthappening.Afurtherpointmadeis that a more holistic approach should be taken whereby the textile manufacturersshouldbeexaminingwaysofproducingfabricsandgarments whichhave inherentcapacityfordisassembly. Thiswouldthenallow fibre separationtobeachievedwithlowercostinvestment. A substantial problem encountered in developing new high added value technologies for waste textiles is the availability and sourcing of well specified fibre. Although many recyclers of textiles would invest in more advancedequipmenttoprocesswastetextilesintohigheraddedvaluefibre, themarketforproductsusingthesematerialsisstillnotwellestablished.
8.1
8.2
77
http://www.uniformreuse.co.uk/pdf/alternative_joining_methods.pdf
For Defra
Page 80
December 2009
require little processing technology or are broken down further into a mixtureoftheirconstituentfibres.Alargeproportionofthesefibreswillend upasreconstitutedyarnsorasfeedstockfornonwovenproducts. 8.2.1 Textile to fabric Upcyclingofcertainhardwearingtextilesintoalternativeproductsiscarried outintheUK,althoughthevolumesarelow.Examplesincludeconverting oldseatcoveringsintobagsandshoes. Textiles to yarn Yarnsproducedfromendoflifepostconsumertextilewasteshowdifferent characteristicstothoseofthevirginyarns.Theseyarnsareusuallyofmixed colour and of variable fibre length with poorer physical and mechanical properties.Fabricsmadefromsuchyarn(shoddyandmungo)werewidely manufacturedinthe UKduringtheindustrial revolution.Today,however, theirproductionislimitedtocertaindevelopingcountriessuchasIndiaand Morocco. In the UK, any yarn produced from recycled textiles is generally not used for the recreation of new garments or household textiles but is diverted to the production of synthetic technical textiles. Even so, new technical textiles produced from recycled fibre still require a proportion of virginfibre(1015%)tobeaddedinordertoachievetheminimumproperties requiredforprocessing.Productsmanufacturedusingtheseyarnswouldbe, for example, woven filtration systems and geotextiles (permeable woven or nonwoven fabrics used as an integral part of a structure or system of foundation, soil, rock or similar). In the case of some applications, for examplegeotextiles,onlyfibreproducedfrompreconsumerwastewouldbe acceptableinEurope78.Awelldefinedtextilewastestreamwouldneedtobe providedforthistypeofapplication. 8.2.3 Textiles to fibre Agreaterproportionofthefibrereclaimedfromtextileswillbeusedinthe manufactureofnonwovenproducts.
8.2.2
Worldproductionin2004wasestimatedtobe4.4milliontonnesrisingto6.3 milliontonnesin2009.Accordingtothemarketsharedata,WesternEurope was producing 1.36 million tonnes of nonwoven product and this was predicted to increase to 1.76 million tonnes even though there will be a decreaseinmarketshare.
Geotextiles in Europe must conform to the European Standard EN 13249 Geotextiles and geotextilerelated products Characteristics required for use in the construction of roads and other trafficked areas (excluding railways and asphalt inclusion) where it states that the product contains no postconsumer waste
78
For Defra
Page 81
December 2009
Although the availability of recycled fibre for the UK market has reduced from 34,000.tonnes to 27,000 tonnes, the market is still dominated by three mainapplicationareasconsumingapproximately86%ofthistonnage The largest volume production in the UK is for mattress/upholstery with approximately 66% of all recycled product being in this market. Carpet underlay and automotive applications (mainly sound insulation materials) aremuchlowervolumemarkets(11%and8.7%respectively).Therearealso manyothermuchsmallerdiverseapplicationareasthatcomprisealmostone sixth of the total market, including horticultural basket liners, capillary matting,andthermalinsulation.ThemarketissummarisedinFigure8.1.
For Defra
Page 82
December 2009
Figure 8.1: Market for recycled textiles as nonwovens (approximate total 27,000 tonnes in 2007)
This is essentially downcycling of the fibre recyclate from textiles. Small proportionsoftherecycledtextilesenterthehigheraddedvaluechainorare
For Defra Page 83
December 2009
upcycled. In these circumstances, the recyclate fibres are usually well characterized and usually from a single type of fibre depending upon the application.Thereisalsotheopportunitytoredirectfibreintofurtheradded valueproducts.However,technologyadvancementhasbeenslowandthere hasbeenlittleevidenceofchangesincethelastreport.
Figure 8.3: Five year forecast for new market applications
Assumptionsbasedupon: recycled textiles available increases to 30,000 tonnes due to modest interventiontostimulatemarketdevelopment 20,000tonnesofcarpetarerecycled modestincreasesinenergyandrawmaterialcostfromApril2009. Typicalapplicationsforgeneralnonwovenproductsareasfollows: disposablediapers sanitarynapkins&tampons sterilewraps,caps,gowns,masksanddrapingsusedinthemedicalfield householdandpersonalwipes laundryaids(fabricdryersheets) apparelinterlining carpetingandupholsteryfabrics,paddingandbacking wallcoverings agriculturalcoveringsandseedstrips
For Defra Page 84
December 2009
automotiveheadlinersandupholstery filters envelopes tags labels insulation(boththermalandacoustic) house wraps (a form of insulation that is placed on the surface of the brickworkpriortothefinalbricksurfacelayer) roofingproducts(feltsetc) civilengineeringfabrics/geotextiles composites,e.g.polymermatrixwithrecycledtextilereinforcementused in automotive applications and also in nonloadbearing decorative structures.
8.2.4
Opportunities and barriers to new products from recycled textiles There are numerous opportunities for developing new applications for recycledtextiles. A numberoftheseareshown belowbutare certainlynot exhaustive.
TextileFibreReinforcedConcrete Concrete is the most commonly used construction material in the world. Although it has excellent properties in compression it is generally weak in tension,haslowductilityandlowenergyabsorption.Therehavebeenmany studiesthathaveexaminedwaysofimprovingthetensilepropertiesofthis material which have usually involved the addition of small quantities of fibres(0.2to2%byvolume).Someofthefibreswhichareusedincludesteel, carbon,nylonandpolypropylene.Thekeytousingfibresforreinforcement istoensurethattheydonotreactwiththeconcretemixeitherduringmixing orduringservice.Somestudieshaveshownthatpolypropyleneandnylon, whicharethemajorconstituentsofcarpetandrug,arenotdegradedbythe alkalinityofPortlandcement79.Thismakesthememinentlysuitableforthe reinforcement fibre for concrete. On the other hand, polyesters do show excessive degradation in cement. Fibre dimension is critical in this application,anditisintheUSAthatlongerfibre,whichismoreapplicableto concretereinforcement,isgenerallyusedincarpetmanufacture.Carpetfibre intheUKissomewhatshorter,whichcouldlimitthispossibleapplicationfor recycledcarpet. Anexampleoftheuseofcarpetwastefibreswasinthefullscaleconstruction oftheR&DCentreofShawIndustriesIncinDaltonGeorgia.Inthisinstance 20 tonnes of preconsumer waste carpet was used with a dosage of about
Groom J.L., Holmquist D.V. and Yarbrough K.Y. (1993), Use of waste nylon fibres in Portland cement concrete to reduce plastic shrinkage, in Proc. Recovery & Effective Reuse of Discarded Materials and By-Products for Construction of Highway Facilities, Denver, CO, Oct. 19-22, pp 179-183.
79
For Defra
Page 85
December 2009
6kg/m2.Thisprojectshowedthefeasibilityofusingwastefibresforconcrete construction.
Barriers Post-industrial waste is more appropriate as post-consumer carpet requires cleaning and separating. Only applicable to waste polypropylene and nylon fibre. Specification and construction standards precluding such additions. Opportunities & Benefits High volume, although low added value. Concrete structures are generally long lasting and can be recycled for hardcore.
SoilReinforcement Geotextile fabrics have long been used for soil reinforcement during road construction.Itisalsoknownthatshortfibresaddedtosoilshaveapositive effect,enablingthesoiltohavegreatercohesionproperties.Therehavebeen successfulexamplesoftheuseofvirginpolypropyleneandglasstoreinforce soilandsand80.
Barriers Certain standards throughout the world will not allow the use of post-consumer waste product to be used in geotextiles applications. Opportunities & Benefits High volume, low added value. Any waste carpet product fibre can be used. Trials have shown that shredded carpet waste can be blended into soil with conventional equipment.
NonLoadBearingComposites TheNonwovensInnovation&ResearchInstitute(NIRI)hasinvestigatedthe use of recycled textile waste as a replacement for glass fibre in glass reinforced plastics (GRP). From their initial work using a web of recycled polyester/cotton and a needlepunchedacrylic fabrictogether with an epoxy resin they were able to show the final composites to be strong, light and relativelystiffandsuitablefornonloadbearingcompositeapplications.
Barriers Lack of investment in R&D. Glass fibre reinforcement still competitive on cost. Opportunities & Benefits Possibly cost-effective in markets where mechanical and physical properties not as stringent as for load-bearing composites.
80
Crockford W.W., Grogan W.P. and Chill D.S. (1993), Strength and Life of Stabilised Pavement Layers Containing Fibrillated Polypropylene, 72nd Annual Meeting of the Transportation Research Board, Paper 930888, Washington, D.C.
For Defra
Page 86
December 2009
FiltrationSystems Recycledtextilesusedtoproducenonwovenstructuresshouldbeeminently suitablefortheproductionoffiltrationsystems.Withahighsurfaceareathe fibrescanbesurfacetreatedwithspecificfunctionalchemicals.Forexample, it has been shown that treating a recycled wool nonwoven with chitosan together with a low temperature plasma treatment will produce a filtration systemthateffectivelyremovestoxicPb2+ionsfromwastestreams.Chitosan isalsoveryeffectiveinremovingphosphorusandsurfaceoilsfromwater81. From an industry source there have also been attempts to impregnate nonwovenfabricsproducedfromrecycledfibrewithionexchangematerials thusextendingthefunctionalityandaddedvalueofthematerial.
Barriers The market is price sensitive and only lower value products would be acceptable, unless functionality could be improved. Opportunities & Benefits Easily adapted nonwoven structures are possible. A wide variety of products could be developed.
AcousticInsulation Work has been carried out by Mohsen et al82 that looked into the manufacturing methods and effects of variation in grain/fibre ratio, binder concentrationandparticlesizeontheimpacttransmissionperformanceofa rangeoflaboratoryproducedunderlaysmanufacturedfromrecycledcarpet tiles. From this work it was concluded that it is possible to produce and developacousticunderlayfromPVCbacked,nylonorpolypropylenecarpet tile wastes that were superior to conventional acoustic underlay products. Thistechnologywouldallowthereplacementofvirginfibreinanumberof other noise control applications, for example, traffic noise abatement, automotiveandbuildings.
Barriers Granulation of PVC product Opportunities & Benefits Less reliance on virgin fibres. Reasonably large market.
BuildingInsulation The French textile recycler Le Relais83 collects 45,000 tonnes of used textiles eachyearandclaimstobethelargesttextilerecyclerinFrance.Thecompany has developed a thermal insulation product called Mtisse. The product consistsof70%cottonand15%woolandacrylicwith15%polyesteraddedas abinder.Thematerialistreatedforfungalprotectionandisinsectrepellent. The insulation material has a thermal performance comparable to mineral
81
Radetic M., et al (2003) Application of recycled wool based nonwoven material for purification and cleaning of waters 9th Aachen Textile Conference, Aachen D 27-28 Nov., DWI Reports 126 pp 274283. 82 M. Miraftab., I. Rushforth, K Horoshenkov and M Swift Recycling carpet waste into acoustic underlay for commercial production, Project PLA4-012, March 2004, WRAP. 83 http://www.lerelais.org/Isolant-Metisse
For Defra
Page 87
December 2009
andglassfibreandcanabsorbandreleasemoisture.Itisprovidedin8x0.6 metre lengths and 5 to 20 cm thickness and is claimed to be best suited to timberframed structures. It is used as loft, roof and wall insulation. The product was launched in the UK in March 2007 and is currently being marketedbytheUKBuildingMerchantEcomerchantLtd.
Barriers Requires the continuous availability of recyclate. Opportunities & Benefits Already being marketed throughout Europe. Simple process. Many thermal insulation opportunities in the building sector. Products manufactured using recycled textiles do not require safety equipment when installing.
A number of other applications were explored and reported by NIRI in the 2006reportandinclude: addedfunctionalityautomotiveproducts phasechangematerials heatretentioncompositesusingsilicaaerogels odourcontrolfabrics nonwovenstructurestobehavelikeZeolites biocomposites. At this point in time there has been no major advance in these technology areas. It is clear that with further innovation and investment there will be more opportunities for developing new productsfrom recycledtextilesinto existingandnewmarkets. HorticulturalMatting Horticultural matting is produced by a number of UK manufacturers. A variety of fibres may be used, including cellulosics and wool. Suitable applications include agricultural matting, capillary matting for horticulture andincertaingreenroofsystems.
Barriers Risk assessment for human health and environmental impact. Specification within green roof system Low cost of many existing systems. Opportunities & Benefits Potentially large volume. Existing market for certain recycled textiles. Potential to improve performance and added value to recycled textiles.
For Defra
Page 88
December 2009
8.3
8.3.1
Composting
Best practice and definition of composting Increasingly, textile manufacturers are developing new products that either totallyorpartlycontainbiodegradablefibre.Thesebiodegradablefibrescan be obtained from synthetically manufactured polymers such as, polylactic acid (PLA), polyhydroxyalkanoates (PHA) and polycaprolactone (PCA), or from natural animal products such as wool, or from bast products such as cotton, flax, hemp jute and ramie, or from polyesters produced from microorganisms.Eachtypeoffibrehasvariousdegreesofbiodegradability and in some circumstances is not suitable for domestic composting. The terms biodegradability and compostability are sometimes used by manufacturerstoinferthesamething.Itisimportanttorecogniseandeven distinguishthedifference.
The Association for Organics Recycling (AFOR), formerly The Composting Association(TCA),definescompostingas84: theprocessofcontrolledbiologicaldecompositionofbiodegradablematerialsunder managed conditions that are predominantly aerobic and allow the development of thermophilictemperaturesasaresultofbiologicallyproducedheat andcompostas: asolidparticulatematerialthatistheresultofcomposting,thathasbeensanitised and stabilised and that confers beneficial effects when added to soil, used as a component of a growing material or is used in another way in conjunction with plants. The standard for compliance has been published by the British Standards Institution(BSIPAS100). The European Standard EN13432 Requirements for packaging recoverable through composting and biodegradation Testing scheme and evaluation criteriaforthefinalacceptanceofpackagingdefinesthecharacteristicsthat amaterialmusthave,inordertobedefinedascompostable.Thisstandard is equivalenttotheUS StandardASTM D6400 withonly minor differences. Thesewillequallyapplytotextilesastheydotopackagingmaterials. AccordingtotheEuropeanStandardEN13432,whichhasbeenpublishedin the Official Gazette of the European Union and adopted by all member states,acompostablematerialmusthavethefollowingcharacteristics:
84
For Defra
Page 89
December 2009
It must be biodegradable and quantitatively measured using the standard test method EN14046 (which is also published as ISO 14855: biodegradability under controlled composting conditions). To be acceptableasbiodegradableitmustreach90%within6months. It must disintegrate according to the composting test method EN14045. This method requires that the material be composted with organic materialandafteraperiodofthreemonthsthereshouldbelessthan10% ofthesievedcompostedmaterialwithadimensionhigherthan2mm. Itmustnotcontainheavymetalsabovethemaximumvaluesstipulated nor have any negative effects on the quality of the compost. A plant growthtestaccordingtoOECDTest208(modified)isalsocarriedoutto showanydifferencestothatofacontrolcompost.Otherfactorssuchas pH, salinity, volatile solids, nitrogen, phosphorous, magnesium and potassiumarerequiredtobethesameasthecontrolcompost.
TobecompostablethematerialmustsatisfyALLoftheabovecriteria.A material can therefore be claimed biodegradable but not necessarily compostable. IntheUKtheAssociationforOrganicsRecycling(AFOR)operatesaPAS100 and Quality Compost Protocol Certification Scheme managed by the competent bodies NSFCMi Certification and Organic Farmers & Growers Ltd.TheschemeenablescertificationtotheDINV54900,BSEN13432and ASTM D 6400 standards. In Germany the certification body is Din Certico whichoperatestheEuropeanCompostabilityMark. 8.3.2 Review of existing compostable fabrics Clearlythereisanadvantageindesigningandmanufacturingtextileswhich canbeeasilycompostedatendoflifethusprovidingameansofgenerating added value byproducts rather than disposal to landfill. A number of companies are actively involved in developing technology that will eventuallyminimisetheimpactofusedtextilesontheenvironment. Climatex 85, which is produced in Switzerland by Rohner Textil AG now acquired by Gessner AG, is a textile consisting of three fibre types, namely pure wool, polyester and ramie. It has been designed essentially as an upholstery fabric for climate control seating and attains its properties from theindividualcharacteristicsofeachofthefibretypes.Althoughthetextile is not manufactured from recycled fibre, it has been shown to be fully biodegradable and therefore compostable. Waste material from the manufacturing process can be used in nonwoven products but can also be used as gardening mulch. Further research by the company to develop
85
http://www.climatex.com/en/products/products_overview.html
For Defra
Page 90
December 2009
elasticityinthetextiledemandedchangesinmanufacturingtechniquerather than using other conventional noncompostable synthetic fibres such as elastane. Interface Fabrics Group86 (IFG) has produced a family of textiles based on theirTerratexproduct.Thisisafabricwhichismadefrom100%recycled material including postindustrial and postconsumer waste including recycled PET and wool. Herman Miller87 has worked closely with IFG and CargillDowtodevelopafabriccalledKIRA. Thisfabricisbasedonthepolymerpolylacticacid(PLA)whichCargillDow88 makesfromcornsugar.TheythenspintheresultingPLAfibreintoIngeo Fiber. Ingeo Fiber is a product marketed globally by NatureWorks89 LLC which is joint venture betweenCargill Dow and Teijin Limited90 of Japan establishedinDecember2007.IFGthenweavesthefibreintotheyarnituses toproduceKIRA. DesignTex introduced a new range of upholstery fabrics based upon ClimatexLifecyclein1999.Carnegie91offersarangeofcompostablefabrics whichincludeTerratexandClimatex. In the current situation, no recommendations are made to increase the investmentincreatingcompostablefabrics.
Barriers Most compostable fabrics unlikely to be suitable for municipal UK composting facilities. Environmental benefits versus recycling are not quantified. Confusion between compostable and recyclable products by consumers. Opportunities & Benefits Potential environmental benefit at end of life. Company-led collection schemes likely to be the most practical.
86 87
For Defra
Page 91
December 2009
8.4
Opportunities & Benefits Closed loop recycling possible. Substantial reduction in certain impacts possible. Attractive to end users
92
For Defra
Page 92
December 2009
8.5
8.5.1
93
94
For Defra
Page 93
December 2009
Figure 8.4: Tonnage of carpet and rug supplied into the UK market, 2004 - 2007
Figure 8.5: Types of carpet and rug supplied to the UK market, 2004 - 2007
Over 80% of the carpet and rug supplied into the UK market is tufted. Tuftedcarpethasbeenthepredominantcarpettypesincethelate1970s. Wecanassumethateachyearnewcarpetisreplacedforoldandthereforeon average550,000tonnesofcarpetandrugaredisposedofeachyear.Inmost
For Defra
Page 94
December 2009
cases a typical tufted carpet consists of the yarn and two layers of mostly polypropylene (PP) backing between which there is a calcium carbonate filled, styrenebutadiene latex rubber (SBR). The approximate weight proportions of each material95 are shown in Figure 8.6. The yarn, which makes up for approximately 46% by weight of a new carpet can be from a selection of synthetic fibres such as Nylon 6, Nylon 6,6 (both referred to as Polyamides),Polypropylene(polyolefin),andpolyesteroramixtureofthese withwool.Thewoolcontentofcarpetyarnisgenerallyfarlessthan20%but thelargestvolumeofcommercialanddomesticcarpetusessyntheticyarns. The proportion by weight of each of the synthetic fibres used is shown in Figure 8.6. It is noticeable that postconsumer waste contains a significant quantity of dirt which must be removed before any recycling of the remainingmaterialsisconsidered.Itisestimatedthatupto1kgofdirtcan be collected from 1m of endoflife carpet96. As well as being a time consuming process, cleaning also uses large quantities of water and detergents.Recyclingprocessesthatdonotrequirepretreatmentofendof life carpets are therefore considered preferential in terms of environmental impact.
Figure 8.6: Weight % of materials which make up a new and used tufted carpet or rug
Onthebasisofthesefigures,itcanbeestimatedthatapproximately253,000 tonnes of yarn, 192,500 tonnes of CaCO3, 55,000 tonnes of polypropylene backing and 49,500 tonnes of SBR are available for recycling each year (Figure8.7).
95
Braun M., Levy A.B. and Sifniades S., (1999), Recycling Nylon 6 Carpet to Caprolactam PolymerPlastics Technology & Engineering, Vol 38, No.3, 471-484. 96 Personal communication with Burmatex
For Defra
Page 95
December 2009
Figure 8.7: Tonnage of component materials available for recycling from carpet and rug each year
As SBR is a thermoset material and cannot be remelted or reshaped, this component of the carpet has found little use in recycling and is therefore usually disposed to landfill. However, several research institutes and companiesaroundtheworldareworkingonmethodstorecyclethermosets downtotheirchemicalunitswithionicliquids.Thebreakdownintermsof percentage types of yarn used in a typical carpet are shown in Figure 8.8 below.
Figure 8.8: Weight % of the various fibres used in carpets and rugs
For Defra
Page 96
December 2009
Thequantitiesofeachtypeofyarnthatisavailableforrecyclingisshownin Figure8.9below.
Figure 8.9: Tonnage of fibre type available for recycling from disposed carpet and rug each year
As the cost of Nylon and Nylon 6,6 is high, recycling of fibre is generally associatedwiththesematerials. InEuropetherehavebeenanumberofprojectstodeterminethefeasibilityof carpetcollectionandrecyclingschemesandalsotodevelopendproductsfor carpet recyclates. This effort began in 1993 when the European carpet industry, represented by the industry association GUT (Gemeinschaft umweltfreundlicherTeppichbodene.V.),agreedupontheVaalsDeclaration to develop economically and ecologically viable disposal and recycling systemsforcarpets. The TRA on Polymer Materials was an initiative set up by the European Commissiontopromotecollaborativeresearchandtechnologydevelopment betweenEuropesprocessindustriesandresearchinstitutes.Thereare four cluster groups with one dedicated to researching the recycling of polymer materials.Theobjectiveofthisgroupwastocontributetothedevelopment of costeffective and environmentally sound polymer recycling systems in Europe. From 1996 to 1999, a consortium of eight partners began work on theRecyclingofCarpetMaterials(RECAM)project,asubprojectoftheTRA onPolymerMaterials97.
Project Reference BE95-1337: Sustainable Closed Loop System for Recycling of Carpet Materials
97
For Defra
Page 97
December 2009
The aim of the RECAM project was to develop technologies to support a sustainable closedloop recycling and reuse system for postindustrial and postconsumercarpetwaste.EightEuropeanpartnersworkedonanumber oftasksaddressingissuesfromcollectionthroughtothedevelopmentofend markets. Specific elements of the project looked into collection, identification,sorting,cleaning,shredding,grinding,separation,mechanical /chemicalrecycling,closedlooprecyclingandlifecycleanalysis(LCA).The mainachievementsoftheRECAMprojectwere: a pilot project for the collection and reclamation of 20,000 tonnes of carpetingannuallyviaCarpetRecyclingEurope development and industrial implementation of a handheld identificationdeviceforfibrerecognition development of a rapid identification device (CONCORE). COCARE wasdevelopedasacodingsystemforeasycarpetidentification.Itsgoal is the simplification of recycling for textile floor coverings through the developmentofastandardisedEuropeancodefortextilefloorcoverings and the creation of the necessary technical prerequisites. A code is applied to the back of the carpet during production while at the same timethedatarelevanttorecycling arestoredinadatabase.Thestored dataiscollectedcentrallyandforwardedtotherecycler. planning of a sorting centre and indepth development of a handling system development of a simple depolymerisation process for treating polyamide carpets (PA6) without previous separation of other carpet constituents demonstrationofthedistinctecologicalbenefitsofintroducingcarpeting recyclingasdevelopedinthevariousprocessvariants.
CarpetRecyclingEurope(CRE)wassetupin1998asapilotprojectwiththe fundamental aim to implement the results obtained from RECAM. CRE establishedthefirstautomatedsortingplantforcarpetinMainztogatherthe data needed for the economic, technical and ecological evaluation of carpet recycling. The Mainz plant was able to sort up to 3.5 tonnes of carpet per hour for recycling. This pilot project demonstrated that the economic conditions atthe time made recyclingunfeasible asit was still possible and cheaper to send endoflife carpet to landfill and this resulted in the plant closingin2002. In 2002 Carpet Recycling Netherlands (CRN) was established to assess the feasibilityofintroducingacarpetwasterecyclingschemeintheNetherlands. The project results recommended that carpet waste be collected separately for use as a secondary fuel. These conclusions were based upon the outcomes of a comparative study between energy consumption and energy
For Defra
Page 98
December 2009
8.5.2
savings and a complex LCA study (see 98), based upon the RECAM LCA study.Thereisnoevidencetosuggestthatthishasbeenimplementedinthe Netherlandstodate. Fibre identification in carpets and rugs Carpetrecyclersneedtoidentifythepilefibresinordertofindthebestvalue formaterialsrecoveredfromthem.CarpetRecyclingUKhaveengagedwith the two major US manufacturers of near infrared identification (NIR) technologytoaddresstheproblemforUKrecyclers.IntheUK,marketpile fibre blends, particularly with wool, are well established and therefore instrumentshadtobemodifiedtomeetUKneeds.
8.5.3
Mechanical recycling of carpets Mechanical recyclingis themostcommonlyused recyclingprocess.Carpet fibresareseparatedandshreddedforuseinlowerorhighervalueproducts. A pelletizing machine can be used for polymer based carpet materials and these can then be used for injection moulded or extruded products. For woolbased carpets, shredded material is sold for use in a number of applicationsincludinganimalbedding. Inthe UK,mechanicalrecyclingisinoperation albeiton averysmallscale. However, mechanical recycling of carpet in niche areas, such as the exhibition industry, is evident. Although not directly aligned with the construction, demolition and refurbishment industry, the exhibition and eventssectorhasprovidedsomeinterestinginformationwithregardstothe recyclingofcarpetproducts. AsawholetheUKexhibitionsectorconsumesapproximately6,000tonnes99 of product, mainly polypropylene. This compares to the theoretically available quantity of polypropylene generated from post and preconsumer carpetandrugwastewhichisapproximately73,000tonnes. In partnership with the Polymer Cluster100 based at Warwick University ReedsCarpet,theUKslargestexhibitioncarpetingcontractor,hasdeveloped a recycling system for polypropylene exhibition carpets. A pelletizer converts endoflife exhibition carpets into polypropylene pellets which are then sold onto product manufacturers. A collection service is offered to
98
CARE Annual Conference, May 10-12, 2005 Update on European Carpet Recycling Activities and Experiences, Dr Edmund Vankaan. 99 Innovation in Green Technology Wins Reeds Carpet Recycling Ltd Prestigious Award Business Today Issue 133 p24 Northcliffe Press 100 Polymer Cluster - provides practical support and collaborative opportunities to small and mediumsized enterprises working in the polymer industries in the West Midlands region. http://www.polymercluster.co.uk/
For Defra
Page 99
December 2009
contractors for 2,000 m or more of exhibition carpet which have been used withina150mileradiusofCoventry.Deliveriesarealsoaccepteddirectlyto the plant free of charge. The recycling plant has a capacity of 4,000 tonnes peryearbutiscurrentlyrunningat1,000tonnes. It is believed that expanding this process to incorporate noncommercial carpetandPVCflooringisunderconsideration. With regards to individual manufacturers recycling efforts, there are a number of initiatives currently underway in the UK. Burmatex, have developedtheirRecoverrecyclingprocess.Utilisingacombinedheatand cryogenic process, bitumen backed carpet tiles and offcuts are made into a new backing system for carpet tiles. This is currently applied to post industrialwasteonly,butBurmatexarealsoinvestigatingthefeasibilityofa takeback service for installation offcuts and endoflife own brand carpet and carpet tile waste. Current thinking indicates that this source of carpet waste will be collected at the point of installation on the premise that replacementcarpetispurchasedfromBurmatex101.Workingwithanumber of partners, it is hoped that the scheme will be trialled initially in one area, butcompanyplansarethatthiswillbecomeaUKwideoperationinthenear future102. All collected materials will be recycled at the UK production facilityinWestYorkshire. A small number of carpet recycling businesses have been set up in the UK, and Greenback Recycling is one of the most successful to date, processing waste carpet material and recovering fibres. These are then sold as new gradesofplasticrecyclatesandvariousothervalueaddedproductssuchas horticulturalgrowingproducts. Inordertofacilitatethisprocess,collectioncontainersareplacedatanumber ofHouseholdRecyclingCentresacrosstheUKwhereendoflifecarpetscan be disposed of by the general public and small businesses. Once full, the containers are returned to the Greenback Recycling Facility, located near Swindon.Herethecarpetisinspectedforcontaminationandsortedbyfibre type and backing using infrared scanners. Once baled, the material is supplied as feedstock for the international plastics recycling market. Materialsacceptedincludepolypropylene,Nylon6and6,6,hessian,juteand wool.GreenbackRecyclinghasacapacityofapproximately4,000tonnesper monthandiscurrentlyoperatingatthe1,000tonnepermonthlevel. WM Fibres, a subsidiary of Wrace Technology (Manchester), is now no longer processing and the plant has been sold. Originally the plant used Italianmachineryspeciallydesignedtodealwitharangeofcarpetsandable
101 102
Burmatex The Burmatex Approach to Sustainability, June 2007 Personal communication with Burmatex
For Defra
Page 100
December 2009
toremovetheSBRlatex.WMFibressenttheirrecycledproduct,whichwas mainly fibre, for use in mattress making, sound proofing and other applicationsforfeltlikematerials.Muchoftheirprimaryfeedstockwaspre consumer waste or shortlife product from exhibitions. Trials were carried out using landfill tax funding and the support of SITA and Mersey Waste withpostconsumerwastebutproblemswereencounteredwiththelevelof dustanddirtcontamination. In the USA there are a number of well established mechanical recycling schemes for postconsumer carpet. The Tandus Company, encompassing three floor covering brands (Monterey, C&A and Crossley), have three programmes currently in place to support their carpet recycling programme103. Describing their carpet recycling initative as mining buildings instead of the earth for resources, the three supporting programmes,InfinityInitiative,RetrieveandFLOORE,eachcontributetothe collection and recycling of carpet waste. To date the programme has divertedapproximately60,000tonnesofcarpetfromlandfillintheUSAand displacedtheequivalentinvirginmaterialfromthemanufacturingprocess. C&A also offer customers a unique Sustainability Warranty which guarantees that all reclaimed materials will never be sent to landfill or incinerated. Created in 1994 the Infinity Initiative recycled postconsumer carpet into a new100%recycledcontentcarpetbackingcalledER.Thisbackingconsists of 25% postconsumer carpet with the remaining 75% consisting of post industrial waste from carpet manufacture and industrial waste from the automotiveindustry.TheInfinityInitiativeprocessconsistsofthefollowing stages:
Size Reduction: Reclaimed material is transported to a central processing facility in Dalton, Georgia where it is reduced in size to small pieces ready for processing. Pelletizing: The size-reduced carpet is then processed into fine, uniform sized pellets. Extrusion: The pellets are then extruded into a continuous, pliable rope which is transported by conveyor belt to the calendar. Calender: At this stage, the pliable material is rolled into a recycled composite sheet backing. Cutting: The final backing material is rolled and cut ready for bonding to nylon face materials and surplus stock is stored in rolls.
103
http://www.tandus.com/sustainability/recycling.aspx
For Defra
Page 101
December 2009
The finished Product: is a 100% recycled content backing which is also 100% recyclable.
Through their Retrieve programme, samples and product folders are retrieved at endoflife and these are reused and recycled in the Infinity Initiative. Toensureacontinuoussupplyofvinylbackedcarpetandvinylwasteforthe Infinity Initiative, Tandus established a carpet buyback programme, FLOORE. This provides a financial incentive for customers to return and recycle old nylon carpets which are uplifted when new Tandus flooring is fitted. All makes of uplifted carpets are accepted and these are then processedintheInfinityInitiative. AlthoughTandusproductsaresoldintheUKthroughtheirsubsidiary,CTF IPS Flooring Ltd, there is no UK based recycling facility in place at the momentandcollectedtilesarecurrentlysentbacktotheUSAforprocessing. This may be a feasible option for the UK in the future if the PVC backed carpet market grows from its current share of 25% although this would require significant startup funding to set up and operate a supporting recyclingfacility. The Antron Reclamation Programme, also operating in the USA, is another example of mechanical recycling. After starting efforts to recycle Nylon in 1985, INVISTA finally initiated the Antron Reclamation Programme carpet reclamation and recycling programme in 1991, alongside a consortium of environmentally aware carpet manufacturers, flooring contractors and end users. Recycling all types of carpet, more than 50,000 tonnes have been recycled since 2001 effectively saving approximately 280,000m of landfill space. It is stated that around 700 tonnes of carpet can be processed every month at the Antron Reclamation Centre in Calhoun, Georgia, which is suppliedbyover80collectionsitesintheUSA104. Some of the carpet based products that contain postconsumer recycled content, include EcoSoft carpet cushioning which contains 100% recycled content,ofwhich50%ispostconsumer.Therecycledcarpetisalsousedas feedstock material for a variety of other products including carpet engineering resins, automotive parts, furniture, pallets, filtration pipes, steppingstonesandceramictilebacking. The Antron Reclamation Programme accepts any type of carpet from any source.Thefeaturesoftheprogrammeareasfollows:
104
http://sustain-ed.org/PAGES/Waste/dupont_detail.htm
For Defra
Page 102
December 2009
carpet is collected from central collection facilities, from dealers or directlyattheprocessingsite inspection and evaluation of delivery takes place to determine the reclamationroute reuse is the priority: if the carpet can be refurbished it is donated to charityorsoldonforanominalfee if recycling is deemed more appropriate the carpet is mechanically processedintofeedstockmaterial the recycled material is packaged, sold and shipped to product manufacturerswhoincorporatetherecycledcontentintotheproduction ofnewproductsinvaryingpercentages endoflife carpet that cannot be reused or recycled is converted into carpetderivedfuel nocarpetiseversenttolandfill a full audit trail of the carpet recycling process is made available upon request
A specification105 is also available which provides guidance for the removal ofusedcarpetandoffcutsfrominstallationforreuseandrecycling. Mechanicalrecyclingofpostconsumercarpettilesisalsopossible,andthere areanumberofexamplestoprovethis.InterfacerecyclesPVCbackedtiles toprovidefeedstockfortheirGlasBacbackingmaterial.Uponcollection,the endoflife product is assessed as to whether it is suitable for the recycling process. If suitable, the backing material is separated and processed into a sheetmaterialforuseintheGlasBacbackingsystem. IntheUK,RenewalCarpetTilessuppliestwotypesofcarpettile;onewitha Nylonfacefibreandtheother,incorporatingawoolmixfacefibre.Bothof these products are backed with RenewGel which contains primarily chalk and rubber and is 100% recyclable. Renewal also has a scheme in place to uplift the product at end of life. The uplifted product is returned to the manufacturingsitewhereitisprocessedintoapowderedmaterialwhichis usedinthemanufactureofanunderlayproduct,ReLay.Thisunderlaycan beusedincommercialanddomesticwoolcarpetinstallations.However,no dataonvolumesareavailableasthisisanewschemeusingtileswhichhave onlybeeninthemarketplaceforaroundthreeyearsandarenotyetreadyfor therecyclingprocess106.(Theirestimatedlifespanisapproximatelysixyears.) Previousresearchonrecycling carpettiles includes aWRAPfunded project demonstrating the feasibility of recycling carpet tiles for use in an acoustic underlayproduct107,108.UndertakenbytheUniversityofBradford,theBolton
105 106
http://antron.net/pdf_files/long_form.doc Personal communication with Renewal Carpet Tiles 107 Mohsen Miraftab, Ian Rushforth and Kirill Horoshenkov, AUTEX Research Journal, Vol. 5, No2, June 2005 AUTEX, Acoustic underlay manufactured from carpet tile waste, Part 1
For Defra
Page 103
December 2009
Institute and AngloFelt, samples were produced from granulating PVC backed carpet tiles and binding the waste together with SBR foam. Trials indicated a good performance when compared to other commercial underlays.
Barriers Previous failures in UK/European carpet recycling. Opportunities & Benefits Technically successful projects. Recycling proven in niche markets. Market development potential in several large markets. Commercially feasible US ventures.
8.5.4
Chemical Recycling of Carpets The chemical recycling process involves separating the face fibre from the backingmaterialandapplyingadepolymerisationtechniquetothefacefibre. The raw materials can be extracted for reuse either in new carpet fibre productionorinotherproducts.Potentially,thismethodcanenableclosed loop recycling although this is currently only commercially available for Nylon6and6,6fibres. Nylon 6 is relatively easy to depolymerise to produce the base material caprolactam.Nylon6,6isnotaseasytodepolymerisebuttechnologieshave been developed that enable depolymerisation of mixed Nylon using ammonia. This produces the two compounds caprolactam and 1,6 diaminohexanewhichareusedtomakeNylon6andNylon6,6respectively. Theoverarchingbenefitofchemicalrecyclingisthatthereisnoresultingloss inproductqualityandtheprocesscanberepeated. Chemical recycling of carpet is limited to Nylon 6 and 6,6 fibre types, although this is not a new technology. BASF have been recycling post industrial Nylon 6 in the USA for more than 30 years and have recently developedtechnologytorecyclematerialswithalowNylon6content.This involvesasixstageprocess: carpetcollection carpetseparation monomerrecovery(caprolactam) polymerisation fibrespinning carpetmanufacture. Carpet recycling has not always been a commercial success in the USA. In 2000, the first commercial Nylon 6 recycling plant opened in Augusta,
108
Mohsen Miraftab, Ian Rushforth and Kirill Horoshenkov, AUTEX Research Journal, Vol. 6, No 1, March 2006 AUTEX, Acoustic underlay manufactured from carpet tile waste, Part 2.
For Defra
Page 104
December 2009
Georgia. A joint venture between DSM Chemicals and Honeywell International, the plant was capable of processing approximately 90,000 tpa of used Nylon 6 carpet waste. This equates to almost 20% of all Nylon 6 disposed of annually in the USA. A patented depolymerisation process enabledcaprolactam,thekeybuildingblockofNylon6,toberecoveredfrom endoflife carpets without any detrimental effect on technical properties. The recycling process eliminated the need for mechanical separation as wholecarpetscouldbefeddirectlyintothesystem. Production at the plant ceased in August 2001 due to problems with high runningcosts,plantinefficienciesandalowdemandforcaprolactam.There were also problems with the supply of waste materials as the collection system took longer to set up than anticipated. However, in 2006 Shaw IndustriesacquiredcompleteownershipoftheEvergreenRecyclingfacility. The recycling plant reopened in 2007 and the machinery was upgraded to allow for the processing of up to 135,000 tonnes of carpet waste each year, reclaimedthroughpartnershipssetupwithanumberofrecyclingcompanies across the USA109. Shaw Industries also runs a wastetoenergy project in Dalton,Georgiautilisingagasificationunitthatconvertspostconsumerand postindustrial carpet waste and laminate wood dust into energy. This process converts around 16,000 tpa of carpet waste and 6,000 tpa of wood flour. There are currently no chemical recycling facilities in the UK although a carpetrecyclingplantwasopenedinGermanyaroundthesametimeasthe sitesinAmerica,mentionedabove.CarpetwascollectedfromacrossEurope andtransportedtoPremnitzinGermanywhereitwasthensortedaccording to fibre type. Nylon 6 and polypropylene was recycled chemically and Nylon 6,6 mechanically recycled and pelletised for use in lowgrade components. All other fibre types were utilised in the energyfromwaste (EfW) facility at the factory site. However, the logistics of collecting and transporting endoflife carpet were difficult and yield rates were low. Combining this with the poor economic feasibility and lack of end markets fortherecyclates,theoperationwasclosedin2003.
Barriers Previous failures. High costs. Collection logistics. Lack of end markets for some chemical products Opportunities & Benefits Long term energy/carbon costs should improve economics.
8.5.5
Energy recovery
Carpet can also be incinerated to produce energy. In 1995, after the identification of a lack of data with regards to incineration of carpet waste,
109
http://www.shawfloors.com/Shaw-Environmental/Carpet-Recycling-Collection
For Defra
Page 105
December 2009
the Textile and Flooring Institute GmbH (TFI) in Germany, in partnership with the Forschungszentrum Karlsruhe, investigated the cocombustion of carpet waste with household waste. Ashes and emissions from municipal wasteincinerationplantsweretestedwithtrialsundertakenattheTAMARA researchplant.Thestudyconcludedthatthecocombustionofcarpetwaste inmodernmunicipalwasteincinerationplantsdoesnotleadtoanynegative influencestotheenvironment. Another project undertaken by the TFI in 1995 investigated whether shredded or pelletised carpet waste could be used as fuel in fluidised bed reactors in order to recover energy and compared this to other fuel types suchascoal.Itwasfoundthatcarpetwithanaturalfibretypesuchaswool has a low calorific value (approximately 19 MJ/kg) compared with Nylon carpets which were found to have an average calorific content of 26 MJ/kg. Polypropylenecarpetshadthehighestcalorificcontentat42MJ/kg. Carpetbackingscanhindertheincinerationprocess,particularlychalkfilled SBR. There have been some developments in overcoming this. In the UK, Brockway Carpets have developed an environmentally friendly carpet backing, Envirobac, which uses polyethylene as an adhesive, eliminating theneedforSBR.DevelopedaspartofaDTIfundedprojectwithaGerman textile manufacturer in 1996, approximately 12 million m of Envirobac has beenusedtodate110.Onebenefitisthatthiscanbeincineratedatendoflife without producing toxic emissions, and it has a calorific content similar to thatofcoal.BrockwayCarpetsisoneofonlytwomanufacturersintheUK usingthissystem,theotherbeingVictoriaCarpets.
Barriers Regulation concerning waste incineration. Opportunities & Benefits High calorific value
8.6
110
Personal communication with Brockway Carpets
For Defra
Page 106
December 2009
emissions of carbon dioxide are based on the fossil carbon content of the waste stream. For every kWh of electricity generated through waste treatment, emissions for generating each kWh of electricity from gas was used to quantify the greenhouse gas savings. Table 8.2 summarises the currentliteratureonthecarbonimpactofvariousdisposaloptions.Itisvery difficulttocomparethesevaluesastheboundaryconditionsandfunctional unitsforeachlifecycleassessmentdiffer.DatafromRef4arepresentedin person equivalent (PE) calculated using EDIP assessment methodology. These data are converted to carbon equivalents using the normalisation factors. Data reference from 6 includes various end of life scenarios for a particular textile and are shown under the respective column in Table 8.2 dependingonthemajorcomponentoftheendoflifeoption(i.e.Ref6bisa compositionofvariousscenariosbuttheoverallvalueisassignedtoReuse duetoitslargecontribution). Graphical representation of Table 8.2 is shown in Figure 8.10 for ease of visualisation to compare the carbon impacts. In Ref 1 collected textiles are assumedtoconsistofbothnaturalandsyntheticfibres,andbothdataforthe production of cotton and polyester have been used to calculate the offset, assuming a 50/50 split. The carbon impact data for the cotton and the syntheticfibresproductionwassourcedfromanLCAstudyintheliterature and from Ecoinvent, version 1.1 as polyester (Polyethylene terephthalate, granulate, amorphous, at plant/RER S), respectively. It is thought that this value is higher than currently accepted levels, as the latest version of the Ecoinvent database shows 2,360 and 2,750 kg CO2 equivalent for 1 tonne of production,forthetwofibres.Assuming50/50split,2,555kgCO2equivalent is the maximum available for recycling benefit. This figure is in good agreement with the other data on recycling found in the literature. We thereforebelieveRef1tobeanomalous. The Reuse option modelled in Ref 6 has the highest carbon benefit when the cotton Tshirts (Ref 6b) are mainly reused (60%) to replace the original product. When the garments are trousers (Ref 6e: 65% polyester, 35% cotton),however,thereusebenefitissubstantiallyreduced.Recyclingcotton Tshirts to low value added products like wipers (Ref 6c) also substantially reduces the potential carbon benefits available when original product is substituted. Data given in Ref 7 is based on the chemical recycling technology ECOCIRCLE developed by Teijin Fibers of Japan. It is claimed that the energyconsumption,aswellascarbondioxideemissions,canbereducedby 80% when compared to production from petroleum. The claimed energy reduction and carbon dioxide emission reduction of 80% are based on the carbon impact of production and incineration combined. The recycling benefit shown in Figure 8.10 for Ref 7 was calculated excluding the carbon burdenfromincinerationofwhichshownseparately.
For Defra Page 107
December 2009
Generally the results are in good agreement with the waste or resource hierarchy, favouring reuse of the product above recycling the material, and withenergyfromwasteandlandfillastheleastpreferredoptions.
For Defra
Page 108
December 2009
Table 8.2: Carbon impact of various end of life options available in the literature for a tonne of waste textile processed
Kg CO2e/tonne of textile waste processed Recycling Ref 1 Ref 2 Ref 3 Ref 4 Ref 4b Ref 4c Ref 4d Ref 4e Ref 4f Ref 5 -7853 -1284 -1750 na na na na na na na EfW 218.56 245 na -2051 2201 241 517 -316 17 145 Gasification 248.9 na na na na na na na na na MBT with RDF combustion 97 na na na na na na na na na MBT with Stabilisation 95.1 na na na na na na na na na Landfill 171.32 233 na na na na na na na na Reuse na na na na na na na na na na
Impact of Energy from Waste and Recycling Policy on UK Greenhouse Gas Emissions, Defra, Jan 2006 Waste Strategy for England 2007-Defra Carbon Balances and Energy Impact of Management of UK Wastes-Annex B Dec 2006 EDIPTEX Environmental Assessment of textiles-Working Report 24-2007 T-shirt of 100 % cotton (250 g) jogging suit of nylon microfibres with cotton lining, 706g work jacket of 65 per cent polyester and 35 per cent cotton, 770g blouse of viscose, nylon and elastane,200 g and 125 g per m tablecloth of cotton, 100%, 384g composite floor covering, nylon, polypropylene and latex foam, 2633g/m2. Ecoinvent database version 2.0 (textiles disposal, soiled, 25% water, to municipal incineration) Laura Farrant, Environmental benefits from reusing clothes, MSc Thesis, July 2008, Technical University of Denmark T-shirt of 100 % cotton (250 g), discarded for EfW T-shirt of 100 % cotton (250 g), 60% reused, 30% recycled 10% landfilled
Ref 6a
na
-310.71
na
na
na
na
na
Ref 6b
na
na
na
na
na
na
-6525
For Defra
Page 109
December 2009
Kg CO2e/tonne of textile waste processed Recycling Ref 6c Ref 6d Ref 6e Ref 7 -1258 na na -1102 EfW na -32 na 2103 Gasification na na na na MBT with RDF combustion na na na na MBT with Stabilisation na na na na Landfill na na na na Reuse na na -1682 na
T-shirt of 100 % cotton (250 g), Recycled 90% wipers, 10% EfW Trouser (65% polyester, 35% cotton), discarded for EfW Trouser (65% polyester, 35% cotton), 60% reused, 30% recycled 10% landfilled. ECO CIRCLE Teijin Fibres Close Loop Recycling System, http://www.teijinfiber.com/english/index.html
For Defra
Page 110
December 2009
Figure 8.10: Carbon impact of various end of life options available in the literature for a tonne of waste textile processed
8.7
Strategy Reuse - UK
Barriers General negative perception of reused clothing Low pricing of budget retailers
Opportunities Eco- and thrift image among certain customer market segments Internet-based sale / donation / swapping Greater doorstep collection possible via Local Authorities Favourable economics down to very low prices
Reuse - Overseas
Perceptions of damage to indigenous textiles industries Recycling rates and eventual fates of textiles not well known
Large markets with current strong demand Favourable economics for sorting and sale Possible new markets in concrete reinforcement (carpet fibres in particular), agriculture/horticulture and insulation (thermal and acoustic)
Recycling
For Defra
Page 111
December 2009
Strategy
Barriers Attractive fibres (e.g. wool) are declining in availability Many potentially recyclable fibres lack markets e.g. carpet Reluctance to change from existing materials to recyclates (e.g. fibres for concrete), particularly where these materials may already be low cost Post-consumer textile waste is forbidden (draft BS for geotextiles) Separation of fibre from backing of carpets difficult to achieve Several well known economic failures of UK/European textile recycling operations inhibiting action Logos and branding of corporate clothing
Opportunities Poor public understanding of attractiveness of collecting recycling grades Added value to recycled fibres through the use of additives Chemical recycling of corporate clothing and other synthetic-fibre rich consistent streams
Ourrecommendationsarethereforeasfollows: promotionofapositiveimageofreusedclothingbycharities,designers andthoseconcernedwithsustainableclothing. designandpurchaseoflonglastingstyles(e.g.byschools). audit trails and published recycling/reuse rates by textile recyclers and charitiesinordertogivepublicconfidencethroughtransparency,andto identify serious long term organisations with whom Local Authorities wouldwanttocollaborate. partnership with indigenous industries (e.g. remaking/modification) to impacttextileindustriesindevelopingcountriesmorepositively. innovation funding to create new markets and overcome specific technicalissues. developmentofgeotextilespecificationsthatmayuserecycledtextiles. review past failures of UK/European recycling to determine key factors forsuccessinfutureinitiatives. market development funding, including demonstration, standards and/orcapitalfundingforselectednewmarketsforrecycledtextiles,for examplethermalinsulationandconcretereinforcement.
For Defra
Page 112
December 2009
ItisclearthatthereisaneedintheUKtocontinueinvestmentinnewtechnologies for increasing the value of recycled textiles. This not only includes advances in mechanical and chemical processing but also includes managing the recycling of fibre and textiles containing larger quantities of biodegradable and compostable materialsenteringthewastestream. Manufacturersoftextilesandtextileproductsusingbiodegradableandcompostable fibreshouldbeencouragedtogaincertificationandapplytheappropriatemarkto avoid confusion with the general public about what is meant by biodegradability andcompostability.Thiswouldassistdownstreamorsecondaryrecycling. FurthersupportandencouragementshouldbeprovidedtoCarpetRecyclingUKin order to strengthen the UK carpet manufacturing and recycling industries. The structure and operations of the organisation CARE (Carpet America Recovery Effort)offeragoodbusinessmodelforthepromotionofcarpetstewardship.
For Defra
Page 113
December 2009
There are several different industries involved in recycling textiles, these include: collection garmentreuse(charityshopsandinternationalexports) sorting textilereuse(ragsandcloths) fibrereuse(nonwoventextiles). The development of standards within textile recycling should therefore examineallaspectsoftheindustry.
8.8
8.8.1
8.8.2
For Defra
Page 114
December 2009
8.8.3
country but is considered waste (and therefore illegal) in the destination country. Harmonisation of the interpretation of the definitions of waste across Europe could resolve this problem. It is clear though, that some inspectionandsortingofthematerialwithintheUKwouldbenecessaryin order for any compliance approval to be given. By definition, activities requiredtosortandgradetextilesintheUKpriortoexportingwouldmake foreign operations set up specifically for the purpose of sorting unsorted textiles redundant. There is an argument that this may increase the cost of exportingtextilesandmayresultinareductionofdiversionfromlandfillas foreignbuyersmovetocheapersourcesoftextilesfromalternativecountries. However,thealternativeargumentisthatsomesortingintheUKwillensure that a minimum quality standard of the exported textile is being met ensuringthatsignificantquantitiesofwasteorunusabletextilesarenotbeing transportedinternationally.Toavoidthis,theproductionofaUKstandard thatdefinesthepointatwhichtextilewastebecomesauseableresourcemust beratifiedthroughinternationalconsensus. In a related theme, WRAP and the Environment Agency have recently initiated a programme to develop protocols that enable material waste reprocessorstoreclassifytheirwastematerialasauseable material.Sucha schemecouldbethefirststepindevelopinginternationalstandard. The TRA has published a specification for textiles derived from charity shops.Itdescribesthequalityofmaterialunsuitableforsaleincharityshops whichissoldontotextilerecyclers.Thestandardisnonspecific,statingthat thetextilesshouldbefromUKsources,homogenouslymixed,cleananddry. The textile material should be free of other items, such as books, games, carpets and duvets, and packaged separately from shoes and bags. It also mentions the need for the textiles to be bundled in easily manageable weights(810kg). Textile reuse TheTRAhavealsopublishedastandardforwipingcloths.Itdefinesaseries of grades of wiping cloths, which both aids in the harmonisation of the industry and ensures that a purchaser is confident in the product. Nine different grades of wiper are briefly specified including fibre composition and materials that should be omitted. The standard also specifies that the wipers should be dry, clean, of a certain minimum size and not contain reusedwipers. Clearly, the TRA have published these standards in response to members requests and further work in this area may yield the development of a nationallyrecognisedstandard.
For Defra
Page 115
December 2009
8.8.4
Vendorsofsortedandunsortedtextilessuggestedthattherewaslittleneed for standards for the sale of waste textiles because their customers set specificationsfortheirmaterial.Theyalsofeltthatthediversityofmaterial andtheendusessuggestedthatasinglestandardwouldbeeithertoobroad tobeeffectiveortoonarrowtoenablewideapplication.This,though,isin conflictwithviewsexpressedbybuyersofsortedtextilematerialwherethere is some appetite for a series of recognised standards that ensure that the qualityofmaterialdeliveredtothemisofaspecifiedstandard. Fibre recycling Textileshreddersandfeltmanufacturerswereinterestedinthedevelopment of standards for the quality of material that they received. Even when specified in the purchase, it was difficult to ensure homogenous fibre compositionincludingfibretype,lengthandtowofthetextile.Thequality ofthisstartingmaterialaffectstheoverallqualityoftheresultantshredand therefore accurate information is an important factor in determining the outputqualityofthenonwoventextile.Inaddition,incertaincircumstances, there are safety implications for products requiring high levels of fire resistancewhichusehighlevelsofwool.Itisdifficulttoguarantee,without robust controls, the wool composition of a batch of rags destined for shredding. Purchasers of reclaimed fibres from shredders also expressed an interest in specification of the material they received. In addition to the information requestedbytextileshreddersonfibrecomposition,theywereinterestedin developingstandardswhichprohibitedtheinclusionofforeignmaterialsuch as buttons and zips and ensured that the delivered fibre length is greater thanaspecifiedminimum(underwhichfeltingisdifficultwithoutspecialist machinery).However,therewereconcernsthatalthoughastandardwould improve quality of material, the current scarcity of material in the marketplacemeantanymechanismwhichmayinitiallyremovetextilesfrom thewastestream,wouldaffectthequantityofmaterialavailableforuseand shouldthereforebeavoided.
8.9
For Defra
Page 116
December 2009
plasticpackaging(PAS103) wastewood(PAS104) paper(PAS105) tyreshredandgranulate(PAS107) tyrebalesforconstruction(PAS108) recycledgypsum(PAS109) have been developed for waste material. WRAP has also developed a standardfortheproductionofaggregatesfrominertwaste,whichappearsto beaimedprimarilyatensuringtheaggregatesareofsufficientqualitytonot be considered waste. This standard appears to be similar to the recent call for proposals for standards for recycled materials from WRAP and the Environment Agency. These standards have several important features, whichmaybeappropriateinthedevelopmentofawastetextilestandard: Grading of material: Standards can apply to different grades of material entering and leaving recycling facilities. It is acknowledged that there are many different grades of material both at the point of collection, which can bedependentonsource,ortheonwardsaleofmaterial,whichisdependent on its use. Material composition of batches of recyclate are specifically defined to encourage conformity across industry. This can also include morphologyofthematerial,itscolouranditsbulkform. Recordingofgradedmaterial:Thereareseveralexamplesinthestandards of logging and grading of material: importantly, a framework is given to ensure that the method of recording this information is harmonised. Also, specificationofaminimumsetofrequirementsbeforeabatchofmaterialcan belabelledofaspecificqualitybringstransparencytothemarketplace. Contamination:Limitsonthelevelandtypesofcontaminationofrecyclate materialaredescribed;thisensuresthatmaterialwhichisunfitforrecycling isremovedduringsortingandthattherecyclateisinasuitableconditionfor furtherprocessing. Storage and delivery: Guidelines are given on the storage and transportationofrecyclate.Thisistoensurethatthematerialisexposedtoa minimumnumberofcontaminantspriortorecyclingandcanhaveaneffect on the quality of the material. This is clearly important where reuse is an optioninrecyclingtextiles.Informationonthetypeandsizeofcontaineris also given to aid handling of the recyclate. Guidelines also describe safety protocolsthatshouldbefollowed(beyondthestatutoryminimum)toensure thatthematerialisstoredsafely. Testing procedures for grading: Information is provided on the standard test which must be performed to determine the grade and quality of the goods;thiscanrangefromvisualinspectionthroughtolaboratoryscreening.
For Defra Page 117
December 2009
8.11 Recommendations
Several examples of the potential benefits of standards have been identified within textile fibre recycling. Standards within this area should be explored both in traditional and novel fibre markets. PASs formapossibleapproachtosomeofthese. Quality protocols are of less use in creating markets for waste textiles, althoughofmorepossibleassistanceincarpetrecycling
For Defra
Page 118
December 2009
Summary of Recommendations
9.1
For Defra
Page 119
December 2009
9.2
9.3
Perceptions of the dumping of the Wests surplus clothing on lower incomefamiliesintheUKandoverseasdonotreflectaccuratelythelong traditionoftradeinusedclothing. Previousresearchonconsumerbehaviourhasidentifiedopportunitiesto increaserecyclingbyincreasingtheconvenienceoftextilescollection;by communicatingthatcheapordamagedclothinghasvaluetoacharityor recycler and should not be disposed of as residual waste; and by the promotionofreusebetweenindividuals.Charitiesandrecyclersshould encourage customers to donate cheap and damaged clothing, but avoidingincreasedcollectionofcontaminatedordampclothing. Directreusewithinfamily/friendshipnetworksissignificant,butmaybe declining. Exchange or sale between individuals facilitated by the internet is growing strongly, albeit from a small base. Combined with evidence of innovation and hybrid approaches, continued growth is expected.Encouragementofclassicstylesandslowlychangingfashion (e.g. within school clothing) will assist this. The latter issue could be addressedbyDFCSindiscussionwithretailersoverretentionofsimilar styles over several years. This will also make thrift shop operations withinschoolsmoreeffective. Useof textilebanksis growing asacollection methodfor usedtextiles. There are no significant barriers to the expansion of these schemes so longastheeconomicsoftextilerecyclingremainattractive.Numbersof charity shops have remained at a fairly consistent level in recent years, andnosignificantexpansionisexpectedinthenearfuture. There is little or no UK experience of instore collection. International experienceisofbothcontinuousandcampaigncollections.Continuous
Page 120
For Defra
December 2009
collections allied with synthetic fibre recycling have experienced some problems with consumer awareness, identification/labelling and the consequent costs. Familiarisation with other instore collections (e.g. batteries)maychangeretailerperceptions. Theavailabilityofkerbsidecollectionofusedtextileshasalmostdoubled since2002toover30%,butisstillonlyhalfofthatforglass,plasticsand metals.Previousconsumerbehaviourstudiesshowthatconvenienceisa major factor in increasing recycling/reuse rates for clothing. A greater proportion of LAs should offer kerbside collection of textiles so that recyclingavailabilitymatchesthatofotherrecyclates Thegrowthofcomingledhouseholdcollections(wherebyrecyclatesare collectedtogetherinasinglebox,andsortedatalaterpoint)isathreatto greaterrecyclingandreuseoftextiles,astextilesareunattractivetoMRF operatorsandthecollectionmethodsresultinthepoorconditionofthe textiles.Wherecomingledcollectiontakesplace,LAsshouldintroduce alternative textile recycling offerings such as partnerships with commercialtextilerecyclingcompaniestocollecttextilesseparatelyand ingoodcondition Lower levels of UK sorting and the direct shipping abroad of unsorted clothing is increasing, encouraged by robust overseas reuse and recycling markets and declining UK recycling markets. A level of UK sorting is desirable in order to service UK markets and also to reduce risk of exposure to more volatile overseas trading markets. Greater transparencyonfatesofclothingisrequiredfromindividualcompanies andfromtradeorganisations.Interventionssuchasinnovationfunding, demonstration projects andcapital equipment grantsshouldbeused to createnewmarketsforrecycledfibreintheUK. Collection and reuse/recycling of corporate clothing at end of life is lower than with conventional clothing due to the large volume of identical clothing, security and branding concerns and tax treatment. There are also opportunities due to its consistency, the increasing managementbycompaniesatendoflifeandincreasingawarenessofits environmentalimpact.Useofpublicprocurementinitiativestoincrease theoverallsustainabilityofcorporateclothingusedinthepublicsector, including improved endoflife management. This might include a demonstrationofclosedlooprecyclingorreuse.Greaterconsistencyin the application of tax rules to corporate clothing, with more detailed guidance on what constitutes acceptable corporate identification that also maximises the potential for reuse. Increased collection of used corporateclothingbycompaniesortheiragentsisrecommendedrather thanencouragingemployeestodisposeofclothingthemselves,however, wearersshouldbemadeawareoftheinherentcapacityforreuseofthe uniformstheywear.
Page 121
For Defra
December 2009
Textilerentalalreadypossessesthecollectioninfrastructureforefficient recycling.Particularproblemsremainwithsomeproductssuchasmats and specialist uniforms such as for clean rooms. Market development via innovation or demonstration funding for specific problem products willhelpincreaserecyclingratesinthissector A carpet collection infrastructure is being created to accept carpets and carpettilesfromHWRCs,albeitfromasmallbase,facilitatedbyCarpet Recycling UK. There is a small existing collection, sorting and reuse/recycling industry, often based on social enterprises and often supportedbyalargecarpettilemanufacturer.Therearealsolargerscale remanufacturing opportunities in carpet tiles, currently shipped to the USA. Market development via innovation, demonstration or capital equipment funding will assist in creating more robust markets for the carpet fibre and backing that will be produced from collection and sortingandforinvestmentinremanufacturingtechnology. It is clear that there is a need in the UK to continue investment in new technologies for increasing the value of recycled textiles. This not only includes advances in mechanical and chemical processing but also includes managing the recycling of fibre and textiles containing larger quantities of biodegradable and compostable materials entering the wastestream. Manufacturers of textiles and textile products using biodegradable and compostable fibre should be encouraged to gain certification and apply the appropriate mark to avoid confusion with the general public about whatismeantbybiodegradabilityandcompostability.Thiswouldassist downstreamorsecondaryrecycling. Further support and encouragement should be provided to Carpet Recycling UK in order to strengthen the UK carpet manufacturing and recycling industries. The structure and operations of the organisation CARE(CarpetAmericaRecoveryEffort)offeragoodbusinessmodelfor thepromotionofcarpetstewardship.
9.4
opportunities
for
recycling
Promote positive image of reused clothing by charities, designers and thoseconcernedwithsustainableclothing. Designandpurchaseoflonglastingstyles(e.g.byschools).
For Defra
Page 122
December 2009
Audit trails and published recycling/reuse rates by textile recyclers and charitiesinordertogivepublicconfidencethroughtransparency,andto differentiate serious long term organisations with whom Local Authoritieswouldwanttocollaborate. Partnership with indigenous industries (e.g. remaking/modification) to morepositivelyimpacttextileindustriesindevelopingcountries. Innovation funding to create new markets and overcome specific technicalissues. Developmentofgeotextilespecificationsthatmayuserecycledtextiles. ReviewpastfailuresofUK/Europeanrecyclingtodeterminekeyfactors forsuccessinfutureinitiatives. Market development funding, including demonstration, standards and/orcapitalfundingforselectednewmarketsforrecycledtextiles,for examplethermalinsulationandconcretereinforcement.
9.5
Several examples of the potential benefits of standards have been identified within textile fibre recycling. Standards within this area should be explored both in traditional and novel fibre markets. PASs formapossibleapproachtosomeofthese. Quality protocols are of less use in creating markets for waste textiles, althoughofmorepossibleassistanceincarpetrecycling.
For Defra
Page 123
December 2009
References
Nb. References in alphabetical order, not numbered in relation to footnotes 1. An Analysis of MSW MRF Capacity in the UK WRAP Report BUS013, 2007 2. Braun M., Levy A.B. and Sifniades S., (1999), Recycling Nylon 6 Carpet to Caprolactam Polymer-Plastics Technology & Engineering, Vol 38, No.3, 471484. 3. Carbon Balances and Energy Impact of Management of UK Wastes, Annex B; ERM, Defra project WRT 237, 2006 4. Carpet America Recovery Effort Annual Report 2007, CARE; 2007 5. Clothing Recycling and Producer Responsibility, Morley, N. et al. Paper presented at Waste 06, Stratford upon Avon, September 2006 6. Corporatewear Market Study, 2007-2012; 6th edition, Company Clothing 7. Crafting appearances: the Second Hand Clothing Trade and Dress Practice in Zambia Hansen, K.T., in Old Clothes, New Looks Palmer, A., Clark, H., (eds), Berg 2005, pg 103-117 8. Crockford W.W., Grogan W.P. and Chill D.S. (1993), Strength and Life of Stabilised Pavement Layers Containing Fibrillated Polypropylene, 72nd Annual Meeting of the Transportation Research Board, Paper 930888, Washington, D.C. 9. Desktop Textile Waste Study & Compositional Analysis, M E L Research, 2009 10. Environmental Assessment of textiles - Working Report No.24; EDIPTEX 11. Environmental Impact of Products Institute for Prospective Technological Studies, European Commission May 2006 12. Farrant, L. (2008) Environmental benefits from reusing clothes MSc Thesis, Technical University of Denmark 13. Geffroy, V. Cas des dchets textiles des mnages en France : La responsabilit largie des producteurs Paper presented at Confrence Internationale Responsabilit des producteurs 14. Gregson, L. & Crewe, L.; Second-hand Cultures, 2003 15. Groom J.L., Holmquist D.V. and Yarbrough K.Y. (1993), Use of waste nylon fibres in Portland cement concrete to reduce plastic shrinkage, in Proc. Recovery & Effective Reuse of Discarded Materials and By-Products for Construction of Highway Facilities, Denver, CO, Oct. 19-22, pp 179-183 16. Impact of Energy from Waste and Recycling Policy on UK Greenhouse Gas Emissions, ERM for Defra, 2006 17. Kerbside Recycling: Indicative Costs and Performance WRAP Project ROT024, 2008 18. Mapping of Evidence on Sustainable Development Impacts that Occur in the Life Cycles of Clothing ERM for Defra, 2007
For Defra
Page 124
December 2009
19. Material Health A mass balance and ecological footprint analysis of the NHS in England and Wales, Best Foot Forward Ltd and Stockholm Environmental Institute (University of York), 2004 20. Mattresses, Centre for Remanufacturing and Reuse, 2008 21. Miraftab, M., Rushforth, I. and Horoshenkov, K., AUTEX Research Journal, Vol.5, No2, 2005 22. Miraftab, M., Rushforth, I. and Horoshenkov, K., AUTEX Research Journal, Vol.6, No1, March 2006 23. Miraftab, M., Rushforth, I., Horoshenkov, K. and Swift, M.; Recycling carpet waste into acoustic underlay for commercial production, WRAP Project PLA4012, 2004, 24. Modelling the Impact of Lifestyle Changes on Household Waste Arisings, Maunder A. et al. Paper presented at Waste 06, Stratford upon Avon, September 2006 25. Public Understanding of Sustainable Clothing Nottingham Trent University and Sheffield Hallam University, for Defra, 2008 26. Radetic M., et al (2003) Application of recycled wool based nonwoven material for purification and cleaning of waters 9th Aachen Textile Conference, Aachen D 27-28 Nov., DWI Reports 126 pp 274-283. 27. Reclamation Led Approach to Demolition, BioRegional, 2007 28. Recycling of Low Grade Clothing Waste, Oakdene Hollins Ltd, Salvation Army Trading Co Ltd, Nonwoven Research Institute, Defra SW Project WRT152, 2006 29. Rubbish Theory: The Creation and Destruction of Value Thompson, M., Oxford University Press, 1979 30. Taxation issues in Corporatewear, 2009, CRR 31. The Composting Industry Code of Practice The Composting Association; 2005 32. The Second Hand Trade in England c.1600-1850 Lemire, B. in Old Clothes, New Looks: Second Hand Fashion Palmer, A., Clark, H., (eds), Berg 2005, pg 29-47 33. Ukay Ukay Chic: tales of second hand clothing and trade in the Philippine Cordillera, Milgram, B.L. in Old Clothes, New Looks: Second Hand Fashion Palmer, A., Clark, H., (eds), Berg 2005, pg 135-153 34. Vankaan, E. Update on European Carpet Recycling Activities and Experiences, CARE Annual Conference, 2005 35. Waste Strategy for England 2007 - Defra; 2007 36. Well Dressed?, Cambridge University, 2006
Websites
http://antron.net/ Accessed 02/09 http://www.cargill.com/ Accessed 02/09 http://www.carpet-burns.com/ Accessed 02/09 http://www.carpetrecovery.org/index.php (2006) Accessed 02/09
For Defra
Page 125
December 2009
http://www.carpet-rug.org/commercial-customers/green-building-and-theenvironment/recycle-recover-and-reuse.cfm Accessed 02/09 http://www.climatex.com/en/products/products_overview.html Accessed 02/09 http://www.geohay.com Accessed 03/09 http://www.hmeurope.com/ Herman Miller; Accessed 02/09 http://www.infiltratorsystems.com/ Accessed 03/09 http://www.interfaceeurope.com/Internet/otherfiles.nsf/Lookup/ReEntry_EN/$file/ReEnt ry_EN.pdf Accessed 03/09 http://www.lafiber.com/ Accessed 03/09 http://www.lerelais.org/Isolant-Metisse Accessed 02/09(in French) http://www.natureworksllc.com/ Accessed 02/09 http://www.nonwovens-innovation.com Accessed 02/09 http://www.nycon.com/NyconG.htm Accessed 03/09 http://www.shawfloors.com/Shaw-Environmental/Carpet-Recycling-Collection Accessed 03/09 http://www.statistics.gov.uk/downloads/theme_commerce/PRA20070/PRA17510_20070.pdf Accessed 02/09 http://sustain-ed.org/PAGES/Waste/dupont_detail.htm Accessed 02/09 http://www.tandus.com/sustainability/recycling.aspx Accessed 03/09 http://www.teijin.co.jp/english Accessed 02/09 http://www.wellmaninc.com/ Accessed 02/09 www.carnegiefabrics.com/ Accessed 02/09 www.interfacefabricsgroup.com Accessed 02/09
For Defra
Page 126