0% found this document useful (0 votes)
69 views136 pages

51 WKNM

Uploaded by

Heyder Heyderov
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
0% found this document useful (0 votes)
69 views136 pages

51 WKNM

Uploaded by

Heyder Heyderov
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd

Notices

4802 -- 4949/23

ADMIRALTY
NOTICES TO MARINERS
Weekly Edition 51
21 December 2023
(Published on the ADMIRALTY website 11 December 2023)

CONTENTS

I Explanatory Notes. Publications List


II ADMIRALTY Notices to Mariners. Updates to Standard Nautical Charts
III Reprints of NAVAREA I Navigational Warnings
IV Updates to ADMIRALTY Sailing Directions
V Updates to ADMIRALTY List of Lights and Fog Signals
VI Updates to ADMIRALTY List of Radio Signals
VII Updates to Miscellaneous ADMIRALTY Nautical Publications
VIII Updates to ADMIRALTY Digital Services

For information on how to update your ADMIRALTY products using ADMIRALTY Notices to
Mariners, please refer to NP294 How to Keep Your ADMIRALTY Products Up--to--Date.
Mariners are requested to inform the UKHO immediately of the discovery of new or suspected
dangers to navigation, observed changes to navigational aids and of shortcomings in both paper
and digital ADMIRALTY Charts or Publications.
The H--Note App helps you to send H--Notes to the UKHO, using your device’s camera, GPS and
email. It is available for free download on Google Play and on the App Store.
The Hydrographic Note Form (H102) should be used to forward this information and to report any
ENC display issues.
H102A should be used for reporting changes to Port Information.
H102B should be used for reporting GPS/Chart Datum observations.
Copies of these forms can be found at the back of this bulletin and on the UKHO website.
The following communication facilities are available:
NMs on ADMIRALTY website: Web: [Link]/msi
Searchable Notices to Mariners: Web: [Link]/nmwebsearch
Urgent navigational information: e--mail: navwarnings@[Link]
Phone: +44(0)1823 353448
+44(0)7989 398345
Fax: +44(0)1823 322352
H102 forms e--mail: sdr@[Link]
(see back pages of this Weekly Edition) Post: UKHO, Admiralty Way, Taunton,
Somerset, TA1 2DN, UK
All other enquiries/information e--mail: customerservices@[Link]
Phone: +44(0)1823 484444 (24/7)
 Crown Copyright 2023. All rights Reserved. Permission is not required to make analogue or PDF copies
of these Notices, but such copies may not be sold without the permission of the UKHO. For permission to
sell copies of the Notices or to make (non -- PDF) digital copies please email
[Link]@[Link]
I

GUIDANCE NOTES FOR THE USE OF ADMIRALTY NOTICES TO MARINERS


ON THE UKHO WEBSITE

The Weekly Notices to Mariners (NM) updates for paper Charts and Publications can be accessed via
[Link]/msi or the searchable NM Website [Link]/nmwebsearch The latest
digital NM Weekly update is available 10 days prior to the paper publication date; there are no
subscription fees for access to the UKHO Notices to Mariners Website.

NB: The NM database includes historical NM data from 1 January 2000, for NMs prior to 2000 the
Cumulative List of Notices to Mariners (NP234B-00) must be used.

Software required:

Adobe Acrobat Reader (Version 6.0 or later). Reader software can be obtained direct from the Adobe
website ([Link]).

SEARCHABLE NOTICES TO MARINERS

Enter the [Link]/nmwebsearch website and select the search option that you require
following the on screen instructions:

ƒ Search NMs by - Chart Number only


ƒ Search NMs by - Chart Number + Previous NM Number/Year
ƒ Search NMs by - Chart Number + Between Previous and Present Dates
ƒ Search for Single NM by NM Number/Year

To view the NM, NM Note or full-colour NM Blocks, click on the relevant link.

NOTICES TO MARINERS ON-LINE

Enter the [Link]/msi website, and then select Notices to Mariners. This will give you access
to the following range of Notice to Mariners services:
- ADMIRALTY NM Web Search
- Weekly NMs
- NM Block, Notes and Diagrams
- Annual NMs
- Cumulative NM List

FURTHER GUIDANCE NOTES

For further details of the online NM facilities please see the NM Guidance Notes on the website,
additional detail includes:
ƒ File content and description
ƒ PC and printer specifications

CUSTOMER SERVICE

If you experience any difficulties, please contact the UKHO Customer Services Team in the UK on:

Tel: +44 (0) 1823 484444 (office hours Monday-Friday 6am-10pm GMT and an on call service for
emergency permits operated 24/7)
Email: customerservices@[Link]

Our Singapore team can also be contacted outside of UK hours on:


Tel: +65 6424 4200

Wk51/23 1.2
,

ADMIRALTY NOTICES TO MARINERS


7KLV $'0,5$/7< 1RWLFHV WR 0DULQHUV %XOOHWLQ $10%  LV SXEOLVKHG E\ WKH 8.
+\GURJUDSKLF2IILFH 8.+2 7KH8.0DULWLPHDQG&RDVWJXDUG$JHQF\DFFHSWVWKDWERWK
WKH SDSHU DQG GLJLWDO IRUPV RI WKH $10% FRPSO\ ZLWK FDUULDJH UHTXLUHPHQW IRU 1RWLFHV WR
0DULQHUV ZLWKLQ 5HJXODWLRQ  RI WKH UHYLVHG &KDSWHU 9 RI WKH 6DIHW\ RI /LIH DW 6HD
&RQYHQWLRQ DQG WKH 0HUFKDQW 6KLSSLQJ 6DIHW\ RI 1DYLJDWLRQ  5HJXODWLRQV ERWK RI ZKLFK
FDPHLQWRIRUFH-XO\

:KLOHHYHU\HIIRUWLVPDGHWRHQVXUHWKDWWKHGDWDSURYLGHGWKURXJKWKH1RWLFHVWR0DULQHUV
VHUYLFHLVDFFXUDWHWKHXVHUQHHGVWREHDZDUHRIWKHULVNVRIFRUUXSWLRQWRGDWD,WLVLPSRUWDQW
WKDWWKHXVHUVKRXOGRQO\XVHWKHGDWDRQVXLWDEOHHTXLSPHQWDQGWKDWRWKHUDSSOLFDWLRQVVKRXOG
QRW EH UXQQLQJ RQ WKH XVHU¶V PDFKLQH DW WKH VDPH WLPH 8VHUV VKRXOG H[HUFLVH WKHLU
SURIHVVLRQDOMXGJHPHQWLQWKHXVHRIGDWDDQGDOVRFRQVXOWWKH0DULQHUV¶+DQGERRN 13 
IRUIXUWKHUGHWDLOV

7KH XVHU QHHGV WR EH DZDUH WKDW WKHUH LV D SRVVLELOLW\ WKDW GDWD FRXOG EH FRUUXSWHG GXULQJ
WUDQVPLVVLRQRULQWKHSURFHVVRIGLVSOD\RUSULQWLQJRQWKHXVHU¶VHTXLSPHQWRULIFRQYHUWHG
WR RWKHU VRIWZDUH IRUPDWV DQG LV DFFRUGLQJO\ DGYLVHG WKDW WKH 8.+2 FDQQRW DFFHSW
UHVSRQVLELOLW\ IRU DQ\ VXFK FKDQJH RU DQ\ PRGLILFDWLRQV RU XQDXWKRULVHG FKDQJHV PDGH E\
OLFHQVHHVRURWKHUSDUWLHV

Planning for the future


Plan with ADMIRALTY Maritime Data Solutions, brought to you by the United Kingdom Hydrographic Office.

Admiralty Way, Taunton, Somerset


TA1 2DN, United Kingdom
Telephone +44 (0)1823 484444
customerservices@[Link]
[Link]/ukho

Find out more about our market-leading


ADMIRALTY Maritime Data Solutions:
[Link]

and are trademarks of the Secretary of State for Defence

© Crown Copyright 2020. All rights reserved. Correct at the time of publishing.

 Wk51/23
I

EXPLANATORY NOTES
Dating
Weekly Notices are dated for the Thursday appropriate to the week that the printed version is despatched from the UKHO.
They are available earlier from the UKHO website.
Section I - Publications List
At the beginning of the Publications List is an index of ADMIRALTY Charts affected by the Publications List. Thereafter
there are a number of standard lists which contain details and announcements concerning charts and publications relevant for
the particular Weekly Notice. Full details of how to use the various lists contained in Section I are available in NP294.
Special Announcements and Errata are occasionally included at the end of this Section.
Section IA - Temporary and Preliminary (T&P) Notices
A list of T&P Notices in force (along with a list of those cancelled during the previous month), is included in the Weekly NM
each month (see below).
Section IB - Current Nautical Publications
Information about Publications including the current edition numbers is included in the Weekly NM at the end of March,
June, September and December.
Section II - Updates to Standard Nautical Charts
The notices in Section II give instructions for the updating of standard nautical charts and selected thematic charts in the
ADMIRALTY series. Geographical positions refer to the horizontal datum of the current edition of each affected chart
which is stated in the notice alongside the appropriate chart number. Positions are normally given in degrees, minutes and
decimals of a minute, but may occasionally quote seconds for convenience when plotting from the graduation of some older-
style charts. Where Leisure Products are referred to different horizontal datums from the standard nautical charts for that
geographical area, positions in the notices cannot be plotted directly on these products. Bearings are true reckoned clockwise
from 000° to 359°; those relating to lights are from seaward. Symbols referred to are those shown in NP5011. Depths and
heights are given in metres or fathoms and/or feet as appropriate for the chart being updated (abbreviated where necessary to
m, fm and ft respectively). Blocks and notes accompanying notices in Section II are placed towards the end of the section.
T&P Notices. These are indicated by (T) or (P) after the notice number and are placed at the end of Section II. They are
printed on one side of the paper in order that they may be cut up and filed. To assist in filing, the year is indicated after the
notice number and an in-force list is published monthly. Information from these notices is not included on charts before
issue; charts should be updated in pencil on receipt. Associated diagrams are reproduced with Blocks at the end of Section II.
Original Information. A star (*) adjacent to the number of a notice indicates that the notice is based on original
information.
Section III - Navigational Warnings
NAVAREA I Navigational Warnings in force at the specified time quoted in the header are reprinted in Section III. It is
recommended that this reprint should be kept in a file or book, followed by subsequent weekly reprints. Only the most
convenient ADMIRALTY Chart is quoted. The full text of all Warnings in force is included in Weeks 1, 13, 26 and 39 each
year.
Section IV - Sailing Directions
Updates to all Sailing Directions are given in Section IV of ADMIRALTY Notices to Mariners. Those in force at the end of
the year are reprinted in NP247(2) Annual Summary of ADMIRALTY Notices to Mariners Part 2. A list of updates in force is
published in Section IV of the Weekly Edition quarterly. Full details of how to keep Sailing Directions up-to-date can be
found in NP294 How to Keep Your ADMIRALTY Products Up-to-Date.
In 2018, the UKHO began the process of removing AIS and Racon information from ADMIRALTY Sailing Directions, as
this is held in greater detail within ADMIRALTY Radio Signals publications. During this transition, AIS and Racon
information will be removed from new editions of each Sailing Direction volume, and AIS and Racon information present in
existing Sailing Direction volumes will no longer be updated. For accurate, up-to-date information on AIS and Racons, refer
to ADMIRALTY Radio Signals publications.
Section V - Lights
Updates to all the List of Lights are given in Section V and may be published in an earlier edition than the chart-updating
notice. The entire entry for each light updated will be printed (including minor changes) and an asterisk (*) will denote which
column contains a change. In the case of a new light, or where a new sequence is added below the main light, an asterisk (*)
will appear under all columns. All Section V entries are intended to be cut out and pasted into the appropriate volume. It is
emphasised that the List of Lights is the primary source of information on lights and that many alterations, especially those of
a temporary but operational nature, are promulgated only as updates to the List of Lights. Light positions should be
regarded as approximate and are intended to indicate the relative positions of lights only. Charts should be consulted for a
more authoritative position. When a light is affected by a separate chart-updating notice, its Light List number is always
included in the relevant text contained in Section II. The range of a light is normally the nominal range, except when the
responsible authority quotes luminous or geographical range - see special remarks for ranges used by each country.

Wk51/23 1.4
,

6HFWLRQ9,5DGLR6LJQDOV
8SGDWHVWRDOOWKH5DGLR6LJQDOVDUHJLYHQLQ6HFWLRQ9,:KHQDFKDUWXSGDWLQJQRWLFHLVLVVXHGIRULQIRUPDWLRQWKDWLVDOVR
LQFOXGHG ZLWKLQ WKH 5DGLR 6LJQDOV WKH DSSURSULDWH YROXPH UHIHUHQFH QXPEHU LV TXRWHG IROORZHG LQ SDUHQWKHVHV E\ WKH
QXPEHURIWKH:HHNO\(GLWLRQFRQWDLQLQJ LQ6HFWLRQ9, WKHFRUUHVSRQGLQJXSGDWHWRWKHVHUYLFHGHWDLOV7KHXSGDWHVLQ
6HFWLRQ9,VKRXOGEHFXWRXWDQGSDVWHGLQWRWKHDSSURSULDWHYROXPHV
6HFWLRQ9,,0LVFHOODQHRXV3XEOLFDWLRQV
8SGDWHVWRWKHIROORZLQJVHOHFWHGPLVFHOODQHRXV1DXWLFDO3XEOLFDWLRQVDUHFRQWDLQHGLQ6HFWLRQ9,,
13 7KH0DULQHU¶V+DQGERRN
13$ 3DSHU&KDUW0DLQWHQDQFH5HFRUG
13& (1&0DLQWHQDQFH5HFRUG
13 $'0,5$/7<*XLGHWRWKH3UDFWLFDO8VHRI(1&V
13 $'0,5$/7<*XLGHWR,PSOHPHQWDWLRQ3ROLF\DQG3URFHGXUHV
13 +RZWR.HHS\RXU$'0,5$/7<3URGXFWV8SWRGDWH
13   $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±$WODQWLF2FHDQ
13   $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±,QGLDQDQG3DFLILF2FHDQV
13   $'0,5$/7<'LVWDQFH7DEOHV±$WODQWLF2FHDQ
13   $'0,5$/7<'LVWDQFH7DEOHV±3DFLILF2FHDQ
13   $'0,5$/7<'LVWDQFH7DEOHV±,QGLDQ2FHDQ
13 ,$/$0DULWLPH%XR\DJH6\VWHP
13 6\PEROVDQG$EEUHYLDWLRQVXVHGRQ$'0,5$/7<3DSHU&KDUWV
13 $'0,5$/7<*XLGHWR(1&6\PEROVXVHGLQ(&',6
$OO7LGHV3XEOLFDWLRQV
1DXWLFDO$OPDQDF3XEOLFDWLRQVLQFOXGLQJ6LJKW5HGXFWLRQ7DEOHV
6HFWLRQ9,,,±$'0,5$/7<'LJLWDO6HUYLFHV
,QIRUPDWLRQUHOHYDQWWR$'0,5$/7<'LJLWDO6HUYLFHV
)XUWKHU*XLGDQFH
7KH0DULQHU¶V+DQGERRN 13 JLYHVDIXOOHUH[SODQDWLRQRIWKHOLPLWDWLRQVRIFKDUWVDQGGHWDLOVRIWKH8.+2SROLF\IRU
WKHSURPXOJDWLRQDQGVHOHFWLRQRIQDYLJDWLRQDOO\VLJQLILFDQWLQIRUPDWLRQIRUFKDUWV'HWDLOVRIFKDUWXSGDWLQJPHWKRGVFDQEH
IRXQG LQ ³+RZ WR .HHS <RXU $'0,5$/7< 3URGXFWV 8SWRGDWH´ 13  $OO XVHUV DUH DGYLVHG WR VWXG\ WKHVH
SXEOLFDWLRQV
&$87,21$5<127(6
8SGDWLQJ
8SGDWLQJ LQIRUPDWLRQ LV SXEOLVKHG E\ :HHNO\ 1RWLFHV WR 0DULQHUV VXSSOHPHQWHG E\ QDYLJDWLRQDO ZDUQLQJV IRU LWHPV RI
LPPHGLDWHLPSRUWDQFH,WVKRXOGEHERUQHLQPLQGWKDWWKH\PD\EHEDVHGRQUHSRUWVZKLFKFDQQRWDOZD\VEHYHULILHGEHIRUH
SURPXOJDWLRQDQGWKDWLWLVVRPHWLPHVQHFHVVDU\WREHVHOHFWLYHDQGSURPXOJDWHRQO\WKHPRUHLPSRUWDQWLWHPVWRDYRLG
RYHUORDGLQJXVHUVWKHUHPDLQGHUEHLQJLQFOXGHGLQUHYLVHGHGLWLRQVRIWKHFKDUWVDQGSXEOLFDWLRQVFRQFHUQHG
/DZVDQG5HJXODWLRQV
:KLOHLQWKHLQWHUHVWVRIWKHVDIHW\RIVKLSSLQJWKH8.+2PDNHVHYHU\HQGHDYRXUWRLQFOXGHLQLWVSXEOLFDWLRQVGHWDLOVRIWKH
ODZVDQGUHJXODWLRQVRIDOOFRXQWULHVDSSHUWDLQLQJWRQDYLJDWLRQLWPXVWEHFOHDUO\XQGHUVWRRG
a WKDWQROLDELOLW\ZKDWVRHYHUFDQEHDFFHSWHGIRUIDLOXUHWRSXEOLVKGHWDLOVRIDQ\SDUWLFXODUODZRUUHJXODWLRQDQG
b WKDWSXEOLFDWLRQRIWKHGHWDLOVRIDODZRUUHJXODWLRQLVVROHO\IRUWKHVDIHW\DQGFRQYHQLHQFHRIVKLSSLQJDQGLPSOLHVQR
UHFRJQLWLRQRIWKHLQWHUQDWLRQDOYDOLGLW\RIWKHODZRUUHJXODWLRQ
5HOLDQFHRQ&KDUWVDQG$VVRFLDWHG3XEOLFDWLRQV
:KLOH HYHU\ HIIRUW LV PDGH WR HQVXUH WKH DFFXUDF\ RI WKH LQIRUPDWLRQ RQ $'0,5$/7< FKDUWV DQG ZLWKLQ QDXWLFDO
SXEOLFDWLRQVLWVKRXOGEHDSSUHFLDWHGWKDWLWPD\QRWDOZD\VEHFRPSOHWHDQGXSWRGDWH7KHPDULQHUPXVWEHWKHILQDOMXGJH
RIWKHUHOLDQFHKHFDQSODFHRQWKHLQIRUPDWLRQJLYHQEHDULQJLQPLQGKLVSDUWLFXODUFLUFXPVWDQFHVORFDOSLORWDJHJXLGDQFH
DQGWKHMXGLFLRXVXVHRIDYDLODEOHDLGVWRQDYLJDWLRQ
&KDUWV
&KDUWVVKRXOGEHXVHGZLWKSUXGHQFH WKHUHDUHDUHDVZKHUH WKHVRXUFHGDWDDUHROG LQFRPSOHWHRURISRRUTXDOLW\7KH
PDULQHUVKRXOGXVHWKHODUJHVWVFDOHDSSURSULDWHIRUKLVSDUWLFXODUSXUSRVHDSDUWIURPEHLQJWKHPRVWGHWDLOHGWKHODUJHU
VFDOHVDUHXVXDOO\XSGDWHGILUVW:KHQH[WHQVLYHQHZLQIRUPDWLRQ VXFKDVDQHZK\GURJUDSKLFVXUYH\ LVUHFHLYHGVRPH
PRQWKV PD\ HODSVH EHIRUH LW FDQ EH IXOO\ LQFRUSRUDWHG LQ SXEOLVKHG FKDUWV 2Q VPDOO VFDOH FKDUWV RI RFHDQ DUHDV ZKHUH
K\GURJUDSKLFLQIRUPDWLRQLVLQPDQ\FDVHVVWLOOVSDUVHFKDUWHGVKRDOVPD\EHLQHUURUDVUHJDUGVSRVLWLRQOHDVWGHSWKDQG
H[WHQW8QGLVFRYHUHGGDQJHUVPD\H[LVWSDUWLFXODUO\DZD\IURPZHOOHVWDEOLVKHGURXWHV
6DWHOOLWH'HULYHG3RVLWLRQVDQG&KDUW$FFXUDF\
0DULQHUVPXVWQRWDVVXPHWKDWFKDUWVZKLFKDUHUHIHUUHGWR:*6'DWXPRUWKRVHIRUZKLFKVKLIWVWR:*6'DWXPDUH
SURYLGHGKDYHEHHQVXUYH\HGWRPRGHUQVWDQGDUGVRIDFFXUDF\2QVRPHFKDUWVRZLQJWRWKHDJHDQGTXDOLW\RIWKHVRXUFH
LQIRUPDWLRQVRPHRIWKHFKDUWHGGHWDLOPD\QRWEHSRVLWLRQHGDFFXUDWHO\,QVXFKFDVHVPDULQHUVDUHDGYLVHGWRH[HUFLVH
SDUWLFXODUFDXWLRQZKHQQDYLJDWLQJLQWKHYLFLQLW\RIGDQJHUVHYHQZKHQXVLQJDQHOHFWURQLFSRVLWLRQLQJV\VWHPVXFKDV*36
)RUIXUWKHUGHWDLOVVHH7KH0DULQHU¶V+DQGERRN 13 7KLVDSSOLHVWRERWKSDSHUDQGGLJLWDO $'0,5$/7<5DVWHU
&KDUW6HUYLFHDQG(1& YHUVLRQVRIFKDUWV

 Wk51/23
I
[51/23]
ADMIRALTY Charts affected by the Publication List

ADMIRALTY Charts ADMIRALTY Charts International Charts ADMIRALTY Publications

125 5622_10 INT 1231 GP 100


130 5622_11 INT 1234
363 5622_12 INT 1422
810 5622_13 INT 1423
845 IN 292 INT 1540
847 NZ 5412 INT 1563
864 NZ 6821 INT 1764
1096 INT 1771
1521 INT 7021
1755
1821
1828
1889
3048
5622_8

UK COASTAL WARNING (WZ) NAVIGATIONAL WARNINGS

1. General Area Message Element

With effect from December 18th, 2023, UK Shipping Forecast Areas are used in the General Area
message element of UK Coastal Warning (WZ) Navigational Warnings to describe the broad
geographic area each message refers to. See ALRS Volume 3(1) (NP283(1)) diagram 'United Kingdom
Shipping Forecast Areas' for full details of broad geographic area limits. For further information on
message elements of Navigational Warnings See ALRS Volume 3(1) (NP283(1)) entry 'MARITIME
SAFETY INFORMATION, Extracts from the revised Joint IMO/IHO/WMO Manual on Maritime
Safety Information (MSI) January 2016'.

2. GUNFACTS/SUBFACTS

With effect from December 18th, 2023, GUNFACTS/SUBFACTS negative reports (i.e., notifications
when no hazardous operations are taking place) will not be promulgated.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk51/23 1.6
I

UKRAINE NAVIGATIONAL INFORMATION

Owing to insufficient information, it is not always possible to ensure that ADMIRALTY Nautical
Publications are completely up-to-date for new dangers or changes to aids to navigation.

Mariners are therefore advised to exercise particular caution when navigating in Ukrainian waters.

BALTIC SEA CHART DATUM 2000 (BSCD2000)

UKHO Products and Services, including foreign charts, in the Baltic Sea region are changing to a
new vertical reference system for depth and height information. During this transition period,
Charts may be referred to either mean sea level or the new BSCD2000. For further information
please contact the national charting authority and see ADMIRALTY Sailing Directions.
This note is to be reviewed in 2026.

PHOTOGRAPHY

ADMIRALTY publications utilise imagery from a wide variety of sources, mariners, port authorities and
other users. The UK Hydrographic Office (UKHO) welcomes new imagery of navigational aids, landmarks,
coastline, approaches to and from ports and berths. Imagery from the mariner's point of view is especially
helpful. Images can be sent to the UKHO using the email [Link]@[Link].
Please include the name and location of the feature in the image and how the image should be accredited
within ADMIRALTY publications.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.7 Wk51/23
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 21 December 2023

Chart Title, limits and other remarks Scale Folio 2024 Catalogue
page

363 Mexico - East Coast , Tampico . 1:25,000 83 122

Includes significant safety-related information as follows: changes to


submarine pipelines and depths.

Note: On publication of this New Edition former Notices 3741(P)/23,


4345(P)/23 are cancelled. This chart remains affected by Notice 1114(P)/23.

1828 International Chart Series - England - South-East Coast, Dover to North 1:37,500 1 24
INT 1563 Foreland.

New Edition to include latest information from British Government Surveys.

1889 International Chart Series, Scotland - East Coast, Cromarty Firth, Cromarty 1:15,000 6 28
INT 1540 to Invergordon.
Invergordon. 1:5,000

Includes updated hydrography from the latest British Governments and port
authority surveys and amendments to harbour areas.

Note: This chart remains affected by Notice 2721(T)/22.

Reproductions of Indian Government Charts


(Publication dates of these charts reflect the dates shown on the Indian Government Charts)

Chart Published Title, limits and other remarks Scale Folio 2024 Catalogue
page

IN292 30/04/2023 International Chart Series, India - West Coast, Dwārka to Mumbai. 1:750,000 41 58
INT 7021
Includes changes to depths, coastline, vessel reporting lines, wells,
submarine cables, port limits, platforms, aids to navigation and
fouls. (A modified reproduction of INT 7021 published by India.)

Note: On publication of this New Edition former Notice 1217(P)/19


is cancelled. This chart remains affected by Notices 2106(P)/19,
4326(P)/19, 4125(T)/21, 4368(T)/23, 4419(T)/23, 4637(T)/23,
4706(T)/23 and 4723(T)/23. This chart is to be deleted from the list
of charts affected by Notice 579(P)/20.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk51/23 1.8
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

Reproductions of New Zealand Government Charts


(Publication dates of these charts reflect the dates shown on the New Zealand Government Charts)

Chart Published Title and other remarks Scale Folio 2024 Catalogue
page

NZ5412 01/09/2023 New Zealand, North Island - East Coast, Port of Tauranga. 1:10,000 71 94
Western Channel. 1:20.000

Includes changes to a directional light and general updating


throughout. (A modified reproduction of chart NZ5412 published by
New Zealand).

NZ6821 01/10/2023 New Zealand, South Island - South Coast, Bluff Harbour and 1:12,000 72 94
Entrance.
Port of Bluff. 1:7,000

Includes changes to depths, leading lines, legends and aids to


navigation. (A modified reproduction of NZ6821 published by New
Zealand.

Note: This chart is to be deleted from the list of charts affected by


Notice 772(P)/23.

ADMIRALTY Publications

NP No. Title and other remarks Date Remarks

GP100 The Astronomical Almanac 2024 18/12/2023 The Astronomical Almanac


2024 is now available. This
ISBN: 978-0-70-774-6418 reference publication contains
high precision data covering the
positions of the Sun, Moon,
planets and minor planets,
timescales, reduction of celestial
coordinates, reference frames as
well as reference data for a variety
of astronomical objects.
Phenomena including rise/set
information, planetary magnitudes
and eclipses are also provided. It
is aimed at the professional and
amateur astronomer, space
scientist, geodesist, surveyor and
navigator.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.9 Wk51/23
I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED

ADMIRALTY CHARTS TO BE PUBLISHED 04 JANUARY 2024

New ADMIRALTY Charts


Charts to be 2024 Catalogue
Chart Title, limits and other remarks Scale WITHDRAWN Folio page

1821 South Atlantic Ocean, St Helena. 1:50,000 - 35 52


15°44’·20 S. — 16°14’·00 S., 5°32’·50 W.— 5° 53’·40 W.

A new chart providing improved coverage of the Island of Saint


Helena

New Editions of ADMIRALTY Charts


Charts to be 2024
Chart Title, limits and other remarks Scale WITHDRAWN Folio Catalogue
page

125 International Chart Series, North Sea, Netherlands, Approaches to 1:60,000 125 9 24, 32
INT 1422 Ijmuiden. INT 1422

Includes changes to depths, contours, submarine cables, wind farms,


entry prohibited areas, restricted areas and buoyage. (Published
jointly by the UKHO and the Hydrographer of the Royal
Netherlands Navy).

130 International Chart Series - North Sea, Netherlands, Approaches to 1:60,000 130 9 24, 32
INT 1423 Scheveningen. INT 1423
Scheveningen. 1:15,000

Includes changes to depths, aids to navigation, wind farms,


restricted areas, submarine cables, anchorage areas and coastline.
(Published jointly by the UKHO and by the Hydrographer of the
Royal Netherlands Navy.)

810 International Chart Series, Sweden - East Coast, Mälaren Eastern 1:50,000 810 10 36
INT 1771 Part. INT 1771
A Continuation of same scale. 1:50,000
B Stallarholmen – Kolsundet. 1:25,000
C Bockholms-Sundet. 1:25,000
D Strängnäs. 1:12,500
E Stäket. 1:10,000

Includes changes to depths, wrecks, legends and lights. (A modified


reproduction of INT 1771 published by Sweden.)

845 International Chart Series, Sweden - East Coast - Stockholms 1:25,000 845 10 36
INT 1234 Skärgård, Södertälje and Approaches. INT 1234
A Södertälje. 1:12,500
B Brandalsund. 1:12,500

Includes changes to depths and submarine cables. (A modified


reproduction of INT1234 published by Sweden.)

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk51/23 1.10
I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED

ADMIRALTY CHARTS TO BE PUBLISHED 04 JANUARY 2024

New Editions of ADMIRALTY Charts (continued)


Charts to be 2024
Chart Title, limits and other remarks Scale WITHDRAWN Folio Catalogue
page

847 International Chart Series, Sweden - East Coast, Norrköping and 847 10 36
INT 1231 Approaches. INT 1231
A Approaches to Norrköping. 1:25,000
B Norrköping Hamn. 1:15,000
C Continuation at Same Scale. [Link]

Includes changes to depths and buoyage. (A modified reproduction


of INT 1231 published by Sweden.)

864 International Chart Series, Sweden - East Coast, Hävringe to 1:50,000 864 10 36
INT 1764 Landsort. INT 1764

Includes changes to depths, wrecks, lights, buoyage and


obstructions. (A modified reproduction of INT1764 published by
Sweden.)

1521 Venezuela, Canal de Maracaibo Southern Part. 1521 87 124


A Maracaibo to Las Salina. [Link]
B Bahía de Maracaibo. 1:20,000
C Bajo Grande. 1:20,000
D La Salina. 1:20,000

Includes significant safety-related information as follows: new


wrecks and spoil ground; changes to depths, buoyage and Traffic
Separation Scheme.

New Editions of ADMIRALTY Small Craft Charts


Charts to be NP109A
Chart Title and other remarks Scale WITHDRAWN Catalogue page

5622_8 Port of Cork, The Sound and Ringabella Bay. 1:12,500 5622_8 43

Includes full updates for New Edition and Notices to


Mariners affecting source charts.

5622_10 Port of Cork, The Sound to Spike Island. 1:12,500 5622_10 43

Includes full updates for New Edition and Notices to


Mariners affecting source charts.

5622_11 Port of Cork, Cohb Road and West Passage. 1:12,500 5622_11 43

Includes full updates for New Edition and Notices to


Mariners affecting source charts.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.11 Wk51/23
I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED

ADMIRALTY CHARTS TO BE PUBLISHED 04 JANUARY 2024

New Editions of ADMIRALTY Small Craft Charts (continued)


Charts to be NP109A
Chart Title and other remarks Scale WITHDRAWN Catalogue page

5622_12 Port of Cork, Upper Harbour West. 5622_11 43


A Upper Harbour West. 1:12,500
B Continuation of River Lee to Cork. 1:12,500

Includes full updates for New Edition and Notices to


Mariners affecting source charts.

5622_13 Port of Cork, Upper Harbour East. 1:12,500 5622_13 43

Includes full updates for New Edition and Notices to


Mariners affecting source charts.

ADMIRALTY CHARTS AND PUBLICATIONS PERMANENTLY WITHDRAWN

ADMIRALTY Charts

Chart to be On publication of
WITHDRAWN Main Title New Chart/New Edition

363 Mexico - East Coast, Tampico. 363

1828 International Chart Series - England - South-East Coast, Dover to North 1828
INT 1563 Foreland. INT 1563

1889 International Chart Series, Scotland - East Coast, Cromarty Firth, Cromarty to 1889
INT 1540 Invergordon. INT 1540

IN292 International Chart Series, India - West Coast, Dwārka to Mumbai. IN292
INT 7021 INT 7021

NZ5412 New Zealand, North Island - East Coast, Port of Tauranga. NZ5412

NZ6821 New Zealand, South Island - South Coast, Bluff Harbour and Entrance. NZ6821

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk51/23 1.12
I
INTENTION TO WITHDRAW CHARTS

It is proposed to withdraw without replacement, the following ADMIRALTY Charts:-

Chart to be Date of
WITHDRAWN Main Title withdrawal

1096 Spain - North Coast, Ribadeo. 11 January 2024

1755 Spain - West Coast, Plans in Ria de Arousa. 11 January 2024

3048 Indian Ocean, Mauritius, Grand Port. 11 January 2024

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.13 Wk51/23
II

GEOGRAPHICAL INDEX

(1) Miscellaneous . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(2) British Isles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.8 – 2.9
(3) North Russia, Norway, The Færoe Islands and Iceland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.10
(4) Baltic Sea and Approaches . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.10 – 2.15
(5) North Sea and North and West Coasts of Denmark, Germany, Netherlands and Belgium . . . . . . . . 2.15 – 2.18
(6) France and Spain, North and West Coasts, and Portugal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.19 – 2.22
(7) North Atlantic Ocean. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.22 – 2.23
(8) Mediterranean and Black Seas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.23 – 2.30
(9) Africa, West Coast and South Atlantic . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.30
(10) Africa, South and East Coasts, and Madagascar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(11) Red Sea, Arabia, Iraq and Iran. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.31
(12) Indian Ocean, Pakistan, India, Sri Lanka, Bangladesh and Burma . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.31 – 2.33
(13) Malacca Strait, Singapore Strait and Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.33
(14) China Sea with its West Shore and China . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.33 – 2.37
(15) Japan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.37 – 2.38
(16) Korea and the Pacific Coasts of Russia . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(17) Philippine Islands, Borneo and Indonesia except Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.38 – 2.40
(18) Australia and Papua New Guinea . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.40 – 2.41
(19) New Zealand . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.41
(20) Pacific Ocean . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.42
(21) Aleutian Islands, Alaska and West Coast of North America including Mexico . . . . . . . . . . . . . . . . . . . . . . . 2.42
(22) West Coasts of Central and South America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.43
(23) Antarctica. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(24) East Coast of South America and The Falkland Islands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.43 – 2.44
(25) Caribbean Sea, West Indies and the Gulf of Mexico. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.44 – 2.46
(26) East Coast of North America and Greenland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.46 – 2.49
(27) T & P Notices . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.50 – 2.61

2.1
Wk51/23
II

INDEX OF NOTICES AND CHART FOLIOS

Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
4802 2.30 34 4858 2.34 47
4803* 2.15 9 4859 2.12 10
4804* 2.44 86 4860(P)/23 2.53 40
4805* 2.15 9 4861 2.27 31
4806(T)/23 2.50 10 4862 2.31 41
4807 2.38 48 4863 2.40 66
4808 2.10 10 4864 2.12 10
4809 2.23 26 4865(T)/23 2.51 7, 9
4810(T)/23 2.54 19, 20, 34, 35, 53, 87, 89, 4866 2.13 9, 10
92, 95 4867* 2.45 86
4811* 2.15 9 4868 2.17 9
4812 2.38 46 4869 2.20 17
4813* 2.10 10 4870 2.21 18
4814 2.10 10 4871 2.10 15
4815 2.11 10 4872 2.40 65
4816 2.11 11 4873 2.30 20
4817 2.23 25 4874 2.27 25
4818 2.33 45 4875 2.41 66
4819 2.33 47, 50 4876 2.28 28
4820 2.24 24 4877* 2.40 48
4821 2.43 95 4878 2.23 20
4822 2.33 50 4879* 2.8 2, 5
4823 2.24 31 4880* 2.9 8
4824 2.31 41 4881(P)/23 2.56 50
4825 2.19 16 4882 2.28 18
4826 2.39 48 4883 2.45 83
4827 2.34 50 4884 2.35 52
4828 2.16 2, 7, 9 4885 2.28 27
4829 2.24 24 4886 2.43 98
4830* 2.34 47 4887 2.45 86
4831 2.11 10 4888* 2.9 7
4832* 2.8 2, 7 4889 2.35 52
4833(T)/23 2.59 72 4890 2.21 16
4834(T)/23 2.61 87 4891 2.47 79
4835(P)/23 2.59 71 4892(T)/23 2.56 47
4836* 2.16 9 4893 2.42 89, 90, 92
4837 2.17 9 4894 2.41 65
4838 2.19 1, 16 4895 2.35 47
4839 2.42 73 4896 2.36 50
4840 2.46 81 4897 2.44 95
4841* 2.8 1, 2 4898 2.36 48, 50
4842 2.20 18 4899 2.32 43
4843 2.46 79 4900 2.14 10
4844 2.44 83 4901 2.36 47
4845 2.12 11 4902 2.29 25
4846 2.24 27 4903 2.41 66
4847 2.41 71 4904 2.29 28
4848 2.39 47, 48 4905 2.37 47
4849(T)/23 2.58 65 4906(T)/23 2.55 43
4850 2.25 27 4907(T)/23 2.51 9
4851 2.25 25 4908 2.21 17
4852* 2.26 30 4909 2.41 66
4853(T)/23 2.55 42, 43 4910* 2.9 2, 3
4854 2.22 15, 19 4911(P)/23 2.53 36
4855 2.44 86 4912 2.47 81
4856 2.27 25 4913 2.32 43
4857* 2.17 2, 7 4914(T)/23 2.50 10

2.2
Wk51/23
II

INDEX OF NOTICES AND CHART FOLIOS

Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
4915 2.46 83
4916 2.33 42, 43
4917 2.37 55
4918 2.37 55
4919 2.37 55
4920 2.38 54
4921(P)/23 2.56 55
4922(T)/23 2.57 55
4923(T)/23 2.57 55
4924(T)/23 2.58 55
4925(T)/23 2.58 54
4926(T)/23 2.60 53, 57, 59
4927 2.18 7, 9
4928 2.40 58
4929 2.21 18
4930 2.29 28
4931 2.29 26
4932 2.22 16, 17
4933 2.18 9
4934 2.48 81, 84
4935 2.31 40
4936* 2.9 1, 2
4937 2.37 47
4938 2.46 83
4939 2.18 9
4940(P)/23 2.55 41
4941 2.30 27
4942 2.23 20
4943(P)/23 2.52 30
4944 2.46 83
4945 2.42 89
4946 2.22 17
4947 2.22 18
4948 2.49 81
4949* 2.15 10

2.3
Wk51/23
II

INDEX OF CHARTS AFFECTED

Admiralty Chart No. Notices


Notices Admiralty
Admiralty Chart
Chart No.
No. Notices

20 4932 1183 4832


38 4862 1196 4817, 4902
39 4862 1250 4884
58 4862 1290 4869
73 4929 1291 4869
83 4842 1321 4802
86 4947 1323 4821
90 4899 1336 4848
110 4865T, 4907T 1338 4877
114 4939 1387 4802
116 4865T 1398 4916
122 4865T, 4927 1402 4866
128 4837, 4933 1406 4828, 4927
131 4931 1408 4927
141 4882 1417 4850
145 4882 1424 4874
202 4846 1443 4885
204 4846 1513 4876
207 4868 1535 4888
220 4846 1541 4904
252 4820 1580 4941
259 4866 1596 4876
266 4865T 1630 4927
317 4853T 1631 4865T
318 4853T 1632 4865T
319 4853T 1633 4865T
341 4905 1700 4851
365 4844 1701 4851
376 4844 1702 4851
414 4883 1704 4856, 4902
468 4804 1705 4856
485 4887 1710 4820
515 4846 1725 4895
527 4834T 1768 4896
529 4810T 1782 4827
537 4834T 1827 4841
544 4897 1862 4878
572 4834T 1863 4942
585 4867 1872 4828
591 4945 1873 4828
611 4810T 1874 4828, 4865T
674 4911P 1910 4820
693 4911P 1965 4892T
775 4852 1975 4832
792 4818 2007 4910
800 4815 2014 4808
802 4815 2015 4814
848 4852 2040 4900
849 4852, 4943P 2069 4853T
850 4852, 4943P 2070 4930
851 4852 2074 4852
892 4866 2079 4855
916 4809 2107 4866
929 4864 2108 4831
932 4812 2109 4877
933 4812 2146 4838
1000 4873 2151 4880
1001 4873 2182A 4828, 4857
1010 4816 2182B 4857
1025 4867 2215 4859, 4914T
1036 4937 2227 4845
1059 4830 2230 4861
1104 4932 2232 4823
1107 4839 2288 4900
1147 4810T 2347 4926T
1153 4869 2380 4879
1154 4869 2412 4926T
1175 4908 2414 4858
1180 4817 2419 4881P

2.4
Wk51/23
II

INDEX OF CHARTS AFFECTED

Admiralty Chart No. Notices


Notices Admiralty
Admiralty Chart
Chart No.
No. Notices

2422 4858 3780 4860P


2449 4828 3834 4848
2486 4912 3838 4877
2489 4912 3849 4938
2563 4912 3850 4938
2564 4912 3852 4915
2573 4829 3938 4901
2589 4831 3951 4860P
2590 4831 3981 4897
2591 4864 3982 4897
2601 4949 3990 4892T
2604 4934 4050 4893
2605 4934 4102 4854
2613 4838 4104 4810T
2636 4900 4112 4854
2645 4884 4115 4810T
2653 4889 4123 4819
2656 4838 4129 4819
2663 4932 4202 4810T
2675 4838 4203 4810T
2687 4834T 4209 4810T
2688 4900 4215 4810T
2731 4934 4216 4810T
2732 4840 4248 4886
2754 4912 4410 4807, 4826, 4898
2755 4912 4427 4826
2801 4934 4485 4928
2805 4934 4507 4926T
2813 4934 4509 4926T
2814 4934 4510 4810T, 4926T
2818 4934 4644 4849T
2829 4934 4648 4833T
2834 4851 4765 4843
2863 4944 4782 4891
2919 4934 4801 4893
2920 4948 4806 4810T
2959 4934 4810 4810T, 4893
2976 4870 4920 4893
2985 4946 5600_20 4936
3118 4802 5605_11 4828
3133 4878 5605_12 4828
3134 4878 5605_15 4841
3179 4860P 5606_1 4828
3204 4912 5606_10 4841
3232 4898 5606_6 4832
3233 4898 5607_1 4828
3235 4822 5607_2 4832
3237 4926T 5610_4 4910
3418 4936 5611_22 4879
3427 4825 5614_25 4857
3451 4912
3454 4912 Australian
3455 4912 Notices
3456 4912 Chart No.
3457 4912
3458 4912 Aus 143 4872
3459 4912 Aus 293 4863
3483 4877 Aus 357 4849T
3489 4807 Aus 807 4894
3561 4821 Aus 814 4903
3567 4871 Aus 826 4909
3599 4935 Aus 827 4875
3659 4890
3686 4934 German
3687 4934 Notices
Chart No.
3688 4912
3768 4844 DE 4 4803
3778 4860P DE 31 4806T
3779 4860P DE 42 4836

2.5
Wk51/23
II

INDEX OF CHARTS AFFECTED

German
Admiralty Chart No. Notices International
Admiralty Chart No. Notices
Notices
Chart No. Chart No.
DE 46 4805 INT 644 4849T
DE 50 4811, 4865T INT 648 4833T
DE 90 4865T INT 754 4853T
DE 164 4949 INT 755 4853T, 4916
DE 1516 4813 INT 756 4853T, 4906T
INT 801 4893
Indian INT 810 4810T, 4893
Notices INT 1042 4857
Chart No. INT 1043 4828, 4857
INT 1045 4811, 4865T
IN 31 4853T, 4906T INT 1070 4838
IN 32 4853T INT 1085 4810T
IN 33 4853T, 4916 INT 1201 4814
IN 203 4824 INT 1218 4900
IN 254 4940P INT 1219 4808
IN 301 4906T INT 1288 4900
IN 308 4853T INT 1300 4866
IN 351 4906T INT 1301 4866
IN 352 4853T INT 1302 4831
IN 353 4853T INT 1357 4806T
IN 473 4916 INT 1366 4836
IN 2068 4824 INT 1377 4864
IN 2079 4824 INT 1378 4866
IN 2107 4824 INT 1379 4831
IN 3033 4913 INT 1380 4831
INT 1416 4927
Japanese INT 1417 4865T
Notices INT 1418 4865T
Chart No.
INT 1420 4865T
JP 28 4921P INT 1425 4880
JP 53 4919 INT 1453 4805
JP 64B 4924T INT 1457 4803
JP 65 4923T INT 1461 4865T
JP 141 4925T INT 1465 4868
JP 150C 4920 INT 1472 4865T, 4927
JP 1030 4917 INT 1473 4865T, 4907T
JP 1102 4925T INT 1474 4828, 4865T
JP 1108 4925T INT 1476 4939
JP 1162B 4922T INT 1477 4865T
JP 1195 4918 INT 1478 4837, 4933
JP 1221 4926T INT 1480 4828
INT 1559 4888
INT 1561 4832
New Zealand INT 1637 4910
Notices
Chart No. INT 1705 4838
INT 1750 4838
NZ 64 4833T INT 1772 4815
NZ 522 4847 INT 1773 4815
NZ 6142 4835P INT 1803 4932
INT 1806 4869
International INT 1807 4869
Notices INT 1832 4825
Chart No. INT 1842 4946
INT 50 4893 INT 1848 4908
INT 102 4854 INT 1853 4869
INT 104 4810T INT 1901 4929
INT 112 4854 INT 1939 4878
INT 120 4866 INT 1971 4882
INT 202 4810T INT 1972 4882
INT 203 4810T INT 1993 4873
INT 209 4810T INT 1994 4873
INT 215 4810T INT 2088 4802
INT 407 4810T INT 2810 4802
INT 507 4926T INT 3184 4817, 4902
INT 509 4926T INT 3185 4817
INT 510 4810T, 4926T INT 3500 4829
INT 551 4877 INT 4182 4867
INT 553 4807 INT 5708 4877

2.6
Wk51/23
II

INDEX OF CHARTS AFFECTED

International
Admiralty Chart No. Notices Admiralty Chart No. Notices
Notices
Chart No.
INT 7019 4862
INT 7031 4916
INT 7229 4860P
INT 7241 4860P
INT 7314 4862
INT 7319 4824
INT 7329 4824
INT 7331 4940P
INT 7400 4853T
INT 7405 4853T
INT 7408 4853T
INT 7409 4853T
INT 7413 4853T
INT 7416 4853T
INT 7419 4906T
INT 7691 4911P
INT 7692 4911P
INT13420 4949
INT13450 4813

2.7
Wk51/23
II
4832* ENGLAND - East Coast - Wreck. Depth.
Source: Port of London Authority

Chart 1183 (INT 1561) [ previous update 4352/23 ] ETRS89 DATUM


Insert
15!,Wk 51° 41´·88N., 1° 18´·93E.

Chart 1975 [ previous update New Edition 13/07/2023 ] ETRS89 DATUM


Insert
15!,Wk 51° 41´·88N., 1° 18´·93E.
Replace depth, 119, with depth, 118 51° 41´·24N., 1° 17´·59E.

Chart 5606_6 [ previous update New Edition 30/11/2023 ] ETRS89 DATUM


Replace depth, 119, with depth, 118 51° 41´·20N., 1° 17´·58E.

Chart 5607_2 [ previous update 4352/23 ] ETRS89 DATUM


Insert
15!,Wk 51° 41´·88N., 1° 18´·93E.

4841* ENGLAND - South East Coast - Depths.


Source: Ramsgate Royal Harbour Authority
Note: This update is included in New Edition 1828, published 21 December 2023.

Chart 1827 (Panel C, Ramsgate) [ previous update 871/23 ] ETRS89 DATUM


Insert depth, 02 (a) 51° 19´·67N., 1° 25´·34E.
Delete depth, 09, close W of: (a) above

Chart 5605_15 (Panel B, Ramsgate) [ previous update New Edition 30/03/2023 ] ETRS89 DATUM
Insert depth, 02 (a) 51° 19´·67N., 1° 25´·34E.
Delete depth, 09, close W of: (a) above

Chart 5606_10 (Panel C, Ramsgate) [ previous update New Edition 23/11/2023 ] ETRS89 DATUM
Insert depth, 02 (a) 51° 19´·67N., 1° 25´·34E.
Delete depth, 09, close W of: (a) above

4879* SCOTLAND - West Coast - Buoy. Legend.


Source: iPowerboat Ltd

Chart 2380 [ previous update 955/23 ] ETRS89 DATUM


Insert
GVVQ(6)+LFl.10s
q 56° 41´·05N., 5° 08´·60W.

Chart 2380 (Panel B, Continuation of Loch Leven) [ previous update 955/23 ] ETRS89 DATUM
Insert legend, Buoyed Channel, orientated SW/NE, centred on: 56° 42´·32N., 5° 02´·85W.

Chart 5611_22 (Panel B, Loch Leven) [ previous update New Chart 11/11/2021 ] ETRS89 DATUM
Insert
GVVQ(6)+LFl.10s
q 56° 41´·06N., 5° 08´·61W.

2.8
Wk51/23
II

4880* ENGLAND - East Coast - Depths.


Source: Port of London Authority

Chart 2151 (INT 1425) [ previous update 3165/23 ] ETRS89 DATUM


Insert depth, 81 (a) 51° 27´·857N., 0° 17´·754E.
Delete depth, 82, close NE of: (a) above
depth, 82, close S of: (a) above

4888* ENGLAND - East Coast - Drying height. Depth.


Source: ABP Lowestoft

Chart 1535 (INT 1559) [ previous update 3589/23 ] ETRS89 DATUM


Insert drying height, 01, enclosed by 0m low water line (a) 52° 28´·18N., 1° 45´·53E.
Delete depth, 16, close N of: (a) above

4910* SCOTLAND - West Coast - NM Blocks.


Source: Peel Ports

Chart 2007 (INT 1637) (Panel A, River Clyde) [ previous update 2452/23 ] ETRS89 DATUM
Insert the accompanying block, centred on: 55° 56´·0N., 4° 34´·5W.

Chart 5610_4 (Panel B, Pillar Bank to Dumbarton Castle) [ previous update 4451/22 ] ETRS89 DATUM
Insert the accompanying block, centred on: 55° 56´·0N., 4° 34´·5W.

Chart 5610_4 (Panel C, Dumbarton Castle to Bowling) [ previous update 4451/22 ] ETRS89 DATUM
Insert the accompanying block, centred on: 55° 56´·0N., 4° 34´·0W.

4936* ENGLAND - South Coast - Drying heights.


Source: Shoreline Surveys Ltd

Chart 3418 [ previous update 4696/23 ] ETRS89 DATUM


Insert drying height, 27 (a) 50° 47´·44N., 0° 57´·07W.
Delete drying height, 21, close E of: (a) above

Chart 5600_20 [ previous update 2905/23 ] ETRS89 DATUM


Insert drying height,27 (a) 50° 47´·44N., 0° 57´·07W.
Delete drying height, 21, close E of: (a) above

2.9
Wk51/23
II

4871 FØROYAR - Submarine power cable.


Source: Faroese Notice 6/16/23

Chart 3567 [ previous update 4273/23 ] WGS84 DATUM


Insert submarine power cable, ÉÊÉ, joining: 62° 09´·14N., 7° 09´·33W.
62° 09´·00N., 7° 09´·97W.
62° 08´·55N., 7° 10´·47W.
62° 08´·20N., 7° 11´·28W.

4808 GERMANY - Baltic Coast - Buoy.


Source: German Notice 20/40/23
Note: This update is included in New Edition 2015, published early 2024.

Chart 2014 (INT 1219) [ previous update 4740/23 ] WGS84 DATUM


Insert
G;Fl(5)Y.20s
f ODAS
54° 24´·96N., 14° 18´·00E.

4813* GERMANY - Baltic Coast - Spoil ground. Legend.


Source: WSA Ostsee 364/23

Chart DE 1516 (INT 13450) [ previous update 4408/23 ] WGS84 DATUM


Insert limit of spoil ground, pecked line, joining: (a) 54° 30´·226N., 13° 43´·656E.
(b) 54° 29´·957N., 13° 43´·664E.
(c) 54° 29´·952N., 13° 43´·201E.
(d) 54° 30´·222N., 13° 43´·193E.
legend, Spoil Ground 5650S, within: (a)-(d) above

4814 SWEDEN - South Coast - Buoyage.


Source: Swedish Notice 990/18100/23

Chart 2015 (INT 1201) (Panel B, Ystad) [ previous update 4631/23 ] WGS84 DATUM
Move
BdQ.R, from: 55° 24´·869N., 13° 48´·742E.
to: 55° 24´·840N., 13° 48´·724E.

CbQ.G, from: 55° 24´·815N., 13° 48´·859E.


to: 55° 24´·791N., 13° 48´·859E.

CbQ.G, from: 55° 24´·671N., 13° 48´·684E.


to: 55° 24´·640N., 13° 48´·705E.

CbQ.G, from: 55° 24´·547N., 13° 48´·609E.


to: 55° 24´·491N., 13° 48´·547E.

BdQ.R, from: 55° 24´·617N., 13° 48´·456E.


to: 55° 24´·694N., 13° 48´·541E.

2.10
Wk51/23
II

4815 SWEDEN - East Coast - Light.


Source: Swedish Notice 990/18097/23

Chart 800 (INT 1773) [ previous update 4747/23 ] WGS84 DATUM


Amend Espholmen light to, Fl(2) WRG 3s 59° 26´·76N., 16° 14´·59E.

Chart 802 (INT 1772) [ previous update 4591/23 ] WGS84 DATUM


Amend Espholmen light to, Fl(2) WRG 3s 59° 26´·76N., 16° 14´·59E.

4816 SWEDEN - East Coast - Buoyage.


Source: Swedish Notice 990/18118/23

Chart 1010 [ previous update 5174/22 ] WGS84 DATUM


Move
Jd, from: 65° 32´·99N., 22° 13´·08E.
to: 65° 32´·98N., 22° 13´·18E.

Jd, from: 65° 32´·81N., 22° 14´·13E.


to: 65° 32´·83N., 22° 14´·04E.

Jd, from: 65° 32´·46N., 22° 16´·05E.


to: 65° 32´·47N., 22° 15´·96E.

4831 DENMARK - Islands - Buoy. Measuring instrument. Rock.


Source: Danish Chart Corrections 20/170/23, 20/173-174/23 and 20/176/23

Chart 2108 (INT 1302) [ previous update 4077/23 ] WGS84 DATUM


Insert
J;[Link]. 55° 53´·24N., 10° 49´·99E.

Chart 2589 (INT 1379) [ previous update 2889/23 ] WGS84 DATUM


Insert
J;[Link]. 55° 53´·22N., 10° 50´·04E.

. 56° 17´·91N., 10° 52´·20E.

Chart 2590 (INT 1380) [ previous update 980/23 ] WGS84 DATUM


Insert
J;[Link]. 55° 53´·22N., 10° 50´·04E.

. 56° 17´·91N., 10° 52´·20E.

2.11
Wk51/23
II

4845 ESTONIA - Rocks. Depth. Restricted area.


Source: Estonian Notice 8/116-117/23
Note: Former Notice 5618(T)/20 is cancelled.

Chart 2227 (Panel, Vanasadam) [ previous update 4272/23 ] WGS84 DATUM


Insert
4)+ with seabed type, R 59° 26´·958N., 24° 46´·035E.
depth, 96, enclosed by 10m contour 59° 26´·722N., 24° 46´·186E.

9%+ with seabed type, R 59° 26´·764N., 24° 46´·228E.

6%+ with seabed type, R 59° 26´·727N., 24° 46´·295E.

9Ó+ with seabed type, R 59° 26´·736N., 24° 46´·472E.

Chart 2227 [ previous update 4272/23 ] WGS84 DATUM


Insert limit of restricted area, anchoring, fishing and diving
prohibited, pecked line, joining: 59° 33´·65N., 24° 44´·70E.
59° 33´·65N., 24° 45´·00E.
59° 33´·48N., 24° 45´·00E.
59° 33´·48N., 24° 44´·70E.

4859 LATVIA - Note. Legend.


Source: Latvian Chart 113

Chart 2215 [ previous update 3703/23 ] WGS84 DATUM


Insert the accompanying note, HISTORIC WRECKS, centred on: 56° 58´·07N., 22° 51´·04E.
Amend legend to, Historic Wk (see Note), centred on: 57° 45´·00N., 22° 37´·61E.

4864 DENMARK - East Coast - NM Block. Buoy. Marine Reserve. Harbour limit. Light-beacon. Beacon.
Light.
Source: Danish Chart Corrections 8/58-59/23
Note: Former Notice 4144(P)/20 is cancelled.

Chart 929 (Panel, Horsens) [ previous update 5549/18 ] WGS84 DATUM


Insert the accompanying block, centred on: 55° 51´·5N., 9° 51´·8E.
Delete
J\ 55° 51´·480N., 9° 52´·719E.
limit of marine reserve, ÇMR Ç, and associated legend,
Nature Reserve Æ, joining: 55° 51´·308N., 9° 52´·402E.
55° 51´·358N., 9° 52´·412E.
55° 51´·322N., 9° 52´·750E.

2.12
Wk51/23
II
4864 DENMARK - East Coast - NM Block. Buoy. Marine Reserve. Harbour limit. Light-beacon. Beacon.
Light. (continued)

Chart 929 [ previous update 5549/18 ] WGS84 DATUM


Insert
T©Iso.R.2s
j 12m 10M
(a) 55° 51´·45N., 9° 51´·49E.
Delete
Kj,© close E of: (a) above

¶ Iso.R.2s 12m 10M, close SE of: (a) above


Insert harbour limit, pecked line, joining: 55° 51´·60N., 9° 52´·53E.
(b) 55° 51´·60N., 9° 52´·77E.
Delete former harbour limit, pecked line, joining: (b) above
55° 51´·70N., 9° 52´·77E.
limit of marine reserve, ÇMR Ç, and associated legend,
Nature Reserve Æ, joining: 55° 51´·31N., 9° 52´·40E.
55° 51´·36N., 9° 52´·41E.
55° 51´·22N., 9° 53´·69E.
55° 50´·65N., 9° 53´·68E.

Chart 2591 (INT 1377) [ previous update 3279/23 ] WGS84 DATUM


Delete limit of marine reserve, ÇMR Ç, and associated legend,
Æ , joining: 55° 51´·33N., 9° 52´·49E.
55° 51´·20N., 9° 53´·65E.
55° 50´·65N., 9° 53´·69E.

4866 DENMARK - East Coast - Depths. Wrecks.


Source: Danish Chart Corrections 27/261/23, 27/265/23 and 27/270/23

Chart 259 (INT 120) [ previous update 3221/23 ] WGS84 DATUM


Replace depth, 104, with depth, 101 57° 39´·1N., 10° 52´·1E.

2.13
Wk51/23
II
4866 DENMARK - East Coast - Depths. Wrecks. (continued)

Chart 892 (INT 1378) [ previous update 4420/23 ] WGS84 DATUM


Insert
26,Wk (a) 57° 32´·51N., 10° 56´·08E.
Delete
^PA, close N of: (a) above
Insert depth, 101 (b) 57° 38´·59N., 10° 52´·10E.
Delete depth, 104, close NW of: (b) above
Insert depth, 154 (c) 57° 38´·91N., 10° 50´·48E.
Delete depth, 164, close S of: (c) above
Replace
^ with 22%,Wk 57° 41´·77N., 10° 52´·94E.

22,Wk with 28,Wk 57° 33´·21N., 10° 48´·17E.

Chart 1402 (INT 1300) [ previous update 4737/23 ] WGS84 DATUM


Insert depth, 101 (a) 57° 38´·6N., 10° 52´·1E.
Delete depth, 104, close W of: (a) above

Chart 2107 (INT 1301) [ previous update 4737/23 ] WGS84 DATUM


Insert
26,Wk (a) 57° 32´·51N., 10° 56´·08E.
Delete
^PA, close N of: (a) above
Insert depth, 101 (b) 57° 38´·59N., 10° 52´·10E.
Delete depth, 104, close NW of: (b) above
Replace
^ with 22%,Wk 57° 41´·77N., 10° 52´·94E.

4900 POLAND - Landmark. Light. Legends.


Source: Polish Notice 26/327/23

Chart 2040 (INT 1218) [ previous update 3383/23 ] WGS84 DATUM


Amend legend to, RADIO MAST (R Lt), centred on: 54° 33´·24N., 18° 29´·72E.

Chart 2288 [ previous update 4704/23 ] WGS84 DATUM


Amend legend to, MAST, centred on: 54° 33´·0N., 18° 30´·6E.

Chart 2636 [ previous update 3833/23 ] WGS84 DATUM


Delete
Ï Aero 3F.R.112m (vert) 54° 32´·755N., 18° 32´·171E.

Chart 2688 (INT 1288) [ previous update 4548/23 ] WGS84 DATUM


Amend legend to, RADIO MAST, centred on: 54° 32´·77N., 18° 31´·48E.
legend to, (R Lt), centred on: 54° 32´·73N., 18° 32´·42E.

2.14
Wk51/23
II

4949* GERMANY - Baltic Coast - Buoyage.


Source: DK DMA 46/1109/23

Chart DE 164 (INT 13420) [ previous update New Chart 23/11/2023 ] WGS84 DATUM
Insert
J;Fl(5)Y.20s
f ODAS
54° 50´·67N., 12° 41´·39E.
54° 49´·77N., 12° 36´·71E.
54° 47´·62N., 12° 34´·67E.
54° 46´·23N., 12° 32´·11E.

Chart 2601 [ previous update 4412/23 ] WGS84 DATUM


Insert
J;Fl(5)Y.20s
f ODAS
54° 47´·62N., 12° 34´·67E.
54° 46´·23N., 12° 32´·11E.

4803* GERMANY - North Sea Coast - Foul.


Source: WSA Weser-Jade-Nordsee 133/23

Chart DE 4 (INT 1457) (Panel B, Bremerhaven) [ previous update 4113/23 ] WGS84 DATUM
Insert
« 53° 31´·040N., 8° 33´·000E.

Chart DE 4 (INT 1457) [ previous update 4113/23 ] WGS84 DATUM


Insert
« 53° 31´·04N., 8° 33´·00E.

4805* GERMANY - North Sea Coast - Foul.


Source: WSA Elbe-Nordsee 320/23

Chart DE 46 (INT 1453) (Panel, Brunsbüttel) [ previous update 4230/23 ] WGS84 DATUM
Delete
« 53° 52´·600N., 9° 09´·700E.

Chart DE 46 (INT 1453) [ previous update 4230/23 ] WGS84 DATUM


Delete
« 53° 52´·60N., 9° 09´·70E.

4811* NORTH SEA - German Sector - Wrecks.


Source: WSA Elbe-Nordsee 324-325/23

Chart DE 50 (INT 1045) [ previous update 4688/23 ] WGS84 DATUM


Insert
37,ÃWk 54° 27´·8N., 5° 40´·4E.

39,ÃWk 54° 24´·4N., 5° 37´·1E.

2.15
Wk51/23
II

4828 BELGIUM - Light.


Source: Belgian Notice 7/109/23

Chart 1406 [ previous update 4682/23 ] WGS84 DATUM


Amend range of light to, 22M 51° 14´·19N., 2° 55´·79E.

Chart 1872 [ previous update 4682/23 ] WGS84 DATUM


Amend range of light to, 22M 51° 14´·18N., 2° 55´·83E.

Chart 1873 (INT 1480) (Panel A, Oostende) [ previous update 4613/23 ] WGS84 DATUM
Amend range of light to, 22M 51° 14´·179N., 2° 55´·829E.

Chart 1873 (INT 1480) [ previous update 4613/23 ] WGS84 DATUM


Amend range of light to, 22M 51° 14´·18N., 2° 55´·83E.

Chart 1874 (INT 1474) [ previous update 4682/23 ] WGS84 DATUM


Amend range of light to, 22M 51° 14´·18N., 2° 55´·83E.

Chart 2182A (INT 1043) [ previous update 4683/23 ] WGS84 DATUM


Amend range of light to, 22M 51° 14´·2N., 2° 56´·2E.

Chart 2449 [ previous update 4682/23 ] WGS84 DATUM


Amend range of light to, 22M 51° 14´·18N., 2° 55´·83E.

Chart 5605_12 (Panel E, Oostende) [ previous update 3541/23 ] WGS84 DATUM


Amend range of light to, 22M 51° 14´·179N., 2° 55´·829E.

Chart 5605_11 [ previous update 4434/23 ] WGS84 DATUM


Amend range of light to, 22M 51° 14´·18N., 2° 55´·83E.

Chart 5606_1 [ previous update 4309/23 ] WGS84 DATUM


Amend range of light to, 22M 51° 14´·19N., 2° 55´·79E.

Chart 5607_1 [ previous update 4309/23 ] WGS84 DATUM


Amend range of light to, 22M 51° 14´·19N., 2° 55´·79E.

4836* GERMANY - North Sea Coast - Lights.


Source: LKN 71(T)/23
Note: Light name, Nobiskrug, and leading line remain unchanged.

Chart DE 42 (INT 1366) (Panel D, Rendsburg) [ previous update 3435/23 ] WGS84 DATUM
Replace
¶ Iso.4s8m2M with ¶ (exting) 54° 18´·74N., 9° 41´·74E.

¶ Iso.4s6m2M with ¶ (exting) 54° 18´·72N., 9° 41´·67E.

2.16
Wk51/23
II

4837 BELGIUM - Lights.


Source: ENC BE5ANTWZ

Chart 128 (INT 1478) (Panel C, Hoboken to Wintam) [ previous update 4700/23 ] WGS84 DATUM
Delete
·(F.Y Fog) 51° 08´·529N., 4° 19´·583E.
51° 08´·543N., 4° 19´·589E.
51° 08´·583N., 4° 19´·803E.
51° 08´·600N., 4° 19´·808E.
51° 10´·520N., 4° 19´·820E.
51° 10´·534N., 4° 19´·821E.
51° 10´·548N., 4° 19´·533E.
51° 10´·564N., 4° 19´·533E.

4857* GERMANY - North Sea Coast - Wrecks.


Source: WSA Elbe-Nordsee 324-325/23

Chart 2182A (INT 1043) [ previous update 4828/23 ] WGS84 DATUM


Insert
37,ÃWk 54° 27´·8N., 5° 40´·4E.

39,ÃWk 54° 24´·4N., 5° 37´·1E.

Chart 2182B (INT 1042) [ previous update 4683/23 ] WGS84 DATUM


Insert
37,ÃWk 54° 27´·8N., 5° 40´·4E.

39,ÃWk 54° 24´·4N., 5° 37´·1E.

Chart 5614_25 [ previous update 4409/23 ] WGS84 DATUM


Insert
37,ÃWk 54° 27´·8N., 5° 40´·4E.

39,ÃWk 54° 24´·4N., 5° 37´·1E.

4868 NETHERLANDS - Buoy.


Source: Netherlands Notice 47/357/23

Chart 207 (INT 1465) (Part A, Nieuwe Waterweg and Europoort) [ previous update 4439/23 ] WGS84 DATUM
Move
BdLFl.R.5s AR 2, from: 51° 58´·31N., 4° 00´·09E.
to: 51° 58´·23N., 4° 00´·09E.

2.17
Wk51/23
II

4927 NETHERLANDS - Wrecks. Obstructions. Wells.


Source: Netherlands Notice 47/358/23

Chart 122 (INT 1472) [ previous update 4574/23 ] WGS84 DATUM


Insert
21%,Wk
à 52° 09´·65N., 3° 52´·01E.

21,ÃObstn 52° 10´·23N., 3° 51´·71E.

20Ó,Obstn
à 52° 11´·09N., 3° 51´·55E.

Chart 1406 [ previous update 4828/23 ] WGS84 DATUM


Insert
20Ó,Wk 52° 09´·65N., 3° 52´·01E.

21,Obstn 52° 10´·23N., 3° 51´·71E.

20Ó,Obstn
à 52° 11´·09N., 3° 51´·55E.

Chart 1408 [ previous update 4574/23 ] WGS84 DATUM


Insert
20Ó,Wk 52° 09´·7N., 3° 52´·0E.

21,Obstn 52° 10´·2N., 3° 51´·7E.

20Ó,Obstn 52° 11´·1N., 3° 51´·6E.


Replace
19Ó,Well with 24%,Well 52° 15´·8N., 3° 51´·2E.

Chart 1630 (INT 1416) [ previous update 4682/23 ] WGS84 DATUM


Insert
21%,WÃ k 52° 09´·65N., 3° 52´·01E.

21,ÃObstn 52° 10´·23N., 3° 51´·71E.

20Ó,OÃ bstn 52° 11´·09N., 3° 51´·55E.


Replace
19Ó,Well with 24%,Well 52° 15´·78N., 3° 51´·17E.

4933 BELGIUM - Light.


Source: Belgian Notice 14/170/23
Note: Former Notice 2869(P)/23 is cancelled.

Chart 128 (INT 1478) (Panel A, Baalhoek to Antwerp) [ previous update 4837/23 ] WGS84 DATUM
Insert
·F.W 51° 17´·96N., 4° 16´·58E.

4939 NETHERLANDS - Buoy.


Source: Netherlands Notice 48/365/23

Chart 114 (INT 1476) (Panel A, Terneuzen to Sluiskil) [ previous update 4653/23 ] WGS84 DATUM
Delete
GrVQ(3)5s
W NST-O
51° 19´·321N., 3° 49´·527E.

2.18
Wk51/23
II

4825 FRANCE - West Coast - Anchorage areas. Legend. Reported anchorage.


Source: French Notices 20/37-38/23

Chart 3427 (INT 1832) (Panel, Port de Camaret-sur-Mer) [ previous update New Edition 23/02/2023 ] WGS84 DATUM
Insert limit of anchorage area, pecked line, joining: (a) 48° 16´·602N., 4° 35´·251W.
(b) 48° 16´·651N., 4° 35´·131W.
(c) 48° 16´·692N., 4° 35´·169W.
(d) 48° 16´·643N., 4° 35´·289W.
legend, (15.05 - 15.10), within: (a)-(d) above
Delete
½ 48° 16´·582N., 4° 35´·245W.

Chart 3427 (INT 1832) [ previous update New Edition 23/02/2023 ] WGS84 DATUM
Insert
½ (a) 48° 16´·66N., 4° 35´·20W.
Delete
½, close SW of: (a) above
Replace reported black ½ with magenta ½
48° 17´·63N., 4° 27´·43W.

4838 FRANCE - North Coast - Buoyage. Submarine power cable. Platform. Restricted area.
Mooring buoy.
Source: French Notices 50/35/21, 32/41/22 and 24/46/23
Note: This update is included in New Edition 2136, published late 2023.

Chart 2146 (INT 1750) [ previous update 4657/23 ] WGS84 DATUM


Delete
DfVQ.Y MO1 49° 27´·56N., 0° 09´·27W.

DfVQ.Y MO2 49° 27´·49N., 0° 11´·80W.

DfVQ.Y MO3 49° 27´·36N., 0° 15´·95W.

DfVQ.Y MO4 49° 26´·32N., 0° 06´·45W.

DfVQ.Y MO5 49° 22´·01N., 0° 06´·17W.

Chart 2613 (INT 1705) [ previous update 4642/23 ] WGS84 DATUM


Insert submarine power cable, ÉÊÉ, joining: 49° 20´·12N., 0° 25´·59W.
49° 20´·94N., 0° 25´·37W.
49° 21´·96N., 0° 25´·63W.
49° 25´·71N., 0° 28´·87W.
49° 27´·15N., 0° 29´·85W.

¼ 49° 27´·28N., 0° 29´·82W.


symbol, entry prohibited, centred on: 49° 27´·28N., 0° 30´·16W.

RFl(3)12s 49° 26´·70N., 0° 28´·71W.

2.19
Wk51/23
II
4838 FRANCE - North Coast - Buoyage. Submarine power cable. Platform. Restricted area.
Mooring buoy. (continued)

Chart 2656 [ previous update 4642/23 ] ETRS89 DATUM


Insert submarine power cable, ÉÊÉ, joining: 49° 20´·2N., 0° 25´·6W.
49° 20´·9N., 0° 25´·4W.
49° 22´·0N., 0° 25´·6W.
49° 25´·7N., 0° 28´·9W.
49° 27´·2N., 0° 29´·9W.

¼ 49° 27´·3N., 0° 29´·8W.

BfFl(5)Y.20s
; 49° 27´·7N., 0° 29´·2W.
49° 29´·2N., 0° 35´·7W.

Chart 2675 (INT 1070) [ previous update 4642/23 ] ETRS89 DATUM


Insert submarine power cable, ÉÊÉ, joining: 49° 20´·1N., 0° 25´·6W.
49° 20´·9N., 0° 25´·4W.
49° 22´·0N., 0° 25´·6W.
49° 25´·7N., 0° 28´·9W.
49° 27´·2N., 0° 29´·9W.

¼ 49° 27´·3N., 0° 29´·8W.

4842 PORTUGAL - South Coast - Depth.


Source: Portuguese Notice 6/178/23

Chart 83 (Panel, Portimão) [ previous update 4522/22 ] WGS84 DATUM


Replace sounding out of position, (84), with sounding out of position,
(78) 37° 08´·00N., 8° 31´·71W.

4869 SPAIN - North Coast - Note. Automatic Identification System.


Source: Spanish Notice 27/260/23

Chart 1153 [ previous update 2819/23 ] WGS84 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 43° 30´·70N., 5° 50´·85W.

Chart 1154 (INT 1853) [ previous update 2819/23 ] WGS84 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 43° 32´·411N., 5° 42´·592W.

Chart 1290 (INT 1807) [ previous update 3641/23 ] WGS84 DATUM


Insert Automatic Identification System, AIS, at light-buoy 43° 37´·18N., 5° 39´·55W.

Chart 1291 (INT 1806) [ previous update 2819/23 ] WGS84 DATUM


Insert Automatic Identification System, AIS, at light-buoy 43° 37´·18N., 5° 39´·55W.

2.20
Wk51/23
II

4870 SPAIN - South West Coast - Buoyage. Anchorage area. Legend.


Source: Spanish Notice 30/286/23

Chart 2976 [ previous update 4661/23 ] WGS84 DATUM


Insert
B;Fl(5)Y.20s
f (May-Oct)
(a) 36° 47´·360N., 6° 21´·560W.
(b) 36° 47´·470N., 6° 21´·270W.
(c) 36° 47´·410N., 6° 21´·230W.
(d) 36° 47´·300N., 6° 21´·530W.
limit of anchorage area, pecked line, joining: (a)-(d) above
legend, ½ (May-Oct), within: (a)-(d) above

4890 FRANCE - North Coast - Obstruction.


Source: French Notice 40/41/23

Chart 3659 [ previous update 4444/23 ] WGS84 DATUM


Insert
5#+ú Obstn 48° 41´·72N., 1° 50´·50W.

4908 FRANCE - West Coast - Depths.


Source: French Notice 41/60/23

Chart 1175 (INT 1848) [ previous update 2148/23 ] WGS84 DATUM


Insert depth, 05, and extend 2m approximate contour NW to enclose,
with seabed type, R 43° 29´·698N., 1° 33´·083W.
depth, 07, enclosed by 2m contour, with seabed type, R (a) 43° 29´·010N., 1° 34´·538W.
Delete depth, 87, close NE of: (a) above

4929 SPAIN - South West Coast - Buoy.


Source: Spanish Notice 28/269/23

Chart 73 (INT 1901) [ previous update 4566/23 ] WGS84 DATUM


Move
IbFl.G.5s
]b No 15, from:
37° 09´·12N., 6° 53´·10W.
to: 37° 09´·29N., 6° 53´·39W.

2.21
Wk51/23
II

4932 FRANCE - West Coast - Fog signals.


Source: French Notice 35/65/23

Chart 20 [ previous update 4606/23 ] WGS84 DATUM


Delete fog signal, Whis, at light-buoy 46° 13´·0N., 2° 32´·1W.
fog signal, Bell, at light-buoy 46° 09´·3N., 2° 21´·1W.

Chart 1104 [ previous update 4662/23 ] WGS84 DATUM


Delete fog signal, Whis, at light-buoy 46° 13´·0N., 2° 31´·5W.
fog signal, Bell, at light-buoy 46° 09´·2N., 2° 21´·4W.

Chart 2663 (INT 1803) [ previous update New Edition 14/09/2023 ] WGS84 DATUM
Delete fog signal, Whis, at light-buoy 46° 12´·84N., 2° 31´·98W.
fog signal, Bell, at light-buoy 46° 09´·14N., 2° 21´·27W.

4946 FRANCE - West Coast - Buoyage.


Source: French Notice 46/48/23

Chart 2985 (INT 1842) [ previous update 4768/23 ] WGS84 DATUM


Delete
D;Fl(5)Y.20s
f EDF Angle
47° 16´·23N., 1° 52´·67W.

D;Ff l(5)Y.20s EDF Binet 47° 15´·30N., 1° 51´·11W.

4947 SPAIN - South West Coast - Depths.


Source: ENC ES504437

Chart 86 [ previous update 3386/23 ] WGS84 DATUM


Insert depth, 63 (a) 36° 30´·24N., 6° 12´·36W.
Delete depth, 68, close NE of: (a) above
Replace depth, 38, with depth, 17 36° 29´·97N., 6° 11´·49W.
depth, 25, with depth, 15 36° 29´·80N., 6° 11´·14W.

4854 NORTH ATLANTIC OCEAN - Depths.


Source: RRS Discovery

Chart 4102 (INT 102) [ previous update 4692/22 ] WGS84 DATUM


Insert depth, 447 Rep (2016) 60° 15´·0N., 29° 06´·3W.

Chart 4112 (INT 112) [ previous update 3228/23 ] WGS84 DATUM


Insert depth, 563 Rep (2016) (a) 60° 48´·9N., 28° 16´·4W.
Delete depth, 640, close SW of: (a) above
Insert depth, 447 Rep (2016) (b) 60° 15´·0N., 29° 06´·3W.
Delete depth, 577, close N of: (b) above

2.22
Wk51/23
II

4878 NORTH ATLANTIC OCEAN - Islas Canarias - Wreck.


Source: French Notice 31/154/23

Chart 1862 (INT 1939) [ previous update 1756/23 ] WGS84 DATUM


Insert
29,Wk 27° 15´·0N., 13° 27´·8W.

Chart 3133 [ previous update 3482/23 ] WGS84 DATUM


Insert
29,Wk 27° 15´·0N., 13° 27´·8W.

Chart 3134 [ previous update 4254/23 ] WGS84 DATUM


Insert
29,Wk 27° 15´·0N., 13° 27´·8W.

4942 NORTH ATLANTIC OCEAN - Islas Canarias - NM Block.


Source: Spanish Notice 18/152/23

Chart 1863 [ previous update 4454/22 ] WGS84 DATUM


Insert the accompanying block, centred on: 28° 51´·4N., 13° 52´·4W.

4809 ITALY - West Coast - NM Block.


Source: Italian Notice 5.11/23

Chart 916 (Panel H, Torre Annunziata) [ previous update 4138/23 ] WGS84 DATUM
Insert the accompanying block, centred on: 40° 44´·9N., 14° 27´·0E.

4817 SPAIN - Mediterranean Sea Coast - Buoy.


Source: Spanish Notice 23/212/23

Chart 1180 (INT 3185) [ previous update New Edition 22/06/2023 ] WGS84 DATUM
Delete
G;Ff l.Y.4s3M(sync) 41° 23´·265N., 2° 12´·386E.

Chart 1196 (INT 3184) [ previous update 3922/23 ] WGS84 DATUM


Move
G;Ff l.Y.4s3M(sync), from: 41° 23´·26N., 2° 12´·39E.
to: 41° 23´·35N., 2° 12´·52E.

2.23
Wk51/23
II

4820 ALGERIA - Buoyage. Single Buoy Mooring.


Source: Algerian Chart 1209

Chart 252 [ previous update 4087/23 ] WGS84 DATUM


Replace symbol, single buoy mooring, with symbol, single buoy
mooring, Q.W 36° 44´·8N., 5° 09´·5E.

Chart 1710 (Panel, Port de Bejaïa) [ previous update 3490/22 ] UNDETERMINED DATUM
Insert
GUQ(12)15s
m (a) 36° 43´·931N., 5° 06´·737E.
Delete
BQ(12)15s, close E of: (a) above

Chart 1910 [ previous update 2345/22 ] WGS84 DATUM


Insert
GUQ(12)15s
m 36° 43´·9N., 5° 06´·7E.

4823 UKRAINE - Depths.


Source: Ukrainian Chart 3103_23

Chart 2232 [ previous update 4694/23 ] WGS84 DATUM


Insert depth, 194, enclosed by 20m contour 45° 54´·4N., 30° 54´·0E.
depth, 20, enclosed by 20m contour 45° 48´·8N., 30° 59´·5E.

4829 EGYPT - North Coast - NM Block.


Source: ENC EG5EGM15

Chart 2573 (INT 3500) (Panel, Al ’Arīsh Harbour) [ previous update 4495/23 ] WGS84 DATUM
Insert the accompanying block, centred on: 31° 09´·5N., 33° 50´·1E.

4846 CROATIA - Depths. Rock.


Source: Croatian Notice 6/4/23

Chart 202 [ previous update 3955/23 ] WGS84 DATUM


Insert depth, 156 (a) 44° 31´·36N., 14° 14´·73E.
Delete depth, 17, with seabed type, R (a) above
Insert depth, 136, and extend 20m contour S to enclose (b) 44° 30´·52N., 14° 20´·28E.
Delete depth, 49, close SE of: (b) above

2.24
Wk51/23
II
4846 CROATIA - Depths. Rock. (continued)

Chart 204 [ previous update 694/23 ] WGS84 DATUM


Insert depth, 156 (a) 44° 31´·4N., 14° 14´·7E.
Delete depth, 17, with seabed type, R (a) above

Chart 220 [ previous update 4256/23 ] WGS84 DATUM


Insert depth, 156 (a) 44° 31´·4N., 14° 14´·7E.
Delete depth, 17, with seabed type, R (a) above

Chart 515 [ previous update 4082/23 ] WGS84 DATUM


Insert depth, 156 (a) 44° 31´·36N., 14° 14´·73E.
Delete depth, 17, with seabed type, R (a) above
Insert depth, 136, and extend 20m contour S to enclose (b) 44° 30´·52N., 14° 20´·28E.
Delete depth, 49, close SE of: (b) above

4850 ITALY - South Coast - Danger line. Legend.


Source: Italian Notice 19.14/23

Chart 1417 [ previous update 3479/23 ] WGS84 DATUM


Insert danger line, dotted line, joining: (a) 40° 28´·99N., 17° 08´·68E.
(b) 40° 29´·01N., 17° 08´·79E.
(c) 40° 28´·89N., 17° 08´·80E.
(d) 40° 28´·96N., 17° 08´·68E.
legend, Wks, close E of: (a)-(d) above

4851 SPAIN - Islas Baleares - Marine Reserves. Legends.


Source: Spanish Notice 21/190/23

Chart 1700 [ previous update 2502/22 ] WGS84 DATUM


Insert limit of marine reserve, ÇMR Ç, joining: 38° 53´·0N., 1° 12´·9E.
38° 51´·8N., 1° 13´·7E.
38° 51´·5N., 1° 11´·3E.
38° 51´·7N., 1° 11´·1E.
38° 52´·1N., 1° 11´·0E.

Chart 1701 [ previous update 4207/23 ] WGS84 DATUM


Insert limit of marine reserve, ÇMR Ç, joining: 38° 57´·2N., 1° 10´·7E.
38° 57´·5N., 1° 09´·7E.
38° 58´·6N., 1° 09´·4E.
38° 59´·2N., 1° 10´·6E.
and
38° 53´·0N., 1° 12´·9E.
38° 51´·8N., 1° 13´·7E.
38° 51´·5N., 1° 11´·3E.
38° 51´·7N., 1° 11´·1E.
38° 52´·1N., 1° 11´·0E.

2.25
Wk51/23
II
4851 SPAIN - Islas Baleares - Marine Reserves. Legends. (continued)

Chart 1702 [ previous update 5364/21 ] WGS84 DATUM


Insert limit of marine reserve, ÇMR Ç, joining: 38° 57´·2N., 1° 10´·7E.
38° 57´·5N., 1° 09´·7E.
38° 58´·6N., 1° 09´·4E.
38° 59´·2N., 1° 10´·6E.
and
38° 53´·0N., 1° 12´·9E.
38° 51´·8N., 1° 13´·7E.
38° 51´·5N., 1° 11´·3E.
38° 51´·7N., 1° 11´·1E.
38° 52´·1N., 1° 11´·0E.

Chart 2834 [ previous update 4092/23 ] WGS84 DATUM


Insert limit of marine reserve, ÇMR Ç, joining: (a) 38° 57´·21N., 1° 10´·66E.
(b) 38° 57´·46N., 1° 09´·72E.
(c) 38° 58´·63N., 1° 09´·43E.
(d) 38° 59´·19N., 1° 10´·61E.
legend, Marine Reserve (see Note), close W of: (a)-(d) above
limit of marine reserve, ÇMR Ç, joining: (e) 38° 52´·95N., 1° 12´·95E.
(f) 38° 51´·75N., 1° 13´·71E.
(g) 38° 51´·49N., 1° 11´·30E.
(h) 38° 51´·68N., 1° 11´·14E.
(i) 38° 52´·12N., 1° 11´·02E.
legend, Marine Reserve (see Note), close SE of: (e)-(i) above

4852* CYPRUS - Depths.


Source: Cyprus Department of Lands and Surveys, and Cyprus Agriculture

Chart 775 [ previous update 2265/22 ] WGS84 DATUM


Insert depth, 12, and extend 20m contour SW to enclose 35° 10´·61N., 32° 32´·08E.
Replace depth, 116, with depth, 71, enclosed by 10m contour 34° 42´·23N., 32° 28´·41E.
depth, 146, with depth, 116 34° 37´·77N., 32° 46´·22E.

Chart 848 (Panel B, Approaches to Larnaca) [ previous update 842/22 ] WGS84 DATUM
Replace depth, 181, with depth, 163 34° 55´·94N., 33° 42´·73E.

Chart 849 (Panel E, Paphos) [ previous update 3213/22 ] WGS84 DATUM


Insert depth, 2, and extend 2m contour SE to enclose 34° 45´·18N., 32° 24´·60E.

Chart 849 (Panel G, Approaches to Akrotiri Harbour and Limassol) [ previous update 3213/22 ] WGS84 DATUM
Insert depth, 48, and extend 5m contour SE to enclose (a) 34° 41´·21N., 33° 04´·68E.
Delete depth, 67, close N of: (a) above

2.26
Wk51/23
II
4852* CYPRUS - Depths. (continued)

Chart 850 [ previous update 3213/22 ] WGS84 DATUM


Insert depth, 48 (a) 34° 41´·21N., 33° 04´·68E.
Delete depth, 67, close NE of: (a) above
Replace depth, 146, with depth, 116 34° 37´·77N., 32° 46´·22E.
depth, 181, with depth, 163 34° 55´·94N., 33° 42´·73E.

Chart 851 [ previous update 4079/22 ] WGS84 DATUM


Insert depth, 157, and extend 20m contour NE to enclose (a) 34° 58´·04N., 34° 05´·17E.
Delete depth, 35, close NE of: (a) above
Replace depth, 181, with depth, 163 34° 55´·94N., 33° 42´·73E.

Chart 2074 [ previous update 2265/22 ] WGS84 DATUM


Replace depth, 146, with depth, 116 34° 37´·8N., 32° 46´·2E.

4856 SPAIN - Mediterranean Sea Coast - Buoy.


Source: Spanish Notice 21/187/23

Chart 1704 [ previous update 4207/23 ] WGS84 DATUM


Insert
BfF; l(5)Y.20s ODAS 42° 09´·0N., 3° 26´·8E.

Chart 1705 [ previous update 4291/23 ] WGS84 DATUM


Insert
BfF; l(5)Y.20s ODAS 42° 09´·0N., 3° 26´·8E.

4861 TURKEY - Black Sea Coast - Depths.


Source: ENC TR300181

Chart 2230 [ previous update 3493/23 ] WGS84 DATUM


Insert depth, 75 41° 33´·2N., 28° 44´·1E.
depth, 81 (a) 41° 33´·0N., 28° 56´·7E.
Delete depth, 93, close W of: (a) above
Insert depth, 98, and extend 100m contour N to enclose (b) 41° 32´·9N., 29° 02´·3E.
Delete depth, 105, close W of: (b) above
Insert depth, 76 41° 30´·0N., 29° 02´·1E.
depth, 59 41° 27´·7N., 28° 34´·2E.

4874 FRANCE - Corse - Depths.


Source: French Chart 7436

Chart 1424 (Panel, Propriano) [ previous update 4573/23 ] WGS84 DATUM


Replace depth, 54, with depth, 48, enclosed by 5m contour 41° 40´·366N., 8° 52´·888E.

2.27
Wk51/23
II

4876 GREECE - Aegean Sea Coast - Depths. Wrecks.


Source: Greek Notice 6/110/23

Chart 1513 [ previous update 3468/22 ] WGS84 DATUM


Insert
15$, Wk (a) 37° 57´·00N., 23° 36´·20E.
Delete depth, 33, close NE of: (a) above

´PA, close SW of: (a) above


Insert depth, 29, and extend 30m contour N to enclose 37° 57´·02N., 23° 36´·29E.

Chart 1596 [ previous update 2103/22 ] WGS84 DATUM


Insert
15$,Wk 37° 56´·998N., 23° 36´·203E.
depth, 29, and extend 30m contour N to enclose 37° 57´·021N., 23° 36´·290E.
Delete
´ PA 37° 56´·957N., 23° 36´·151E.

4882 MOROCCO - North Coast - Virtual aid to navigation.


Source: French Notice 36/147/23

Chart 141 (INT 1972) [ previous update 4252/22 ] WGS84 DATUM


Insert symbol, Virtual aid to navigation, port lateral topmark, V-AIS 35° 54´·66N., 5° 29´·14W.

Chart 145 (INT 1971) [ previous update 4238/20 ] WGS84 DATUM


Insert symbol, Virtual aid to navigation, port lateral topmark, V-AIS 35° 54´·660N., 5° 29´·140W.

4885 ITALY - East Coast - Buoy.


Source: Italian Notice 19.17/23

Chart 1443 (Panel C, Barletta) [ previous update 3993/23 ] WGS84 DATUM


Insert
G;Fl(5)Y.20s3M
f 41° 20´·029N., 16° 17´·733E.

2.28
Wk51/23
II

4902 SPAIN - Mediterranean Sea Coast - Submarine cable.


Source: Spanish Notice 25/241/23

Chart 1196 (INT 3184) [ previous update 4817/23 ] WGS84 DATUM


Insert submarine cable, É, joining: 41° 25´·35N., 2° 14´·08E.
41° 25´·29N., 2° 14´·35E.
41° 25´·28N., 2° 14´·54E.
41° 25´·23N., 2° 14´·94E.
41° 24´·83N., 2° 17´·10E.

Chart 1704 [ previous update 4856/23 ] WGS84 DATUM


Insert submarine cable, É, joining: 41° 25´·4N., 2° 14´·1E.
41° 24´·2N., 2° 21´·2E.
41° 24´·1N., 2° 22´·6E.
41° 24´·8N., 2° 29´·7E.
41° 25´·0N., 2° 33´·4E.
41° 24´·9N., 2° 37´·8E.
41° 24´·4N., 2° 42´·1E.

4904 GREECE - Aegean Sea Coast - Light.


Source: ENC GR4APP06

Chart 1541 (Panel E, Nísos Thíra) [ previous update 4670/22 ] WGS84 DATUM
Amend range of light to, 10M 36° 27´·90N., 25° 22´·12E.

4930 GREECE - Aegean Sea Coast - NM Block. Depths.


Source: ENC GR642G01

Chart 2070 (Panel B, Liménas Thessaloníkis) [ previous update 1053/23 ] WGS84 DATUM
Insert the accompanying block, centred on: 40° 38´·1N., 22° 54´·6E.

Chart 2070 (Panel A, Órmos Thessaloníkis) [ previous update 1053/23 ] WGS84 DATUM
Insert depth, 123 (a) 40° 38´·14N., 22° 54´·32E.
Delete depth, 106, close N of: (a) above

4931 ITALY - West Coast - Wrecks.


Source: Italian Notice 16.2/23

Chart 131 (Panel B, Canale di Piombino) [ previous update 4480/23 ] WGS84 DATUM
Insert
67,Wk 42° 51´·50N., 10° 21´·70E.

82,Wk 42° 50´·80N., 10° 19´·60E.

2.29
Wk51/23
II

4941 CROATIA - Vertical clearance.


Source: Croatian Notice 7/11/23

Chart 1580 [ previous update 4276/23 ] WGS84 DATUM


Amend vertical clearance to, 46m 42° 44´·2N., 17° 50´·0E.

4802 EQUATORIAL GUINEA - Mooring buoy. Moored storage tanker. Platform.


Single Buoy Mooring.
Source: Exxonmobil

Chart 1321 (Panel D, Bahia de Luba) [ previous update 4129/21 ] UNDETERMINED DATUM
Insert
R(Reported 2023) 3° 29´·4N., 8° 33´·0E.

Chart 1387 (INT 2810) [ previous update 2590/23 ] WGS84 DATUM


Delete symbol, single buoy mooring 3° 52´·2N., 8° 08´·3E.

é{ 3° 51´·2N., 8° 06´·6E.

Chart 3118 (INT 2088) [ previous update 1453/23 ] WGS84 DATUM


Replace
é{ with ¼{ 3° 50´·9N., 8° 06´·8E.

4873 SENEGAL - Submarine cables.


Source: French Notice 29/168/23

Chart 1000 (INT 1993) [ previous update 2593/23 ] WGS84 DATUM


Insert submarine cable, É, joining: 14° 39´·25N., 17° 26´·18W.
14° 38´·59N., 17° 26´·77W.
14° 38´·02N., 17° 28´·02W.
14° 37´·91N., 17° 28´·85W.
14° 38´·13N., 17° 30´·77W.
14° 37´·86N., 17° 33´·61W.
14° 38´·51N., 17° 34´·28W.
14° 38´·92N., 17° 34´·68W.
14° 38´·79N., 17° 38´·85W.

Chart 1001 (INT 1994) [ previous update 3648/22 ] WGS84 DATUM


Insert submarine cable, É, joining: 14° 39´·26N., 17° 26´·17W.
14° 38´·69N., 17° 26´·68W.

2.30
Wk51/23
II

4935 IRAN - Depths.


Source: ENC IR586102

Chart 3599 [ previous update New Edition 25/05/2023 ] WGS84 DATUM


Insert depth, 61 (a) 27° 08´·37N., 56° 17´·45E.
Delete depth, 67, close E of: (a) above

4824 INDIA - West Coast - Maritime limit. Legend.


Source: Indian Notice 16/147/23

Chart IN 203 (INT 7319) [ previous update New Chart 31/10/2021 ] WGS84 DATUM
Insert circular maritime limit, radius 0·6M, pecked line, centred on: (a) 22° 40´·55N., 69° 35´·30E.
legend, VLCC STS Ops Area, within: (a) above

Chart IN 2068 [ previous update New Edition 01/06/2023 ] WGS84 DATUM


Insert circular maritime limit, radius 0·6M, pecked line, centred on: (a) 22° 40´·55N., 69° 35´·30E.
legend, VLCC STS Ops Area, within: (a) above

Chart IN 2079 (INT 7329) [ previous update New Edition 01/06/2023 ] WGS84 DATUM
Insert circular maritime limit, radius 0·6M, pecked line, centred on: (a) 22° 40´·55N., 69° 35´·30E.
legend, VLCC STS Ops Area, within: (a) above

Chart IN 2107 [ previous update 473/20 ] WGS84 DATUM


Insert semi-circular maritime limit, radius 0·6M, pecked line,
centred on 22°40’·55N., 69°35’·30E, joining: 22° 40´·00N., 69° 35´·04E.
22° 40´·00N., 69° 35´·56E.
legend, VLCC STS Ops Area, centred on: 22° 40´·55N., 69° 35´·30E.

4862 PAKISTAN - Depths. Anchorage area. Legends. Anchor berth.


Source: Pakistan Chart 28

Chart 38 (INT 7019) [ previous update 3765/23 ] WGS84 DATUM


Insert depth, 205 (a) 24° 31´·4N., 66° 57´·0E.
Delete depth, 24, close N of: (a) above
Insert
î 24° 28´·0N., 66° 57´·7E.

2.31
Wk51/23
II
4862 PAKISTAN - Depths. Anchorage area. Legends. Anchor berth. (continued)

Chart 39 [ previous update 3310/23 ] WGS84 DATUM


Insert depth, 205 (a) 24° 31´·3N., 66° 57´·0E.
Delete depth, 24, close NW of: (a) above
Insert limit of anchorage area, pecked line, joining: (a) 24° 30´·0N., 66° 58´·0E.
(b) 24° 28´·0N., 66° 58´·0E.
(c) 24° 28´·0N., 66° 56´·0E.
(d) 24° 30´·0N., 66° 56´·0E.
legend, ½Oil Tanker, within: (a)-(d) above
limit of anchorage area, pecked line, joining: (e) 24° 28´·0N., 66° 58´·0E.
(f) 24° 26´·0N., 66° 58´·0E.
(g) 24° 26´·0N., 66° 56´·0E.
(h) 24° 28´·0N., 66° 56´·0E.
legend, ½Gas Tanker, within: (e)-(h) above

Chart 58 (INT 7314) [ previous update 3310/23 ] WGS84 DATUM


Insert depth, 205 (a) 24° 31´·35N., 66° 57´·01E.
Delete depth, 24, close NW of: (a) above

4899 BANGLADESH - Buoyage.


Source: BNHOC Notice 9/23

Chart 90 [ previous update 4072/23 ] WGS84 DATUM


Amend No-4A light-buoy to, LFl.R.6s 21° 39´·7N., 91° 50´·1E.
No-2A light-buoy to, LFl.R.6s 21° 37´·4N., 91° 49´·3E.

4913 INDIA - East Coast - NM Blocks.


Source: Indian Notice 8/87/23

Chart IN 3033 [ previous update 2808/22 ] WGS84 DATUM


Insert the accompanying block A, centred on: 10° 49´·7N., 79° 51´·1E.

Chart IN 3033 (Panel, Karaikal Port) [ previous update 2808/22 ] WGS84 DATUM
Insert the accompanying block B, centred on: 10° 49´·6N., 79° 51´·1E.

2.32
Wk51/23
II

4916 INDIAN OCEAN - Andaman Islands - Wreck.


Source: Indian Notice 19/159/23

Chart IN 33 (INT 755) [ previous update 4832/22 ] WGS84 DATUM


Delete
´ PA 11° 32´·6N., 92° 09´·9E.

Chart IN 473 (INT 7031) [ previous update 2788/22 ] WGS84 DATUM


Delete
´ PA 11° 32´·4N., 92° 10´·1E.

Chart 1398 [ previous update 4739/23 ] UNDETERMINED DATUM


Delete
´PA 11° 32´·50N., 92° 10´·00E.

4818 MALAYSIA - Peninsular Malaysia, West Coast - Buoyage.


Source: Marine Department, Malaysia Notice 126/23

Chart 792 [ previous update 4370/23 ] WGS84 DATUM


Amend Vale No 2 light-buoy to, Fl(2+1)R.15s 4° 09´·12N., 100° 33´·67E.
Vale No 4 light-buoy to, Fl(2+1)R.15s 4° 09´·20N., 100° 34´·43E.
Vale No 6 light-buoy to, Fl(2+1)R.15s 4° 09´·29N., 100° 35´·09E.
Vale No 5 light-buoy to, Fl(2+1)G.15s 4° 09´·01N., 100° 35´·10E.
Vale No 3 light-buoy to, Fl(2+1)G.15s 4° 08´·95N., 100° 34´·45E.
Vale No 1 light-buoy to, Fl(2+1)G.15s 4° 08´·87N., 100° 33´·84E.

4819 CHINA - South Coast - Buoyage. Depths.


Source: Hong Kong Notices 21/37-38/23

Chart 4123 [ previous update 2337/23 ] WGS84 DATUM


Delete
GfFl.Y.6s Weather 4 22° 19´·625N., 113° 56´·925E.

Chart 4129 [ previous update New Edition 09/11/2023 ] WGS84 DATUM


Insert
GfFl.Y.4s Weather 13 22° 19´·01N., 113° 52´·06E.
depth, 56 (a) 22° 17´·24N., 113° 51´·93E.
Delete depth, 61, close SW of: (a) above

4822 TAIWAN - Automatic Identification System.


Source: Taiwanese Notice 182/23

Chart 3235 [ previous update 502/23 ] WGS84 DATUM


Insert Automatic Identification System, AIS, at light-buoy 24° 56´·95N., 121° 55´·50E.

2.33
Wk51/23
II

4827 CHINA - South Coast - NM Block. Note. Buoyage. Automatic Identification Systems.
Source: Chinese Notice 33/1202/23 and UKHO

Chart 1782 [ previous update 3025/23 ] CGCS 2000 DATUM


Insert the accompanying block, centred on: 23° 09´·4N., 116° 38´·1E.
the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 23° 11´·29N., 116° 32´·59E.

BdFl(3)R.10s No 6 23° 08´·23N., 116° 37´·80E.

CbFl(3)G.10s No 5 23° 08´·21N., 116° 37´·94E.

BdFl(2)R.6s No 4 23° 06´·98N., 116° 37´·56E.

CbFl(2)G.6s No 3 23° 06´·96N., 116° 37´·71E.

BdFl.R.4s No 2 23° 05´·83N., 116° 37´·35E.

CbFl.G.4s No 1 23° 05´·81N., 116° 37´·49E.


Delete Automatic Identification System, AIS, at light-buoy 23° 01´·52N., 116° 36´·11E.
Automatic Identification System, AIS, at light-buoy No 1 23° 11´·89N., 116° 40´·36E.
Automatic Identification System, AIS, at light-buoy No 2 23° 11´·75N., 116° 40´·26E.

4830* VIETNAM - Depths.


Source: VMS-South Notice 108/23

Chart 1059 (Panel C, Song Thi Vai) [ previous update 4692/23 ] WGS84 DATUM
Insert depth, 109 10° 34´·46N., 107° 01´·42E.
depth, 104 (a) 10° 34´·31N., 107° 01´·32E.
Delete depth, 121, close S of: (a) above
Insert depth, 118 (b) 10° 34´·10N., 107° 01´·18E.
Delete depth, 14, close E of: (b) above

4858 MALAYSIA - Peninsular Malaysia, East Coast - Obstruction.


Source: Malaysian Notice 5/81/23

Chart 2414 [ previous update 3980/23 ] WGS84 DATUM


Insert
åObstn 5° 13´·5N., 105° 13´·6E.

Chart 2422 [ previous update 3980/23 ] WGS84 DATUM


Insert
åObstn 5° 13´·5N., 105° 13´·6E.

2.34
Wk51/23
II

4884 CHINA - Bo Hai - Depths. Groyne.


Source: Chinese charts 11781, 11783 and 11784

Chart 1250 [ previous update 4525/23 ] CGCS 2000 DATUM


Insert depth, 65 (a) 38° 36´·5N., 118° 09´·9E.
Delete depth, 83, close SW of: (a) above
Insert depth, 113 (b) 38° 28´·1N., 118° 17´·3E.
Delete depth, 119, close S of: (b) above
Insert groyne, single dotted line, joining: 38° 27´·1N., 118° 05´·3E.
38° 25´·0N., 118° 00´·6E.
38° 24´·6N., 118° 00´·2E.

Chart 2645 [ previous update 2658/23 ] CGCS 2000 DATUM


Insert depth, 28 38° 42´·38N., 117° 43´·25E.

4889 CHINA - Bo Hai - Offshore installation.


Source: Chinese Notice 40/1449/23

Chart 2653 [ previous update 3788/23 ] CGCS 2000 DATUM


Insert limit of renewable energy device, pecked line, joining: (a) 38° 52´·10N., 117° 50´·82E.
(b) 38° 52´·08N., 117° 51´·00E.
(c) 38° 51´·99N., 117° 50´·98E.
(d) 38° 52´·00N., 117° 50´·80E.
symbol, renewable energy device, close E of: (a)-(d) above

4895 CHINA - South Coast - Buoy.


Source: Chinese Notice 42/1508/23

Chart 1725 [ previous update 4552/23 ] CGCS 2000 DATUM


Move
CbQ.G E1 from:
21° 24´·24N., 109° 33´·83E.
to: 21° 24´·48N., 109° 33´·84E.

2.35
Wk51/23
II

4896 CHINA - East Coast - Buoyage.


Source: Chinese Notice 44/1594/23

Chart 1768 [ previous update 3024/23 ] CGCS 2000 DATUM


Insert
GfMo(O)Y.12s
; Bo 1
(a) 23° 50´·01N., 117° 30´·14E.
Delete
GfMo(O)Y.12s
; No 5, close SE of:
(a) above
Insert
IbFl(2)G.6s
] No 11
(b) 23° 49´·94N., 117° 30´·53E.
Delete
GfMo(O)Y.12s
; No 3, close S of:
(b) above
Insert
IbFl.G.4s ] No 9
(c) 23° 49´·90N., 117° 31´·19E.
Delete
GfMo(O)Y.12s; No 1, close E of:
(c) above
Insert
GdFl(2)R.6s \ No 10
(d) 23° 49´·81N., 117° 31´·12E.
Delete
GfMo(O)Y.15s ; No 2, close N of:
(d) above

GfMo(O)Y.15s ; No 4
23° 49´·87N., 117° 30´·31E.

4898 TAIWAN - Wreck.


Source: UKHO

Chart 3232 [ previous update 3218/23 ] WGS84 DATUM


Delete
® 21° 53´·00N., 120° 50´·95E.

Chart 3233 [ previous update 1216/23 ] WGS84 DATUM


Delete
® 21° 52´·99N., 120° 50´·99E.

Chart 4410 [ previous update 4826/23 ] WGS84 DATUM


Delete
® 21° 53´·0N., 120° 51´·0E.

4901 CHINA - South Coast - Buoyage.


Source: Chinese Notice 42/1505/23

Chart 3938 [ previous update 2745/23 ] CGCS 2000 DATUM


Replace
GfMo(P)Y.12s
; No 21 with BdFl.R.4s No 21
21° 32´·75N., 108° 20´·97E.

2.36
Wk51/23
II

4905 CHINA - South Coast - Depths.


Source: Hong Kong Chart 3002

Chart 341 [ previous update 4741/23 ] WGS84 DATUM


Insert depth, 98, enclosed by 10m contour (a) 22° 11´·99N., 114° 00´·03E.
Delete depth, 12, close SW of: (a) above

4937 VIETNAM - Obstruction. Buoy.


Source: VMS South Notices 188/23 and 189/23

Chart 1036 [ previous update 4255/23 ] WGS84 DATUM


Delete
åObstn 10° 36´·20N., 106° 46´·67E.

IbQ] .G 53A 10° 36´·18N., 106° 46´·69E.

4917 JAPAN - Hokkaidō - Legend.


Source: Japanese Notice 48/503/23.

Chart JP 1030 [ previous update 1326/23 ] WGS84 DATUM


Delete legend, (Parabola), centred on: 42° 09´·77N., 142° 47´·97E.

4918 JAPAN - Honshū - Breakwater. Light.


Source: Japanese Notice 48/507/23

Chart JP 1195 [ previous update 326/23 ] WGS84 DATUM


Insert breakwater, single firm line, joining: (a) 40° 35´·0N., 139° 52´·7E.
(b) 40° 34´·9N., 139° 53´·0E.
Move
· Fl G 5s 7M, from: (a) above
to: (b) above

4919 JAPAN - Honshū - Superbuoy. Automatic Identification System.


Source: Japanese Notice 48/508/23.

Chart JP 53 [ previous update 5114/22 ] WGS84 DATUM


Delete
êfMo(U)
¿ 10s (a) 40° 13´·48N., 142° 00´·78E.
Automatic Identification System, AIS, at superbuoy (a) above

2.37
Wk51/23
II

4920 JAPAN - Seto Naikai - Breakwater.


Source: Japanese Notice 48/509/23

Chart JP 150C [ previous update 2377/23 ] WGS84 DATUM


Insert breakwater, single firm line, joining: 34° 17´·37N., 134° 39´·72E.
34° 17´·27N., 134° 39´·77E.

4807 PHILIPPINE ISLANDS - Luzon - Light.


Source: Philippines Notice 1/14/23

Chart 3489 (INT 553) [ previous update 4689/23 ] WGS84 DATUM


Insert
¶ Fl.5s 20° 46´·2N., 121° 49´·1E.

Chart 4410 [ previous update New Edition 30/11/2023 ] WGS84 DATUM


Insert
¶ Fl.5s 20° 46´·2N., 121° 49´·1E.

4812 INDONESIA - Jawa - Submarine pipelines. Legend.


Source: Indonesian Notice 16/183/23

Chart 932 (Panel B, Approaches to Pelabuhan Tanjung Priok) [ previous update 3873/23 ] WGS84 DATUM
Insert submarine pipeline, È, joining: (a) 5° 59´·28S., 106° 57´·30E.
(b) 5° 58´·78S., 106° 56´·85E.
(c) 5° 58´·49S., 106° 56´·42E.
5° 58´·40S., 106° 56´·09E.
legend, Gas (see Note - PIPELINES), along: (a)-(c) above
Delete former submarine pipeline, È, and associated legend, Gas
(see Note - PIPELINES), joining: (a) above
5° 58´·40S., 106° 56´·73E.

Chart 933 [ previous update 3873/23 ] WGS84 DATUM


Insert submarine pipeline, È, joining: (a) 5° 58´·88S., 106° 57´·03E.
5° 58´·23S., 106° 55´·64E.
Delete former submarine pipeline, È, joining: (a) above
5° 58´·22S., 106° 56´·60E.
5° 58´·23S., 106° 55´·64E.

2.38
Wk51/23
II

4826 PHILIPPINE ISLANDS - Luzon - Lights.


Source: Philippines Notice 1/15/23

Chart 4410 [ previous update 4807/23 ] WGS84 DATUM


Insert
¶ Fl(2)10s 20° 25´·2N., 121° 56´·8E.

¶ Fl(2)G.10s 20° 22´·0N., 121° 54´·8E.

Chart 4427 [ previous update 4684/23 ] WGS84 DATUM


Insert
¶ Fl(2)10s 20° 25´·17N., 121° 56´·76E.

¶ Fl(2)G.10s 20° 21´·98N., 121° 54´·84E.

4848 MALAYSIA - Sarawak - Fish havens. Depths.


Source: Marine Department, Sarawak Notice 104/23

Chart 1336 [ previous update 2689/23 ] WGS84 DATUM


Insert
Á 2° 00´·2N., 109° 47´·8E.
1° 57´·4N., 109° 51´·2E.
1° 55´·3N., 109° 55´·7E.
1° 54´·6N., 109° 59´·8E.
1° 49´·1N., 109° 56´·2E.
(a) 1° 50´·5N., 109° 51´·9E.
Delete depth, 11, close N of: (a) above

Chart 3834 [ previous update 2689/23 ] WGS84 DATUM


Insert
Á 2° 00´·20N., 109° 47´·79E.
1° 57´·37N., 109° 51´·19E.
1° 52´·26N., 109° 48´·37E.
1° 50´·55N., 109° 51´·93E.
1° 49´·15N., 109° 56´·15E.
1° 54´·59N., 109° 59´·76E.
(a) 1° 55´·27N., 109° 55´·68E.
Delete depth, 198, close E of: (a) above

2.39
Wk51/23
II

4877* BRUNEI - Platform.


Source: Maritime and Port Authority of Brunei Darussalam

Chart 1338 [ previous update 4118/23 ] WGS84 DATUM


Insert
¼{ EGWJ-02 5° 01´·7N., 114° 16´·7E.

Chart 2109 [ previous update 4118/23 ] WGS84 DATUM


Insert
¼{ EGWJ-02 5° 01´·68N., 114° 16´·71E.

Chart 3483 (INT 551) [ previous update 4265/23 ] WGS84 DATUM


Insert
¼{ 5° 01´·7N., 114° 16´·7E.

Chart 3838 (INT 5708) [ previous update 4265/23 ] WGS84 DATUM


Insert
¼{ EGWJ-02 5° 01´·68N., 114° 16´·71E.

4928 PHILIPPINE ISLANDS - Panay - NM Block. Note.


Source: Philippine Notices 12/72-73/22, 5/66/23, 7/90/23 and Philippine Lights List

Chart 4485 [ previous update 1193/23 ] WGS84 DATUM


Insert the accompanying block, centred on: 11° 37´·0N., 122° 46´·0E.
the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 11° 21´·23N., 122° 56´·73E.

4863 AUSTRALIA - Queensland - Buoy.


Source: Australian Notice 24/1001/23

Chart Aus 293 [ previous update 4595/23 ] WGS84 DATUM


Insert
BWQ(3)10s
r 10° 33´·68S., 142° 14´·64E.

4872 AUSTRALIA - Victoria - Light-beacon.


Source: Australian Notice 24/1012/23

Chart Aus 143 [ previous update 4646/23 ] WGS84 DATUM


Delete
TlFl.Y.3s 37° 51´·84S., 144° 52´·07E.

2.40
Wk51/23
II

4875 AUSTRALIA - Queensland - Light-beacon.


Source: Australian Notice 24/997/23

Chart Aus 827 [ previous update 591/23 ] WGS84 DATUM


Insert
TlÜ Fl.Y.2·5s 19° 10´·15S., 146° 48´·55E.

4894 AUSTRALIA - New South Wales - Buoy.


Source: Australian Notice 24/990/23

Chart Aus 807 [ previous update 3450/23 ] WGS84 DATUM


Move
DfFl.Y.5s FAD (Oct-May), from: 35° 51´·18S., 150° 22´·00E.
to: 35° 50´·00S., 150° 22´·63E.

4903 AUSTRALIA - Queensland - Buoy.


Source: Australian Notice 24/1000/23

Chart Aus 814 [ previous update 4596/23 ] WGS84 DATUM


Move
EfFl(5)Y.20s, from: 27° 29´·21S., 153° 38´·03E.
to: 27° 28´·61S., 153° 38´·12E.

4909 AUSTRALIA - Queensland - Mooring buoys.


Source: Australian Notice 24/993/23

Chart Aus 826 [ previous update 3445/23 ] WGS84 DATUM


Insert
RfFl.Y.4s 19° 50´·50S., 148° 01´·25E.
(a) 19° 50´·60S., 148° 01´·00E.
Delete depth, 107, close SE of: (a) above

4847 NEW ZEALAND - North Island - Buoy.


Source: New Zealand Notice 24/78/23

Chart NZ 522 [ previous update 3627/21 ] WGS84 DATUM


Insert
EfFl(5)Y.20s 36° 25´·17S., 175° 07´·66E.

2.41
Wk51/23
II

4839 SOUTH PACIFIC OCEAN - Îles de la Société - Restricted area.


Source: French Notice 24/230/23

Chart 1107 (Panel, Port de Fare and Approaches) [ previous update 4709/23 ] IGN 51-54 DATUM
Insert limit of submarine cable area, ÇÉÇ, joining: (a) 16° 43´·45S., 151° 02´·07W.
(b) 16° 43´·42S., 151° 02´·13W.
(c) 16° 43´·66S., 151° 02´·31W.
(d) 16° 43´·70S., 151° 02´·42W.
(e) 16° 43´·61S., 151° 03´·01W.
(f) 16° 43´·51S., 151° 02´·98W.
(g) 16° 43´·57S., 151° 02´·39W.
(h) 16° 43´·37S., 151° 02´·25W.
(i) 16° 43´·31S., 151° 02´·15W.
(j) 16° 43´·33S., 151° 02´·05W.

Å, within: (a)-(j) above

4893 CANADA - British Columbia - Depths.


Source: Canadian Notice 7/3000/23

Chart 4050 (INT 50) [ previous update 4171/22 ] WGS84 DATUM


Replace depth, 25, with depth, 24 53° 18´·2N., 135° 39´·3W.

Chart 4801 (INT 801) [ previous update 1367/21 ] WGS84 DATUM


Insert depth, 24, and extend 30m contour SE to enclose (a) 53° 18´·2N., 135° 39´·3W.
Delete depth, 25, close W of: (a) above

Chart 4810 (INT 810) [ previous update 2245/23 ] WGS84 DATUM


Insert depth, 24, and extend 30m contour SE to enclose (a) 53° 18´·2N., 135° 39´·3W.
Delete depth, 15, close W of: (a) above

Chart 4920 [ previous update 2372/23 ] NAD27 DATUM


Replace depth, 14, with depth, 13 53° 18´·2N., 135° 39´·2W.

4945 UNITED STATES OF AMERICA - West Coast - Depths.


Source: ENC US5CA12M

Chart 591 [ previous update 4722/23 ] NAD83 DATUM


Insert depth, 53, and extend 6fm contour SE to enclose (a) 37° 46´·69N., 122° 36´·63W.
Delete depth, 62, close NW of: (a) above
depth, 45, and associated 6fm contour, close SW of: (a) above

2.42
Wk51/23
II

4886 CHILE - Northern Coasts - Light-beacons. Leading line. Buoyage. Legend.


Source: Chilean Notice 9/51/23

Chart 4248 (Panel A, Talcahuano) [ previous update 1049/22 ] WGS84 DATUM


Insert
TF.R.5M (F.3M day) (a) 36° 42´·721S., 73° 06´·541W.

TF.R.5M (F.3M day) 36° 42´·703S., 73° 06´·502W.


leading line, pecked line for 275m and firm line for 1000m,
extending in direction 61°, from: (b) (a) above
legend 241°, seaward end of: (b) above

AbFl.G.3s
[ 36° 42´·695S., 73° 06´·348W.

DdFl.R.3s
: 36° 42´·585S., 73° 06´·308W.

AbFl.G.3s
[ 36° 42´·510S., 73° 06´·012W.

DdFl.R.3s
: 36° 42´·458S., 73° 06´·048W.

DdFl.R.3s : 36° 42´·310S., 73° 05´·839W.

4821 ARGENTINA - Light-beacons. Buoyage.


Source: Argentine Notice 7/95/23

Chart 1323 (Panel A) [ previous update 1809/23 ] WGS84 DATUM


Insert
Tw¥ Mo(A)10s Km 19·3 UNEN (a) 34° 28´·26S., 58° 28´·16W.
Delete
T¦h Fl.G.1·5s ’1’ UNEN close SW of: (a) above
Insert
T¥w Mo(A)10s ’A’ UNEN (b) 34° 29´·59S., 58° 17´·48W.
Delete
HpMo(A)10s
Z ’A’ UNEN close NW of:
(b) above
Replace
HZMp o(A)6s ’B’ UNEN with Tw¥ Mo(A)6s ’B’ UNEN 34° 30´·86S., 58° 19´·59W.

Chart 3561 [ previous update 4336/23 ] WGS84 DATUM


Insert
T¥w Mo(A)10s ’A’ UNEN (a) 34° 29´·59S., 58° 17´·48W.
Delete
HpMZ o(A)10s ’A’ UNEN close NW of: (a) above
Replace
HZMo(A)6s
p ’B’ UNEN with Tw¥ Mo(A)6s ’B’ UNEN
34° 30´·86S., 58° 19´·59W.

2.43
Wk51/23
II

4897 BRAZIL - South Coast - Wrecks.


Source: Brazilian Notice 15/S 130/23

Chart 544 [ previous update 2917/23 ] WGS84 DATUM


Insert
´ 27° 31´·53S., 48° 24´·18W.
27° 48´·13S., 48° 29´·20W.

Chart 3981 [ previous update 4615/23 ] WGS84 DATUM


Insert
´ 27° 31´·5S., 48° 24´·2W.

Chart 3982 [ previous update 996/23 ] WGS84 DATUM


Insert
´ 27° 48´·1S., 48° 29´·2W.

4804* WEST INDIES - Turks and Caicos Islands - NM Block.


Source: Pedro Santana Construction and Carnival Grand Bahama Investment LTD.

Chart 468 (Panel, Grand Turk Terminal 1) [ previous update New Edition 10/12/2020 ] WGS84 DATUM
Insert the accompanying block, centred on: 21° 25´·7N., 71° 08´·9W.

4844 MEXICO - Gulf of Mexico - Buoyage.


Source: ENC MX372000

Chart 365 [ previous update 4568/21 ] WGS84 DATUM


Insert
HZLp Fl.10s (a) 22° 29´·40N., 97° 48´·15W.
Delete
HZLFl.10s
p Altamira, close SW of:
(a) above

Chart 376 [ previous update 3462/23 ] WGS84 DATUM


Replace
HpLZ Fl.10s Altamira with HpLZ Fl.10s 22° 29´·3N., 97° 48´·3W.

Chart 3768 [ previous update 4753/23 ] WGS84 DATUM


Replace
HZLp Fl.10s Altamira with HZLp Fl.10s 22° 29´·3N., 97° 48´·3W.

4855 WEST INDIES - Leeward Islands - NM Block.


Source: French Notice 6/260/23

Chart 2079 (Panel C, Baie de Marigot) [ previous update 4187/23 ] WGS84 DATUM
Insert the accompanying block, centred on: 18° 04´·4N., 63° 05´·4W.

2.44
Wk51/23
II

4867* WEST INDIES - Leeward Islands - Depths.


Source: UKHO

Chart 585 [ previous update 4541/23 ] WGS84 DATUM


Insert depth, 701 16° 49´·39N., 62° 15´·65W.
depth, 706 (a) 16° 48´·07N., 62° 15´·84W.
Delete depth, 786, close NE of: (a) above

Chart 1025 (INT 4182) [ previous update 4541/23 ] WGS84 DATUM


Insert depth, 701 (a) 16° 49´·4N., 62° 15´·7W.
Delete depth, 805, close S of: (a) above

4883 CUBA - North Coast - Buoyage.


Source: Cuban Notices 9/184/23 and 9/195/23

Chart 414 [ previous update 2880/23 ] WGS84 DATUM


Insert
GdF: l.R.4s ’4’ 23° 08´·230N., 82° 20´·496W.

IbF[ l.G.3s ’5’ 23° 08´·030N., 82° 20´·367W.

Gd: Fl.R.4s ’6’ 23° 08´·014N., 82° 20´·486W.


Delete former Ib[ Fl.G.3s ’5’
23° 08´·067N., 82° 20´·606W.
former G:F d l.R.4s ’6’ 23° 08´·021N., 82° 20´·793W.
former GdFl.R.4s
: ’4’
23° 08´·416N., 82° 20´·822W.

4887 WEST INDIES - Virgin Islands - Lights. Light-beacons.


Source: ENCs US5PR12M and US4PR11M

Chart 485 [ previous update 211/23 ] NAD83 DATUM


Insert
¶ Fl.G.4s5m5M 17° 45´·98N., 64° 38´·37W.
Delete former ¶ Fl.G.4s5m5M
17° 45´·99N., 64° 38´·67W.

Chart 485 (Panel C, Christiansted Harbor) [ previous update 211/23 ] NAD83 DATUM
Insert
Td© Fl.R.2·5s5m5M ’10’ (a) 17° 45´·423N., 64° 42´·017W.
Delete
T©d Fl.R.2·5s5m3M ’10’, close N of: (a) above
Insert
T¦Fl.G.4s5m5M
b ’13’
(b) 17° 45´·061N., 64° 41´·953W.
Delete
T¦Fl.G.4s5m4M ’13’, close SE of: (b) above
Amend light-beacon to, Q.G.5m4M 17° 45´·338N., 64° 41´·942W.

2.45
Wk51/23
II

4915 UNITED STATES OF AMERICA - Gulf of Mexico - Buoy.


Source: ENC US3GC05M

Chart 3852 [ previous update 4133/23 ] NAD83 DATUM


Delete
GfFl.Y.4s E1 29° 42´·0N., 86° 19´·7W.

4938 UNITED STATES OF AMERICA - Gulf of Mexico - Platform.


Source: US Coast Guard District 8 LNM 36/11340/23

Chart 3849 [ previous update 2016/23 ] NAD83 DATUM


Delete
¼{ 28° 05´·1N., 94° 26´·6W.

Chart 3850 [ previous update 2312/23 ] NAD83 DATUM


Delete
¼{ 28° 05´·1N., 94° 26´·6W.

4944 CUBA - North Coast - Light.


Source: Cuban Notice 11/241/23

Chart 2863 [ previous update 3512/23 ] WGS84 DATUM


Amend light to, Fl.8s15m12M 23° 04´·4N., 80° 05´·2W.

4840 UNITED STATES OF AMERICA - East Coast - Buoy.


Source: ENC US5CT1FV

Chart 2732 (Panel 2, New London Harbor) [ previous update 379/23 ] NAD83 DATUM
Delete symbol, orange and white pillar light-buoy, F 41° 21´·073N., 72° 05´·079W.

4843 CANADA - Gulf of Saint Lawrence - Buoyage.


Source: Canadian Notice 7/4023/23

Chart 4765 [ previous update 3620/23 ] NAD83 DATUM


Insert
HpMo(A) JD (a) 46° 27´·2N., 62° 44´·4W.
Delete
JdMo(A),
k close N of:
(a) above
Replace
JdMo(A)
k with Bp Mo(A) DP
46° 54´·0N., 64° 14´·3W.

2.46
Wk51/23
II

4891 CANADA - Saint Lawrence River - Obstruction.


Source: Canadian Notice 10/1320/23

Chart 4782 [ previous update 4536/23 ] NAD83 DATUM


Insert
åObstn 48° 15´·27N., 69° 07´·81W.

4912 UNITED STATES OF AMERICA - East Coast - Note.


Source: UKHO

Chart 2486 [ previous update 167/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 44° 17´·93N., 69° 11´·07W.

Chart 2489 [ previous update 2762/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 40° 55´·01N., 70° 03´·45W.

Chart 2563 [ previous update 3338/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 38° 36´·32N., 75° 13´·64W.

Chart 2564 [ previous update 4490/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 38° 43´·37N., 75° 24´·93W.

Chart 2754 [ previous update 3219/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 41° 10´·19N., 73° 15´·59W.

Chart 2755 [ previous update 3338/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 40° 43´·27N., 73° 26´·06W.

Chart 3204 [ previous update 3650/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 40° 23´·65N., 74° 11´·42W.

Chart 3451 [ previous update 4428/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 40° 47´·330N., 73° 56´·959W.

Chart 3454 [ previous update 4567/22 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 40° 48´·063N., 74° 00´·681W.

Chart 3455 [ previous update 1488/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 40° 41´·187N., 73° 59´·022W.

2.47
Wk51/23
II
4912 UNITED STATES OF AMERICA - East Coast - Note. (continued)

Chart 3456 [ previous update 3271/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 40° 37´·154N., 74° 01´·741W.

Chart 3457 [ previous update 3692/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 40° 34´·699N., 74° 07´·994W.

Chart 3458 [ previous update 308/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 40° 32´·543N., 74° 12´·977W.

Chart 3459 [ previous update 4171/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 40° 35´·22N., 73° 58´·31W.

Chart 3688 [ previous update 2923/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 33° 58´·24N., 78° 00´·82W.

4934 UNITED STATES OF AMERICA - East Coast - Note.


Source: UKHO

Chart 2604 (Panel 1) [ previous update 4705/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 39° 50´·784N., 75° 09´·446W.

Chart 2605 (Panel 3) [ previous update 207/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 40° 09´·85N., 74° 50´·39W.

Chart 2731 [ previous update 137/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 41° 41´·83N., 71° 22´·69W.

Chart 2801 [ previous update 1356/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 32° 03´·11N., 81° 00´·01W.

Chart 2805 [ previous update 4463/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 32° 20´·22N., 80° 33´·70W.

Chart 2813 [ previous update 3733/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 36° 55´·21N., 76° 15´·19W.

Chart 2814 [ previous update 3733/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 36° 54´·42N., 76° 14´·71W.

2.48
Wk51/23
II
4934 UNITED STATES OF AMERICA - East Coast - Note. (continued)

Chart 2818 [ previous update 292/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 30° 45´·00N., 81° 28´·53W.

Chart 2829 [ previous update 3628/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 36° 54´·76N., 76° 08´·48W.

Chart 2919 [ previous update 3802/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 36° 54´·04N., 76° 14´·90W.

Chart 2959 [ previous update 3459/22 ] WGS84 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 20° 20´·4N., 76° 37´·0W.

Chart 3686 [ previous update 3513/23 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 34° 10´·83N., 76° 33´·52W.

Chart 3687 [ previous update 2445/22 ] NAD83 DATUM


Insert the accompanying note, AUTOMATIC IDENTIFICATION
SYSTEMS, centred on: 33° 24´·01N., 78° 22´·77W.

4948 UNITED STATES OF AMERICA - East Coast - Light-beacon. Buoy.


Source: ENC US4VA40M

Chart 2920 (Panel 1) [ previous update 2700/23 ] NAD83 DATUM


Insert
TjQ.R.15ft4M
¨ ’8’
(a) 37° 30´·84N., 76° 18´·93W.
Delete
DdQ.R ’8’, close SE of: (a) above

2.49
Wk51/23
II

4806(T)/23 GERMANY - Baltic Coast - Restricted areas. Buoyage.


Automatic Identification Systems.
Source: WSA Ostsee 383/23
1. A restricted area, entry prohibited, marked by special purpose light-buoys, Fl(3)Y.10s, with automatic identification system,
AIS, has been established bounded by the following positions:

OWA North:
*54° 36´·62N., 11° 19´·79E.
*54° 35´·49N., 11° 18´·86E.
*54° 35´·27N., 11° 19´·64E.
*54° 36´·40N., 11° 20´·57E.
2. A restricted area, entry prohibited, marked by special purpose light-buoys, Fl(2+1)Y.15s, with automatic identification
system, AIS, has been established bounded by the following positions:

OWA South:
*54° 32´·67N., 11° 16´·53E.
*54° 31´·58N., 11° 15´·51E.
*54° 31´·33N., 11° 16´·25E.
*54° 32´·44N., 11° 17´·29E.
3. Mariners are advised to navigate with caution in the area.
4. *Former Notice 4071(T)/23 is cancelled.
*Indicates new or revised entry
(WGS84 DATUM)

Chart affected - DE 31 (INT 1357)

4914(T)/23 ESTONIA - Buoyage.


Source: Estonian Notice 8/128(T)/23
1. Yellow pillar buoys, Fl.Y.5s ODAS, have been established in the following positions:

57° 56´·89N., 23° 54´·76E.


57° 56´·89N., 23° 55´·78E.
57° 57´·43N., 23° 56´·79E.
58° 00´·13N., 24° 03´·88E.
58° 00´·13N., 24° 04´·90E.
58° 00´·67N., 24° 05´·92E.
58° 01´·21N., 24° 05´·92E.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Chart affected - 2215

2.50
Wk51/23
II

4865(T)/23 NORTH SEA - Netherlands Sector - Measuring instrument. Buoyage.


Source: Netherlands HO
1. Measuring instruments have been temporarily established in the positions shown below. They are marked by either unlit
yellow buoys or yellow light-buoys, Fl(5)Y.20s, Fl.Y.5s, Fl(2)Y.5s or Iso.Y.2s and will be on station until further notice.
Only the largest scale Admiralty chart is quoted. This list will be updated as necessary by Temporary Notices to Mariners.

Position Largest Scale Charts(s)


51° 42´·41N., 3° 02´·08E. 110
51° 42´·30N., 3° 04´·90E. 110
51° 55´·70N., 3° 39´·80E. 122
55° 01´·41N., 3° 41´·11E. 266
55° 37´·26N., 6° 22´·12E. 1633
55° 37´·22N., 6° 31´·33E. 1633
54° 16´·7N., 5° 38´·5E. DE50
54° 16´·6N., 5° 39´·5E. DE50
53° 34´·22N., 6° 37´·95E. DE90
53° 31´·03N., 6° 41´·12E. DE90

51° 24´·46N., 3° 34´·65E. 116


51° 24´·66N., 3° 36´·71E. 116
51° 24´·55N., 3° 35´·67E. 116
51° 24´·61N., 3° 38´·18E. 116
51° 24´·67N., 3° 37´·70E. 116
51° 25´·55N., 3° 24´·00E. 116
51° 25´·46N., 3° 22´·07E. 116
51° 25´·52N., 3° 23´·04E. 116
51° 25´·58N., 3° 23´·90E. 116
51° 25´·66N., 3° 25´·14E. 116
51° 25´·67N., 3° 25´·83E. 116
*53° 23´·27N., 3° 07´·87E. 1632
53° 22´·60N., 3° 08´·08E. 1632
53° 52´·57N., 3° 42´·58E. 1632
53° 22´·74N., 3° 06´·95E. 1632
52° 53´·13N., 3° 42´·66E. 1631
52° 53´·69N., 3° 41´·06E. 1631
51° 28´·23N., 3° 19´·76E. 1874
51° 28´·29N., 3° 19´·76E. 1874
51° 26´·12N., 3° 20´·07E. 1874
51° 26´·19N., 3° 20´·07E. 1874
3. Mariners are advised to navigate with caution in the area.
4. *Former Notice 4530(T)/23 is cancelled.
* Indicates new or revised entry
(WGS84 DATUM)

Charts affected - 110 (INT 1473) - 116 (INT 1477) - 122 (INT 1472) - 266 - 1631 (INT 1418) - 1632 (INT 1420) - 1633
(INT 1417) - 1874 (INT 1474) - DE 50 (INT 1045) - DE 90 (INT 1461)

4907(T)/23 NORTH SEA - Netherlands Sector - Depths. Buoyage.


Source: Netherlands Notice 48/364(T)/23
1. Due to siltation within the Slijkgat fairway, the water depth is reduced as follows:
2. Depths are up to 1·4m less than charted, between buoys, SG 8, in position 51° 50´·79N., 3° 55´·92E. and SG 8A, in position
51° 50´·91N., 3° 56´·72E.

2.51
Wk51/23
II
4907(T)/23 NORTH SEA - Netherlands Sector - Depths. Buoyage. (continued)
3. Depths are up to 1·0m less than charted, between buoys, P 6, in position 51° 50´·95N., 4° 02´·[Link] P 6A, in position
51° 50´·65N., 4° 02´·19E.
4. Mariners are advised to keep mid fairway between these positions and navigate with caution in the area.
(WGS84 DATUM)

Chart affected - 110 (INT 1473)

4943(P)/23 CYPRUS - Submarine pipelines. Wrecks. Foul. Buoyage. Anchorage area. Dolphin. Light. Firing
practice area.
Source: Department of Lands and Surveys Cyprus
1. Submarine pipelines have been laid joining the following positions:

34° 37´·94N., 32° 53´·57E.


34° 38´·55N., 32° 54´·23E.
and
34° 43´·46N., 33° 17´·33E.
34° 43´·05N., 33° 17´·32E.
2. Wrecks exist in the following positions:

34° 33´·63N., 32° 56´·10E.


34° 54´·56N., 33° 39´·08E.
3. A dangerous wreck marked by a blue and yellow emergency wreck marking pillar buoy, cross topmark, Fl.W.1·5s exists
in position 34° 39´·61N., 33° 01´·65E.
4. A foul exists in position 34° 38´·44N., 33° 00´·79E.
5. A new anchorage area has been established, bounded by the following positions:

34° 40´·07N., 33° 02´·83E.


34° 40´·55N., 33° 03´·51E.
34° 41´·02N., 33° 04´·54E.
34° 40´·16N., 33° 05´·57E.
34° 39´·92N., 33° 05´·04E.
34° 39´·61N., 33° 03´·25E.
6. A dolphin with a light, Fl.R.3s exists in position 34° 42´·46N., 33° 10´·91E.
7. The following light-buoys have been established:

Characteristic Buoy Type Position


Q North Cardinal Buoy 34° 38´·41N., 33° 02´·32E.
Q(3)10s East Cardinal Buoy 34° 38´·37N., 33° 02´·69E.
Q(9)10s West Cardinal Buoy 34° 38´·14N., 33° 02´·24E.
Q(6)+LFl.10s South Cardinal Buoy 34° 38´·07N., 33° 02´·55E.
Fl.4s Special Purpose Buoy 34° 39´·98N., 33° 01´·99E.
Fl.4s Special Purpose Buoy 34° 39´·91N., 33° 02´·06E.
Fl.4s Special Purpose Buoy 34° 39´·83N., 33° 02´·13E.
Fl.4s Special Purpose Buoy 34° 39´·76N., 33° 02´·20E.
Fl.3s Yellow, Pillar Buoy 34° 43´·03N., 33° 17´·34E.
Fl(4)20s Yellow, Pillar Buoy 34° 39´·85N., 33° 15´·88E.
8. A firing danger area no longer exists in the following positions:

34° 43´·34N., 33° 18´·00E.


34° 38´·00N., 33° 18´·00E.
34° 40´·00N., 33° 25´·00E.
34° 45´·00N., 33° 31´·00E.
34° 47´·63N., 33° 31´·00E.

2.52
Wk51/23
II
4943(P)/23 CYPRUS - Submarine pipelines. Wrecks. Foul. Buoyage. Anchorage area. Dolphin. Light. Firing
practice area. (continued)
9. Mariners are advised to navigate with caution in the area.
10. These changes will be included in New Editions of Charts 849 and 850 to be published early 2024.
(WGS84 DATUM)

Charts affected - 849 - 850

4911(P)/23 TANZANIA - Harbour developments. Buoyage. Dredged areas. Channels.


Swinging circle.
Source: Tanzania Port Authority
1. Harbour developments are taking place in and around the port of Dar Es Salaam.
2. Changes to buoyage have taken place throughout the port and approaches.
3. Extensive dredging has taken place. The channel in the vicinity of 6° 48´·791S., 39° 18´·554E. has been dredged to 15·5m.
The channel in the vicinity of 6° 50´·148S., 39° 17´·794E. has been dredged to 14·5m.
4. A turning circle has been established centred on 6° 49´·472S., 39° 17´·456E.
5. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
6. These changes will be included in the next New Editions of Charts 693 and 674.
(WGS84 DATUM)

Charts affected - 674 (INT 7691) - 693 (INT 7692)

4860(P)/23 UNITED ARAB EMIRATES - Dredging areas. Works. Buoyage. Scientific instruments. Mooring
buoys. Restricted area.
Source: ADNOC Port Authority Notices 21 and 30/23
1. *Works are in progress to dredge and deepen the Yas and Ruwais channels in the approaches to Ar Ruways until further
notice, between the following approximate positions:

24° 24´·51N., 52° 36´·48E.


24° 17´·86N., 52° 40´·79E.
2. *Traffic flow and buoyage marking the channels will be amended throughout as the works progress.
3. Numerous scientific monitoring buoys and mooring buoys have been temporarily established to assist with dredging
operations in the vicinity of the channel and are subject to change.
4. A restricted area, has been established within an area bounded by the following positions:

24° 16´·50N., 52° 39´·12E.


24° 15´·46N., 52° 39´·13E.
24° 15´·47N., 52° 37´·86E.
24° 16´·50N., 52° 37´·89E.
5. Mariners are advised to navigate with caution in the area, consult the local port authorities for the latest information, and
maintain a listening watch on Ch 21 and 09.
6. Charts will be updated when works are complete.
7. *Former Notice 4398(P)/23 is cancelled.
*Indicates new or revised entry
(WGS84 DATUM)

Charts affected - 3179 (INT 7229) - 3778 - 3779 - 3780 - 3951 (INT 7241)

2.53
Wk51/23
II

4810(T)/23 INDIAN OCEAN - Buoyage.


Source: NOAA
1. The National Oceanographic and Atmospheric Administration (NOAA) maintains an array of buoys called Prediction and
Research Moored Array in the Atlantic (PIRATA).
2. The PIRATA buoys, white and orange, 2 metre toroid buoys with radar reflectors, are located in the following positions:

Designation Position
Pl279A 0° 00´·4N., 2° 41´·5W.
Pl277A 0° 00´·8N., 9° 50´·9W.
PT059 6° 01´·9S., 10° 00´·2W.
PI273A 12° 01´·0N., 38° 00´·6W.
PT060 9° 54´·6S., 9° 58´·9W.
Pl278A 19° 56´·0S., 9° 58´·0W.
PT058 20° 26´·7N., 23° 08´·6W.
PT057 11° 29´·0N., 22° 59´·3W.
PT056 4° 02´·0N., 22° 58´·7W.
PT054 8° 00´·4S., 30° 36´·9W.
PT046 20° 02´·0N., 37° 51´·1W.
PT055 15° 01´·1N., 37° 58´·4W.
Pl274A 7° 56´·2N., 38° 01´·1W.
*PI276A 10° 58´·7N., 17° 19´·5W.
PI275B 0° 00´·7N., 34° 59´·6W.
PT061 0° 00´·2N., 22° 59´·6W.
*PI280A 18° 51´·7S., 34° 40´·0W.
*PT062 13° 32´·0S., 32° 35´·5W.
3. NOAA also maintain Climate Moorings in the North Pacific Ocean. The buoys are yellow 2 metre solid hull discus buoys
with radar reflectors which are located in the following positions:

Designation Position
*KE018 32° 20´·1N., 144° 31´·2E.
PA017 50° 08´·2N., 144° 50´·2W.
4. Mariners are advised to give all buoys a 5 nautical mile wide berth.
5. Further information and up to date positions are available on the National Data Buoy Center website https://
[Link]/.
6. *Former Notice 3348(T)/23 is cancelled.
*Indicates new or revised entry
(WGS84 DATUM)

Charts affected - 529 - 611 - 1147 (INT 1085) - 4104 (INT 104) - 4115 - 4202 (INT 202) - 4203 (INT 203) - 4209 (INT
209) - 4215 (INT 215) - 4216 (INT 407) - 4510 (INT 510) - 4806 - 4810 (INT 810)

2.54
Wk51/23
II

4853(T)/23 INDIA - East Coast - Buoyage.


Source: Indian Notice 17/152(T)/23
1. Underwater Acoustic Doppler Current Profiler (ADCP) moorings have been deployed in the following positions:

Position Depth of ADCP (m)


*12° 01´·21N., 80° 08´·03E. 167
*12° 01´·92N., 80° 11´·49E. 187, 393, 747
*14° 30´·07N., 80° 25´·04E. 159, 364
*16° 01´·45N., 82° 02´·65E. 178, 383, 708
*16° 10´·74N., 81° 59´·04E. 175
*17° 44´·07N., 84° 00´·58E. 168, 377
*17° 48´·46N., 83° 59´·58E. 113, 188
*19° 25´·88N., 85° 42´·02E. 166
*19° 23´·82N., 85° 47´·39E. 190, 394, 998
*19° 58´·44N., 88° 19´·61E. 167, 347
2. All vessels are to maintain a safe distance and exercise caution in the vicinity of the moorings.
3. *Former Notice 1079(T)/23 is cancelled.
*Indicates new or revised entry.
(WGS84 DATUM)

Charts affected - 317 (INT 7400) - 318 (INT 7405) - 319 (INT 7408) - 2069 - IN 31 (INT 756) - IN 32 (INT 754) - IN 33
(INT 755) - IN 308 (INT 7409) - IN 352 (INT 7416) - IN 353 (INT 7413)

4906(T)/23 INDIA - East Coast - Wreck.


Source: Indian Nav Warning 675/23
1. A dangerous wreck has been reported to exist in approximate position 21° 00´·0N., 88° 35´·0E.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - IN 31 (INT 756) - IN 301 - IN 351 (INT 7419)

4940(P)/23 INDIA - West Coast - Depths.


Source: Indian Chart 207
1. Depths less than charted exist in the southwestern approaches to the Malacca Banks. The most significant are as follows:

Depth Position
4·8m 20° 31´·3N., 72° 13´·7E.
7·9m 20° 38´·0N., 72° 01´·8E.
10m 20° 38´·3N., 71° 46´·9E.
1·6m 20° 45´·0N., 72° 02´·3E.
5·5m 20° 55´·3N., 71° 55´·9E.
8·9m 21° 00´·2N., 71° 58´·3E.
7·7m 21° 04´·9N., 72° 06´·3E.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Chart affected - IN 254 (INT 7331)

2.55
Wk51/23
II

4881(P)/23 CHINA - East Coast - Submarine power cables.


Source: Chinese Notices 43/1548 and 1549/23
1. Submarine power cables have been laid, joining the following positions:

25° 46´·25N., 119° 37´·36E.


25° 47´·24N., 119° 38´·85E.
25° 48´·10N., 119° 47´·38E.
25° 48´·12N., 119° 56´·45E.
25° 48´·24N., 119° 56´·53E.
25° 49´·37N., 119° 56´·68E.
25° 49´·38N., 119° 57´·30E.
25° 49´·73N., 119° 57´·59E.
and

25° 47´·18N., 119° 38´·76E.


25° 48´·00N., 119° 47´·30E.
25° 47´·99N., 119° 56´·14E.
25° 47´·60N., 119° 57´·22E.
2. These changes will be included in a New Edition of Chart 2419 to be published early 2024.
3. Charts 2413, 2401 and 1761 will be updated by Notice to Mariners.
(CGCS 2000 DATUM)

Chart affected - 2419

4892(T)/23 VIETNAM - Virtual aids to navigation.


Source: VMS-North Notice 121(T)/23
1. Virtual aids to navigation (V-AIS) have been established in the following positions:

20° 35´·17N., 106° 53´·54E.


20° 34´·95N., 106° 52´·95E.
20° 34´·32N., 106° 53´·22E.
20° 34´·59N., 106° 53´·84E.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - 1965 - 3990

4921(P)/23 JAPAN - Hokkaidō - Wind turbines.


Source: Japanese Notice 48/5510(P)/23
1. Wind turbines, Fl(2)Y 6s 5M, exist in the following positions:

43° 11´·9N., 141° 14´·9E.


43° 12´·9N., 141° 16´·5E.
43° 13´·5N., 141° 15´·8E.
43° 12´·4N., 141° 14´·3E.
2. Unlit wind turbines exist within the area bounded by the positions above.
3. Charts will be updated by Notices to Mariners.
4. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Chart affected - JP 28

2.56
Wk51/23
II

4922(T)/23 JAPAN - Honshū - Works. Submarine pipeline. Dredging area.


Source: Japanese Notice 48/5511(T)/23
1. Dredging works are taking place, until 22 March 2024, within an area bounded by the following positions:

36° 46´ 09·2"N., 137° 06´ 22·3"E.


36° 46´ 06·7"N., 137° 06´ 33·1"E.
36° 46´ 09·1"N., 137° 06´ 31·4"E.
36° 46´ 15·1"N., 137° 06´ 33·5"E.
36° 46´ 17·5"N., 137° 06´ 22·6"E.
36° 46´ 11·6"N., 137° 06´ 20·6"E.
2. A submarine discharging pipeline is being laid, until 22 March 2024, within an area bounded by the following positions:

36° 46´ 15·1"N., 137° 06´ 33·5"E.


36° 46´ 13·6"N., 137° 06´ 33·0"E.
36° 46´ 09·8"N., 137° 06´ 42·7"E.
36° 46´ 05·6"N., 137° 06´ 48·8"E.
36° 45´ 58·9"N., 137° 06´ 49·9"E.
36° 45´ 51·9"N., 137° 06´ 59·7"E.
36° 45´ 38·2"N., 137° 07´ 28·7"E.
36° 45´ 34·3"N., 137° 07´ 33·8"E.
36° 45´ 33·6"N., 137° 07´ 39·2"E.
36° 45´ 27·1"N., 137° 07´ 56·4"E.
36° 45´ 26·7"N., 137° 08´ 00·1"E.
36° 45´ 27·5"N., 137° 08´ 00·4"E.
36° 45´ 28·9"N., 137° 07´ 57·3"E.
36° 45´ 35·5"N., 137° 07´ 40·0"E.
36° 45´ 36·1"N., 137° 07´ 34·9"E.
36° 45´ 39·7"N., 137° 07´ 30·2"E.
36° 45´ 53·5"N., 137° 07´ 01·2"E.
36° 45´ 59·9"N., 137° 06´ 52·1"E.
36° 46´ 06·6"N., 137° 06´ 51·0"E.
36° 46´ 11·4"N., 137° 06´ 44·2"E.
(WGS84 DATUM)

Chart affected - JP 1162B

4923(T)/23 JAPAN - Honshū - Dredging area. Works.


Source: Japanese Notice 48/5512(T)/23
1. Dredging works are taking place, until 15 March 2024, within an area bounded by the following positions:

40° 33´ 59·0"N., 141° 29´ 31·0"E.


40° 33´ 47·0"N., 141° 29´ 44·0"E.
40° 33´ 30·0"N., 141° 30´ 12·0"E.
40° 33´ 19·0"N., 141° 31´ 00·0"E.
40° 33´ 02·0"N., 141° 31´ 36·0"E.
40° 32´ 47·0"N., 141° 31´ 19·0"E.
40° 32´ 45·0"N., 141° 31´ 23·0"E.
40° 32´ 50·0"N., 141° 31´ 43·0"E.
40° 32´ 47·0"N., 141° 31´ 44·0"E.
40° 32´ 48·0"N., 141° 31´ 50·0"E.
40° 32´ 59·0"N., 141° 31´ 50·0"E.
40° 33´ 16·0"N., 141° 31´ 31·0"E.
40° 33´ 19·0"N., 141° 31´ 16·0"E.
(WGS84 DATUM)

Chart affected - JP 65

2.57
Wk51/23
II

4924(T)/23 JAPAN - Honshū - Depths.


Source: Japanese Notice 48/5514(T)/23
1. Depths less than charted exist in the following positions:

Depth Position
13·7m 38° 16´ 05·7"N., 141° 01´ 37·7"E.
13·3m 38° 16´ 03·5"N., 141° 01´ 34·6"E.
14·5m 38° 16´ 04·7"N., 141° 01´ 50·6"E.
9·5m 38° 16´ 02·4"N., 141° 01´ 46·9"E.
2. Depths of 0·6m to 1·3m less than charted exist on and in the vicinity of a line joining the following positions:

38° 16´ 01·0"N., 141° 01´ 48·2"E.


38° 16´ 00·7"N., 141° 01´ 50·8"E.
(WGS84 DATUM)

Chart affected - JP 64B

4925(T)/23 JAPAN - Seto Naikai - Buoy. Virtual aid to navigation.


Source: Japanese Notice 48/5515(T)/23
1. Iyo Nada Koro Light Buoy is non-existent and has been replaced by Virtual AIS, No 8, Safe water mark, in position
33° 49´·90N., 132° 32´·60E.
(WGS84 DATUM)

Charts affected - JP 141 - JP 1102 - JP 1108

4849(T)/23 AUSTRALIA - Victoria - Scientific instruments.


Source: Australian Notices 24/1028(T)-1029(T)/23
1. Subsurface scientific instruments exist as follows:

Position Depth below surface


38° 19´·2S., 147° 18´·6E. 10m
38° 18´·0S., 147° 20´·4E. 15m
38° 16´·2S., 147° 22´·2E. 10m
38° 14´·4S., 147° 24´·6E. 10m
38° 13´·8S., 147° 24´·7E. 10m
38° 13´·8S., 147° 27´·0E. 10m
38° 21´·0S., 147° 21´·0E. 15m
38° 19´·2S., 147° 23´·4E. 15m
38° 18´·0S., 147° 25´·2E. 15m
38° 16´·8S., 147° 27´·0E. 15m
38° 15´·6S., 147° 30´·0E. 15m
2. Subsurface scientific instruments exist as follows:

2.58
Wk51/23
II
4849(T)/23 AUSTRALIA - Victoria - Scientific instruments. (continued)

Position Depth below surface


38° 26´·8S., 147° 26´·0E. 40m
38° 26´·0S., 147° 27´·1E. 40m
38° 25´·3S., 147° 28´·3E. 40m
38° 24´·5S., 147° 29´·3E. 40m
38° 23´·8S., 147° 30´·5E. 40m
38° 23´·1S., 147° 31´·6E. 40m
38° 22´·4S., 147° 32´·6E. 40m
38° 21´·7S., 147° 33´·8E. 40m
38° 20´·9S., 147° 34´·9E. 40m
38° 20´·2S., 147° 36´·0E. 40m
38° 19´·0S., 147° 37´·7E. 40m
38° 18´·3S., 147° 38´·9E. 40m
38° 31´·3S., 147° 31´·1E. 40m
38° 30´·5S., 147° 32´·2E. 40m
38° 29´·8S., 147° 33´·2E. 40m
38° 29´·1S., 147° 34´·4E. 40m
38° 28´·4S., 147° 35´·5E. 40m
38° 27´·7S., 147° 36´·6E. 40m
38° 26´·9S., 147° 37´·7E. 40m
38° 26´·2S., 147° 38´·8E. 40m
38° 25´·4S., 147° 39´·9E. 40m
38° 24´·7S., 147° 41´·0E. 40m
38° 24´·0S., 147° 42´·1E. 30m
38° 23´·3S., 147° 43´·2E. 30m
38° 22´·5S., 147° 44´·3E. 30m
4. A subsurface scientific instrument, depth 10m, exists in position: 38° 26´·7S., 147° 08´·2E.
5. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
(WGS84 DATUM)

Charts affected - 4644 (INT 644) - Aus 357

4833(T)/23 NEW ZEALAND - South Island - Scientific instruments.


Source: New Zealand Bulletin 24/23 General Notice
1. From 25 November, subsurface instruments are expected to be deployed in 30-40 metre water depths off the Ashburton
River (within a radius of 2 kilometres, centred on 44° 13´·1S., 171° 54´·9E.).
2. Mariners are advised to exercise caution when undertaking seabed activities such as trawling in these areas.
3. As-laid positions will be advised in due course.
(WGS84 DATUM)

Charts affected - 4648 (INT 648) - NZ 64

4835(P)/23 NEW ZEALAND - South Island - Depths. General information.


Source: New Zealand Notice 24/79(P)/23
1. Shoaling has been reported in vicinity of 41° 15´·691S., 173° 14´·918E. extending SW into the entrance to Blind Channel.
Latest survey information indicates movement of shoaling approximately 200m to the NE of the channel entrance.
2. Mariners are advised to exercise caution, consult the local port authorities for the latest information and utilize navigational
aids when navigating in the area.

2.59
Wk51/23
II
4835(P)/23 NEW ZEALAND - South Island - Depths. General information. (continued)
3. Strong currents flow in the channels and the ‘Cut’. This area is especially hazardous in wind over tide conditions (Spring
Ebb (outgoing) tide with a Northerly wind).
4. Charting action will take place in due course.
(WGS84 DATUM)

Chart affected - NZ 6142

4926(T)/23 NORTH PACIFIC OCEAN - General information.


Source: Japanese Notice 48/5518(T)/23
1. A rocket launch is due to take place from the Tanegashima Space Center between 10 January and 29 February 2024.
2. A sea warning area will be established, bounded by the following positions:

30° 25´·67N., 130° 58´·35E.


30° 26´·80N., 130° 59´·88E.
30° 27´·60N., 131° 00´·33E.
30° 27´·60N., 131° 27´·00E.
30° 19´·80N., 131° 27´·00E.
30° 19´·80N., 130° 57´·82E.
30° 21´·95N., 130° 57´·82E.
30° 22´·33N., 130° 57´·68E.
3. Between 11 January and 29 February 2024, rocket debris is predicted to fall within areas bounded by the following
positions:

30° 32´·0N., 132° 29´·0E.


30° 32´·0N., 133° 04´·0E.
30° 14´·8N., 133° 03´·9E.
30° 13´·3N., 133° 01´·8E.
30° 14´·0N., 132° 29´·0E.
and
25° 15´·0N., 134° 03´·0E.
25° 35´·0N., 135° 15´·0E.
23° 58´·0N., 135° 41´·0E.
23° 38´·0N., 134° 30´·0E.
and
14° 58´·0N., 133° 10´·0E.
14° 44´·0N., 134° 27´·0E.
12° 45´·0N., 134° 05´·0E.
12° 59´·0N., 132° 48´·0E.
4. Mariners are advised to navigate with caution within these areas.
(WGS84 DATUM)

Charts affected - 2347 - 2412 - 3237 - 4507 (INT 507) - 4509 (INT 509) - 4510 (INT 510) - JP 1221

2.60
Wk51/23
II

4834(T)/23 GUYANA - Restricted area. Buoyage.


Source: Maritime Administration Department of Guyana Notice 149/23
1. A restricted area, entry prohibited, has been established bounded by the following positions:

*6° 49´·58N., 58° 12´·63W.


*6° 49´·27N., 58° 12´·19W.
*6° 56´·80N., 58° 06´·79W.
*6° 58´·03N., 58° 05´·24W.
7° 03´·76N., 58° 01´·13W.
7° 03´·97N., 58° 01´·41W.
7° 04´·28N., 58° 01´·19W.
7° 09´·18N., 57° 39´·52W.
7° 09´·81N., 57° 40´·19W.
7° 04´·82N., 58° 01´·94W.
7° 04´·50N., 58° 02´·17W.
7° 06´·92N., 58° 05´·54W.
*7° 01´·19N., 58° 09´·66W.
*6° 58´·13N., 58° 08´·63W.
*6° 55´·40N., 58° 08´·63W.
*6° 51´·31N., 58° 11´·56W.
*6° 51´·24N., 58° 11´·45W.
2. A Northern Transiting Corridor has been established between the following positions, it is marked by lateral buoys:

*7° 06´·11N., 58° 08´·47W.


*7° 03´·55N., 58° 10´·48W.
*6° 57´·03N., 58° 03´·89W.
*6° 59´·10N., 58° 01´·29W.
3. A Southern Transiting Corridor has been established between the following positions, it is marked by lateral buoys:

*6° 59´·58N., 58° 12´·54W.


*6° 58´·64N., 58° 14´·04W.
*6° 52´·48N., 58° 07´·83W.
*6° 52´·97N., 58° 06´·94W.
4. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
5. Former Notice 3361(T)/23 is cancelled.
*Indicates new or revised entry
(WGS84 DATUM)

Charts affected - 527 - 537 - 572 - 2687

2.61
Wk51/23
To accompany Notice to Mariners 4827/23

On Chart 1782

AUTOMATIC IDENTIFICATION SYSTEMS


AIS transmitters on aids to navigation are
not shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of
Radio Signals.

To accompany Notice to Mariners 4859/23

On Chart 2215

HISTORIC WRECKS
The sites of historic wrecks are protected from
unauthorised interference.

To accompany Notice to Mariners 4869/23

On Chart 1153

AUTOMATIC IDENTIFICATION SYSTEMS


AIS transmitters on aids to navigation are
not shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of
Radio Signals.

To accompany Notice to Mariners 4869/23

On Chart 1154

AUTOMATIC IDENTIFICATION SYSTEMS


AIS transmitters on aids to navigation are
not shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of
Radio Signals.

To accompany Notice to Mariners 4912/23

On Chart 2486

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4912/23

On Chart 2489

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

Wk51/23
To accompany Notice to Mariners 4912/23

On Chart 2563

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4912/23

On Chart 2564

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4912/23

On Chart 2754

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4912/23

On Chart 2755

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4912/23

On Chart 3204

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4912/23

On Chart 3451

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

Wk51/23
To accompany Notice to Mariners 4912/23

On Chart 3454

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4912/23

On Chart 3455

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4912/23

On Chart 3456

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4912/23

On Chart 3457

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4912/23

On Chart 3458

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4912/23

On Chart 3459

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

Wk51/23
To accompany Notice to Mariners 4912/23

On Chart 3688

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4928/23

On Chart 4485

AUTOMATIC IDENTIFICATION SYSTEMS


AIS transmitters on aids to navigation are
not shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of
Radio Signals.

To accompany Notice to Mariners 4934/23

On Chart 2604

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4934/23

On Chart 2605

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4934/23

On Chart 2731

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4934/23

On Chart 2801

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

Wk51/23
To accompany Notice to Mariners 4934/23

On Chart 2805

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4934/23

On Chart 2813

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4934/23

On Chart 2814

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4934/23

On Chart 2818

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4934/23

On Chart 2829

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4934/23

On Chart 2919

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

Wk51/23
To accompany Notice to Mariners 4934/23

On Chart 2959

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4934/23

On Chart 3686

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

To accompany Notice to Mariners 4934/23

On Chart 3687

AUTOMATIC IDENTIFICATION SYSTEMS


Not ALL AIS transmitters on aids to navigation
are shown on this chart. V-AIS will be shown.
For details, see ADMIRALTY List of Radio
Signals.

Wk51/23
To accompany Notice to Mariners 4804/23. Image Size (mm) 125.2 by 105.5

Wk51/23
To accompany Notice to Mariners 4809/23. Image Size (mm) 192.6 by 170.1

Wk51/23
To accompany Notice to Mariners 4827/23. Image Size (mm) 50 by 52.6

Wk51/23
To accompany Notice to Mariners 4829/23. Image Size (mm) 218 by 180.3

Wk51/23
To accompany Notice to Mariners 4855/23. Image Size (mm) 193.9 by 163.1

Wk51/23
To accompany Notice to Mariners 4864/23. Image Size (mm) 78.3 by 125.2

Wk51/23
To accompany Notice to Mariners 4910/23. Image Size (mm) 37.7 by 77.4

Wk51/23
To accompany Notice to Mariners 4910/23. Image Size (mm) 36.4 by 49.2

Wk51/23
To accompany Notice to Mariners 4910/23. Image Size (mm) 37.8 by 77.4

Wk51/23
To accompany Notice to Mariners 4913/23. Image Size (mm) 46.9 by 52.2

Wk51/23
To accompany Notice to Mariners 4913/23. Image Size (mm) 51.1 by 57.3

Wk51/23
To accompany Notice to Mariners 4928/23. Image Size (mm) 56.8 by 143.1

Wk51/23
To accompany Notice to Mariners 4930/23. Image Size (mm) 100.4 by 112

Wk51/23
To accompany Notice to Mariners 4942/23. Image Size (mm) 37.2 by 46.4

Wk51/23
III

NAVIGATIONAL WARNINGS

See The Mariner’s Handbook (2020 Edition). Only the most convenient ADMIRALTY Chart is quoted. All warnings issued
within the previous 42 days are broadcast via Enhanced Group Call (EGC) and/or NAVTEX.
The complete texts of all in-force NAVAREA I warnings, including those which are no longer being broadcast, are
available from [Link] Additionally, a quarterly cumulative list of
the complete text of all in-force NAVAREA I Warnings is included in Section III of the Weekly NM Bulletin in Weeks
1, 13, 26 and 39 each year.
Alternatively, these may be requested by e-mail from NAVAREA I Co-ordinator at: navwarnings@[Link]
The RNW web page also contains a link to the IHO website which allows direct access to all the other NAVAREA Co-
ordinators around the world who have made their NAVAREA warnings available on the web.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Weekly Edition 51 published on the UKHO website 11 Dec 23.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Navarea I (NE Atlantic) Weekly Edition 51
The following NAVAREA I warnings were in force at 110500 UTC Dec 23.

2023 series: 218, 238, 239, 240.

Summary of Navarea I warnings issued since Weekly Edition 50:

238 1. Navarea I warnings in force at 081000 UTC Dec 23. 2. Cancel 235/23.

239 GMDSS.
ENGLAND AND SCOTLAND EAST COAST, INCLUDING THE NORTH SEA AND THE SHETLAND
ISLANDS.
Chart GB 2 (INT 160).
Cullercoats NAVTEX Station (G), 55-04N 001-28W, unreliable.

240 1. RIGLIST. Correct at 110500 UTC Dec 23.

Southern North Sea: 51N to 55N


52-24.4N 003-45.4E Swift 10 ACP P12-SW
52-40.8N 003-48.3E JB-115 ACP HWA
53-01.1N 001-47.6E Valaris 72 ACP Hewett Gas Field
53-09.5N 002-44.1E Haeva (ex Paragon HZ1)
53-14.0N 003-14.5E 590021 ACP Allseas Test
53-34.1N 001-38.0E Seafox 4 ACP Barque Gas Field
53-39.0N 003-52.0E Well Safe Protector ACP K9C-A
54-04.4N 000-54.9E Erda ACP Ravenspurn North Gas Field
54-05.0N 000-49.5E Valaris 247 ACP Ravenspurn South Gas Field
54-08.8N 002-49.4E Prospector 1 ACP D18a-A

3.1
Wk51/23
III

North Sea: 55N to 60N, East of 5W


55-18.8N 003-48.6E Noble Resolute ACP A15
55-28.5N 005-06.3E Noble Reacher (ex Maersk) ACP Dan Oil Field
55-32.2N 005-01.9E Shelf Drilling Winner (ex Noble Sam Turner) ACP Halfdan Oil Field
56-05.8N 004-13.3E Noble Resolve (ex Maersk) ACP Syd Arne Gas Field
56-19.5N 003-21.2E Noble Invincible ACP Valhall Oil Field
56-25.1N 002-54.1E Linus
56-25.3N 003-12.5E West Elara ACP Eldfisk Oil Field
56-35.0N 002-28.5E Valaris 120
NEW 56-41.8N 002-20.3E Noble Intrepid ACP Judy Oil Field
56-50.9N 001-35.7E Ocean Endeavor
56-54.0N 002-22.8E Valaris 122
56-54.6N 000-08.2W Valaris Norway
57-01.9N 001-57.3E Valaris 121 ACP Shearwater Oil Field
57-09.1N 001-40.5E Valaris 248 (ex Gorilla VI)
57-14.0N 001-37.6E Noble Innovator
57-38.2N 001-40.3E Stena Spey
57-48.9N 004-32.0E Maersk Inspirer ACP YME Oil Field
57-50.7N 000-54.7W COSL Innovator
57-54.2N 000-01.9E Well Safe Guardian
57-57.7N 000-55.0W Shelf Drilling Fortress ACP Golden Eagle
57-58.7N 000-31.8E Paul B Loyd Jr
58-19.8N 001-42.6W COSL Pioneer
58-20.8N 000-06.8E Ocean Patriot
58-22.0N 001-33.0E Transocean Enabler
NEW Mandal Noble Lloyd Noble
58-34.8N 001-15.7E Well Safe Defender
58-46.1N 002-45.6E Deepsea Atlantic
58-46.2N 001-29.4E Stena Don
NEW 59-03.6N 002-14.4E Scarabeo 8
59-08.5N 002-24.4E Deepsea Aberdeen
59-10.5N 002-22.6E West Phoenix
59-35.1N 002-05.1E Deepsea Nordkapp

Norwegian Sea: 60N to 65N, East of 5W


60-01.5N 002-41.1E Deepsea Stavanger
NEW 60-23.1N 004-05.8W Ocean Greatwhite
60-30.3N 002-00.8E Askepott ACP Martin Linge
60-33.8N 002-01.2E Transocean Spitsbergen
61-04.6N 001-59.3E Askeladden
61-20.4N 001-59.9E COSL Promoter
61-32.5N 003-58.5E Deepsea Yantai
64-55.3N 006-44.3E Transocean Norge

South and West Coasts of the British Isles


NEW 53-29.3N 003-39.9W Seafox 7
53-32.1N 003-34.5W Irish Sea Pioneer ACP Douglas Oil Field
54-01.6N 003-51.6W Ensco 92 ACP 113/26

NOTES:
A. Rigs are protected by a 500 metre safety zone.
B. ACP - Adjacent to Charted Platform.
C. For Rigs located North of 65N, East of 5W, refer to Navarea XIX Warnings or visit [Link]

2. Cancel 237/23.

3.2
Wk51/23
IV

[51/23]
UPDATES TO ADMIRALTY SAILING DIRECTIONS

NP1 Africa Pilot Volume 1 (2020 Edition) The coast between Punta de la Restinga (3.184a)
and Punta de la Orchilla, the SW extremity of the
island, 10¾ miles WNW, is sheer and steep--to.
Arquipélago da Madeira – Ilha do Porto Santo -- 3 Between Punta de la Orchilla (274255N
Porto Santo — Pilotage 180922W), SE of which a light (3.183) is exhibited,
and Punta Arenas Blancas, 4 miles NNE, the coast is
71 high.
Ensenada El Golfo (274672N 180251W), a
Paragraph 2.15 4 lines 6--7 Replace by: bight, lies between Punta Arenas Blancas (274615N
Pilotage is compulsory and arranged in advance 180729W) and Punta de Salmor, 7½ miles ENE;
through Funchal. Pilot waiting area is about 1 to numerous rocks, above and below water, lie at the
1½ miles SSW of the head of the S mole. See also foot of the high cliffs forming the coast.
ADMIRALTY List of Radio Signals Volume 6(2). The coast between Punta de Salmor (274934N
175961W) (3.184c) and Punta Norte, 4 miles ENE,
is high and inaccessible, with rocks above and below
Roteiro da Costa de Portugal -- Arquipélago da Madeira
water lying close to the shore.
[NP1--No 119--Wk 51/23]
Depths
3.179
Islas Canarias -- Isla de Hierro — 1 The coast of the island is very steep--to and depths
General information; directions; light; reduce rapidly; the 50 m contour is only about 1 cable
port information; anchorage
from the shore in places.
110--111 Hazards
3.180
Paragraphs 3.177--3.184 including headings Replace by: 1 Volcán Togoro (273721N 175960W), a
submarine volcano, lies about 1½ miles SW of Punta
de la Restinga (3.184a). Last reported volcanic activity
ISLA DE HIERRO was in 2011. For general information, see The
Mariner’s Handbook.
General information
Traffic regulations
Description 3.181
3.177 1 Area To Be Avoided. The island is encompassed
1 Isla de Hierro (274400N 180000W), the SW of by an IMO--designated ATBA for all tankers and
Islas Canarias, lies 33 miles SW of Isla de la Gomera vessels over 500 gt carrying hydrocarbons or
(3.147). dangerous bulk cargo.
Valverde (274855N 175490W), the capital of the Marine reserve
island, stands on a plain in the N part of the island 3.182
surrounded by high mountains. 1 An area of coastal waters, on the SW coast of
Topography Hierro, has been designated a marine reserve. Within
3.178 the charted area, fishing or any underwater activity
1 The upper part of Isla de Hierro is an elevated are subject to authorisation by the Ministry of Fishing.
plateau, with Malpaso (274375N 180253W) the
Directions
highest point at 1501 m. The plateau slopes steeply to
the sea on all sides except to the NE; on the S side, Principal marks
its height varies between 1200 m and 1400 m. 3.183
The coast between Punta Norte (275095N 1 Major lights:
175550W), the N extremity of the island, and Punta Punta Orchilla Light (octagonal masonry tower on
de la Caleta, 3½ miles SE, is steep and free from white building, 25 m in height) (274240N
off--lying dangers. 180885W).
The coast between Punta de la Caleta (3.184) and Punta Norte to Puerto de La Estaca
Puerto de la Estaca (3.184d), 1¼ miles SW, is 3.184
steep--to. 1 From a position N of Punta Norte (275095N
2 The coast between Punta Tijimiraque (3.184a) and 175550W) (3.178), the track leads generally SE, S
Punta de Bonanza, 2½ miles SSW, and thence to and then SSW, passing:
Punta de la Restinga, 6 miles farther SW, is high, NE of Punta de Amacas (275049N 175419W),
steep--to and inaccessible. thence:
Between Punta de la Bonanza (274370N NE of Roque de las Gaviotas (275001N
175639W) and Punta de Miguel, 2½ miles SW, is a 175370W), a small islet, thence:
wide bay where the coast is composed of boulders E of Punta de la Caleta (274804N 175312W),
and black sand. which is sheer, thence:

4.1 Wk51/23
IV

2 ESE of Roca Anegada (274719N 175367W); 2 NNW of Bahía de Calcosas (275056N


the coast W of Roca Anegada is rocky and 175689W). A small group of houses and
indented with coves. warehouses is situated within the bay.
The track then continues to a position SE of Puerto The track then continues to a position N of Punta
de la Estaca (3.184d). Norte (3.178).

Puerto de la Estaca to Punta de la Restinga Puerto de La Estaca


3.184a
1 From the above position, the track continues SSW, General information
passing: 3.184d
ESE of Punta Tijimiraque (274592N 175459W). 1 Position and function. Puerto de La Estaca
Bahía Tijimiraque, N of the point, is a small bay (274687N 175412W) is situated at the N end of a
with a black sand beach at its end. Thence: sandy bight lying between Cueva de Diablo and Punta
ESE of Punta de la Bonanza (274371N Tijimiraque (3.184a), 1½ miles SSW.
175639W) (3.178), thence: Port Authority. Autoridad Portuaria de Santa Cruz
ESE of Punta de Miguel (274155N 175757W) de Tenerife, Puerto de La Estaca, La Estaca, Hierro
(3.178), thence: Island, Canary Islands.
2 ESE of Roques de la Piedra Bermeja Website. [Link]
(274008N 175829W). A brown building is
situated in the vicinity. Thence:
Limiting conditions
ESE of Punta del Miradero (273891N
3.184e
175826W).
1 Controlling depth. The Port Authority should be
The track then continues to a position S of Punta
contacted for the latest information on depths and
de la Restinga (273849N 175853W), the S
authorised draughts.
extremity of the island, which is steep--to and
inaccessible. A small fishing harbour and marina, Tidal levels. Mean spring range about 20 m; mean
marked by lights, lies close W. neap range about 07 m. For further information, see
ADMIRALTY Tide Tables Volume 8.

Punta de la Restinga to Punta de la Dehesa Arrival information


3.184b 3.184f
1 From the above position, the track leads generally 1 Anchorage may be obtained at the head of the
NW, passing: bight close offshore in a depth of 9 m, but it should be
SW of Bahía de Naos (273867N 175996W), a noted that depths increase very rapidly seaward.
small inlet with high sheer cliffs, situated between Pilotage is mandatory for vessels of 500 gt and
Punta de Los Frailes and Punta del las Cañas, over. For further information, see ADMIRALTY List of
thence: Radio Signals Volume 6(1).
2 SW of Punta del Azufre (274153N
180300W); a beach of boulders lies to the Harbour
W from where an access track is visible 3.184g
leading to one the few existing houses along 1 General layout. The port is protected by a
this stretch of coast. breakwater quayed on its inner side. An inner basin
3 From a position W of Punta Orchilla Light (3.183), lies at the head of harbour.
the track then leads N, passing:
W of Roque del Barbudo and Roque del Guincho Directions for entering harbour
(274312N 180963W), close offshore from 3.184h
Punta de la Orchilla, thence: 1 No formal directions are given, the chart being
W of Bahía del los Reyes (274444N 180915W), sufficient guide.
with rocky cliffs and fringed with rocks, including Useful marks:
Baja de Anacón, an islet, at the N end of the bay. Puerto de la Estaca. Breakwater Head Light (green
4 The track then continues to a position NW of Punta round tower truncated conical top and base, 7 m
de la Dehesa (274595N 180773W), a wide in height) (274684N 175406W).
promontory, fringed with rocks.
Basins and berths
Punta de la Dehesa to Punta Norte 3.184i
3.184c 1 Alongside berths. The inner side of the
1 From the above position, the track leads generally breakwater had two RoRo berths, 150 and 223 m in
ENE, passing: length, respectively. Depths range between 10 and
NNW of Ensenada El Golfo (3.178), thence: 15 m.
NNW of Punta de Salmor (274934N 175961W).
Roque de Salmor, a prominent islet, lies 3 cables Port services
W of the headland, with a smaller islet 4 cables 3.184j
farther W. Rocks above and below water lie in the 1 Repairs. There is a mobile 6 tonnes crane.
vicinity. Thence: Supplies. Small quantities of provisions are
NNW of an isolated bank (274995N 175921W) available. Water is scarce and only available in small
with a depth of about 15 m, thence: quantities.

Wk51/23 4.2
IV

Anchorages and harbours NP8 Pacific Coasts of Central America and


Punta Salmor United States Pilot (2019 Edition)
3.184k
1 Anchorage may be possible SW of Punta Salmor Nicaragua -- West coast -- Corinto —
(274934N 175961W) (3.184c), if conditions permit. Arrival information; anchorage
Local knowledge is recommended.
113
UKHO [NP1--No 121--Wk 51/23] Paragraph 4.41 Replace by:
1 Anchorage may be obtained in the vicinity of “C”
Mauritania – Nouakchott to Saint--Louis -- Light Buoy (122804N 871377W) in depths from
Port N’diago — Port information
about 20 to 25 m. This area can be uncomfortable
190 due to the ground swell likely to be experienced and
vessels intending to stay for any length of time are
After Paragraph 6.123 including existing Section IV Notice advised to enter the port.
Week 28/22 Insert:
UKHO [NP8--No 43--Wk 51/23]
Port N’diago
6.123a NP12 Arctic Pilot Volume 3 (2018 Edition)
1 General information. Port N’diago (162669N
162848W) is situated about 17 miles N of the village
of N’diago (6.117). The entrance is sheltered by two Greenland -- West coast -- Karrats Fjord —
breakwaters; a light is exhibited from the extremity of Rock; shoals
the N breakwater. The port is divided into four parts; a 226
commercial berth; a naval base; a naval shipyard and
a fishing quay. Paragraph 5.49 3 lines 8--11 Replace by:
2 Website. [Link] ...WSW. Two shoals with charted depths of 32 m and
Controlling depth. The approach channel has a 69 m lie respectively 2 miles SSW, and about 2¾ miles
reported least depth of about 12 m, mid--channel. SSE, of the S--most islets of the Schades øer (712300N
Contact the local authority for the latest information on 535200W).
depths.
Local knowledge is required. Danish Notices 30/291/22 & 11/96/23
Directions. Access to the port is through a channel [NP12--No 28--Wk 51/23]
marked by light buoys (lateral).
3 Anchorage. A designated anchorage area is
situated about 2 miles SW of the channel entrance. NP13 Australia Pilot Volume 1 (2020 Edition)
Berths. The commercial berth is about 220 m in
length with a reported depth alongside of about 12 m.
Western Australia -- King Sound -- Swan Point —
Grand Tortue Ahmeyim Project Wreck
6.123b
199
1 Works are in progress (2022) to install an FPSO,
and associated submarine pipelines, within a zone Paragraph 5.113 1 lines 1--2 Replace by:
centred on 160400N 165300W, as part of the
Grand Tortue Ahmeyim Project offshore LNG terminal. 1 Historic wreck of the vessel Karrakatta lies 1 mile
For information regarding associated restricted areas N of Swan Point. See 1.82.
see 6.119. Australian Notice 23/981(P)/23
[NP13--No 76--Wk 51/23]
French Notice 32/22; Instructions nautiques C4
[NP1--No 120--Wk 51/23]
Western Australia -- King Sound --
Channel south of Alarm Shoal —
Directions; wreck
NP5 South America Pilot Volume 1 (2021 Edition)
202

Brazil -- Rio Amazonas -- Porto de Santana to Paragraph 5.132 3 lines 6--10 Replace by:
Ponta do Jariubá — Directions; obstruction
...1225780E) of Alarm Shoal, thence:
NNW of an historic wreck (162047S 1230249E)
87
(5.113).
After Paragraph 3.74 4 line 5 Insert: Alternative leading mark for the E end of this
channel:
NW of two areas of obstructions, centred on Line of bearing 050 of SE Twin Island (161758S
positions 03250S 512864W and 03477S 1230551E).
513102W, thence:
Australian Notice 23/981(P)/23
Brazilian Notice 13/149/22 [NP5--No 51--Wk 51/23] [NP13--No 77--Wk 51/23]

4.3 Wk51/23
IV

NP19 Baltic Pilot Volume 2 (2022 Edition) 7 Berths No 107 to 122 (553976N 210897E) are
for general cargo and fishing vessels. The quay is
600 m long, with depths alongside of about 4 to 11 m.

Lithuania – Baltic Sea – KlaipÌda — ENC LT660710 (27.001) [NP19--No 84--Wk 51/23]
Basins and berths
NP21 Bay of Bengal Pilot (2019 Edition)
380
Bangladesh -- Chattogram Coast --
Paragraph 10.39 including existing Section IV Notice Matarbari Island — Anchorage; pipelines
Week 46/22 Replace by:
123
1 Berths No 1 to 3 (554358N 210573E), are the Paragraph 4.62 including existing Section IV Notice Week
oil terminal berths with depths alongside of around 13 12/21 Replace by:
to 14 m. An unnamed berth (2022) lies close W of
1 Entry is prohibited into an area of 1300 m radius
Berth No 1 with depths alongside from about 12 to
surrounding the FSRU (Floating Storage Regasification
17 m. A submerged training wall, marked by light
Unit) (213207N 914912E) and an area of 1 300 m
beacons (special), extends 60 m W.
radius surrounding the FPSO (213334N 914897E)
Berths No 4 to 18 lie on Commercial Port Quay
forming the Moheshkhali LNG terminal.
(554301N 210679E) and the N part of Winter
Entry is prohibited into an area of 500 m radius
Harbour. Depths range from about 7 to 15 m. These
surrounding a SPM (213765N 914709E), SW of
berths are equipped to handle general and bulk cargo.
Matarbari Island (4.72a).
2 Berths No 19 to 26 (554250N 210728E),
2 Anchoring is prohibited within 3 cables of the
comprise the SW part of Winter Harbour and Ship
submarine pipeline running between the FSRU and
Repair Yard Basin. A 9 m wide floating pier extends
Maiskhali Island, and within a 500 m protection zone
SW from the root of the S pier. Ship Repair Yard
surrounding pipelines which connect the SPM,
Basin has numerous metal obstructions on the quays
Matarbari Island and a point on the shore 2½ miles N
which make approach difficult. Depth in Ship Repair
of the mouth of Sangu River (220500N 915050E).
Yard Basin is about 5 m.
3 River DanÌ (554237N 210741E) flows through BNHOC Notice 26/22 [NP21--No 66--Wk 51/23]
the city and enters Jør Kanalas about 2 miles SE of
the main harbour entrance. It is navigable from its Bangladesh -- Chattogram Coast -- Chattogram
mouth to the road bridge, 2½ cables upstream, and — Anchorage
has depths of less than 5 m. The width of the fairway
is 32 to 35 m. There are quays on both sides of the 125
river with depths from 25 to 40 m alongside. Paragraph 4.81 1 including existing Section IV Notice
4 Berths No 28 to 33 (554224N 210738E), are Week 31/23 Replace by:
occupied by a cruise and Naval vessel terminal. Depth
alongside is about 9 m. 1 The outer port area is divided into three anchorage
Berths No 34 to 45, in the N part of the basin, areas. Anchorage A (221620N 914380E), for
constitute the small boat harbour. vessels over 100 m draught, has 31 designated
Berths No 59 to 65 (554205N 210761E), are anchorage berths. Anchorage B (221300N
used for shipbuilding. A slip and two floating docks, 914280E) is for vessels entering the port within
with lengths of about 65 m, are situated within the 24 hours, and Anchorage C (220890N 914620E) is
basin. dedicated to vessels lightering and other vessels not
5 Berths No 66A to 72 (554162N 210803E), scheduled to enter the port within 24 hours.
consist of river alongside berths, with depths from
about 12 to 14 m, and two piers: UKHO [NP21--No 67--Wk 51/23]
The N--most pier projects WSW from the bank and
contains Berths 66A, depth about 14 m alongside, Bangladesh -- Chattogram Coast -- Chattogram
and 67A depth about 13 m. — Traffic regulations; prohibited anchorage
The S--most pier projects W from the bank and
125
contains Berths 71 and 72. It is 220 m in length
and 16 m wide, with depths alongside of about After Paragraph 4.83 Insert:
12 m, and a maximum draught of 115 m.
6 These berths specialize in handling bulk cement Traffic regulations
and fertiliser. 4.83a
Berths No 80 to 106 (554069N 210856E), 1 Prohibited anchorage. Anchoring is prohibited in
provide about 2800 m of berthing space for containers the approach to Karnaphuli River; the prohibited area
and general cargo. The largest are berths 101 to 106, lies between Anchorages B and C. Anchoring is also
with depths alongside of 145 to 148 m. Berths 105 prohibited inshore of the outer anchorage areas.
and 106 are for frozen cargo. Anchorage is prohibited within the vicinity of nearby
Berths 80A and 81A are RoRo berths, projecting pipelines; see 4.44 and 4.62.
NW into the channel, with depths alongside of about
12 m. BNHOC Notice 26/22; UKHO [NP21--No 68--Wk 51/23]

Wk51/23 4.4
IV

NP22 Bay of Biscay Pilot (2019 Edition) NP28 Dover Strait Pilot (2020 Edition)

France -- West coast -- Approaches to


Baie de Saint--Jean--de--Luz -- England -- River Thames -- Sea Reach to
Passe de Belhara Perdun — Directions; wreck Richmond — Traffic regulations; speed limit
216
301
After Paragraph 8.236 1 line 5 Insert:
N of a dangerous wreck (432410N 14544W), Paragraph 14.6 2--3 Replace by:
position approximate, thence:
2 Speed. Vessels are to be navigated at all times at
UKHO [NP22--No 118--Wk 51/23] a speed commensurate with local circumstances and
conditions. Unless an exception or special certificate
Spain -- North coast -- Cabo San Sebastián to of compliance is issued by the Harbour Master, the
Cabo Burela — Directions; light following speed limits apply:
3 From Margaret Ness (513053N 00552E)
275 (14.73) to Wandsworth Bridge (512790N
01127W) (14.107) — 12 kn.
Paragraph 11.81 1 line 7 For 70 m SSW Read 55 m SE Above Wandsworth Bridge and in the various
navigable creeks (14.11) entering the River
Paragraph 11.81 1 line 9 For ¾ cable Read 2½ cables Thames — 8 kn.
4 Care is to be taken to avoid damaging wash and
draw off when passing vessels at a berth closely
UKHO [NP22--No 119--Wk 51/23]
adjacent to the navigational channel, particularly where
those vessels are handling dangerous goods and
Spain -- North coast -- Ría de Ribadeo — displaying a red flag by day or a red light by night. In
Directions for entering harbour; light the case of dangerous cargo or other operations,
further speed reductions may be required.
276 5 Authorised special requests for further speed
Paragraph 11.89 1--2 Replace by: reductions by vessels, installations, works or other
activities are indicated by flag signal Romeo Yankee,
1 Landmarks: which must be illuminated at night.
Isla Pancha Lighthouse (433339N 70252W) 6 Oil and gas jetty exclusion zones. Except in the
with old lighthouse 55 m SE (11.81). case of vessels berthing at an adjacent jetty, all
Masonry cross (more than 8 m in height), illuminated vessels, including fishing boats, must keep a minimum
at night, on the Ermita de Santa Cruz chapel distance of 60 m away from oil and gas jetties and the
(433164N 70373W). A white water tower vessels berthed alongside them.
(uncharted) stands close N. Anchoring. See 10.15.
2 Capilla de San Román (square tower 12 m in
height) (433252N 70173W).
Torres Moreno (433219N 70237W), the tallest UKHO [NP28--No 78--Wk 51/23]
building in Ribadeo, whose domes are covered in
red glazed tiles that reflect the sun (uncharted).
Major lights:
England -- River Thames -- Barking Reach —
Isla de Tapia Light (33447N 65676W) (11.65) Directions
Isla Pancha Light — as above.

UKHO [NP22--No 120--Wk 51/23] 312

Paragraph 14.73 7 Replace by:


NP24 Black Sea and Sea of Azov Pilot
(2019 Edition) 7 Barking Reach leads 1½ miles W from Cross Ness
(513079N 00772E) to Margaret Ness (513053N
00552E) or Tripcock Point on which stands Margaret
Turkey -- Marmara Denizi -- YarÝmca— Ness or Tripcock Point Light (red metal framework
Tütünçiftlik industrial complex — Restricted area
tower, 9 m in height) (513053N 00552E). Margaret
99 Ness is also the E limit of the Thames Barrier Control
Zone (14.79). Barking Creek (513111N 00568E)
Paragraph 2.252 2 lines 1--3 Replace by: (14.74) enters the Thames from the N bank of the
reach NE of Margaret Ness. Barking Point or False
2 Restricted area. Entry into the area surrounding all
Point (513085N 00647E) lies E of the entrance to
terminals (2.253) is prohibited without the permission the creek.
of the ™zmit Port Authority.

ENC TR400291 (17.000) [NP24--No 90--Wk 51/23] UKHO [NP28--No 79--Wk 51/23]

4.5 Wk51/23
IV

NP40 Irish Coast Pilot (2019 Edition) France -- South coast -- Golfe Juan —
Regulations; buoys

112
Ireland -- West coast --
Bearhaven and Castletownbere Harbour — After Paragraph 3.96 1 line 5 Insert:
Arrival information; pilotage
Seasonal restricted areas are established around
70 mooring buoys in the vicinity of 433360N 70607E.
When in use, the mooring of vessels under 24 m in
Paragraph 3.73 Replace by: length and of fishing gear is prohibited; diving is
permanently prohibited.
1 Pilotage for Castletownbere is compulsory for
non -- fishing vessels over 50 m LOA but is French Notice 30/Instructions nautiques D22/22
recommended for all vessels over 40 m LOA as local [NP46--No 48--Wk 51/23]
knowledge is required. The pilot boards in Bearhaven
(3.64). For further details, see 3.32 and ADMIRALTY France -- Corse -- Pointe de Senetosa to
List of Radio Signals Volume 6(1). Cap de Feno -- Baie de Figari — Anchorage

Corr. Castletown Harbour Master 27/04/23 196


[NP40--No 68--Wk 51/23]
Paragraph 6.161 3 Replace by:
3 Anchorage (see also 1.58) may be obtained within
a designated area (412657N 90333E), by vessels
NP45 Mediterranean Pilot Volume 1 of 80 m LOA or greater. A designated anchorage area
(2021 Edition) (412581N 90523E) is situated within the entrance
of Golfe de Ventilegne.
Caution. Mariners should exercise caution, as Baie
Algeria -- Oued Kiss to Îles Habibas -- Ghazaouet de Figari is a seaplane operating area. See 6.126.
— Limiting conditions; depth
ENC FR470240 (5.000) [NP46--No 49--Wk 51/23]
217

Paragraph 6.18 Replace by: NP50 Newfoundland and Labrador Pilot


(2016 Edition)
1 Depths. The access channel has a least charted
depth of 97 m. Contact the local authorities for the
latest depth information. Canada -- Newfoundland -- Conception Bay --
Holyrood Harbour — Pilotage
French Notice 30/22; Instructions nautiques D6 240
[NP45--No 127--Wk 51/23]
Paragraph 7.73 1 lines 4--6 Replace by:
Pilotage is compulsory for merchant vessels. The
NP46 Mediterranean Pilot Volume 2 pilot boards in position 472965N 530635W.
(2022 Edition)
Canadian Eastern Notices 7/4847, 4848/22
[NP50--No 33--Wk 51/23]
France -- South coast -- Golfe de la Napoule —
Regulations; buoys
NP61 Pacific Islands Pilot Volume 2
109
(2017 Edition)

After Paragraph 3.79 1 line 3 Insert: Nouvelle--Calédonie -- South coast --


Passe de Uitoé to Nouméa — Pilotage
Seasonal restricted areas are established around
mooring buoys as follows: 85
At 433163N 70263E; radius 120 m;
At 433127N 70407E; radius 120 m; After Paragraph 2.123 Insert:
At 433083N 70365E; radius 50 m;
At 433090N 70211E; radius 50 m. Pilotage
When in use, the mooring of vessels under 24 m in 2.123a
length and of fishing gear is prohibited; diving is 1 Pilots board by helicopter in position 220995S
permanently prohibited. 1660403E. For details see 2.4 and ADMIRALTY List
of Radio Signals Volume 6(4).
French Notice 30/Instructions nautiques D22/22
[NP46--No 47--Wk 51/23] French Notice 31/4(P)/22 [NP61--No 85--Wk 51/23]

Wk51/23 4.6
IV

Nouvelle--Calédonie -- Passe de Uitoé to NP62 Pacific Islands Pilot Volume 3


Récifs D’Entrecasteaux — Pilotage (2020 Edition)
91
French Polynesia -- Îles de la Société -- Tahiti --
Paragraph 3.5 1 line 5 Replace by: Papeete -- Bassin de Taunoa — Restricted area
...(2.103), Passe Deverd (3.94) and Passe de la Gazelle 164
(3.99).
Paragraph 6.159 1--3 including existing Section IV Notice
French Notice 31/4(P)/22 [NP61--No 86--Wk 51/23] Week 02/20 Replace by:
1 Description. Bassin de Taunoa (173140S
Nouvelle--Calédonie -- West coast -- Bourail to 1493300W) lies between Pointe Iriti (173135S
Passe de Muéo -- Port de Muéo — 1493257W) and Taunoa village 8 cables WSW. An
Arrival information; pilotage area, marked by beacons and light beacons, in which
fishing is prohibited has been established in Bassin de
98 Taunoa, NNW of the village of Taaone.
Local knowledge is required.
Paragraph 3.56 1 line 6 Replace by: Restricted area. Anchoring and fishing are
...length with black hull and white superstructure. The pilot prohibited within Bassin de Taunoa.
boards in position 212500S 1645500E and, for 2 Directions. The basin is approached from N and
tankers, in position 212552S 1645416E. entered through Passe de Taunoa (173120S
1493310W) (6.155). The basin may also be entered
French Notice 31/4(P)/22; ENC FR473750 (2.013) through a marked channel from Bassin de Papaoa
[NP61--No 87--Wk 51/23] (6.158).
Landing. Landing places in the basin are unusable
in strong NW winds.
Nouvelle--Calédonie -- Passe de la Gazelle —
Pilotage French Notice 33/22; Instructions nautiques K11
[NP62--No 33--Wk 51/23]
104

Paragraph 3.99 2 lines 1--4 Replace by:


NP67 West Coasts of Spain and Portugal Pilot
2 Pilotage is compulsory and available in daylight (2021 Edition)
only. Pilots board by helicopter in position 202456S
1635531E. For details see 3.5 and ADMIRALTY List
Portugal -- Rio Douro to Cabo Carvoeiro --
of Radio Signals Volume 6(4). Porto de Aveiro —
Directions for entering harbour; leading lights
French Notice 31/4(P)/22 [NP61--No 88--Wk 51/23]
127
Nouvelle--Calédonie -- East coast -- Paragraph 5.110 3 lines 6--7 Replace by:
Passe de Thio — Pilotage
The track then continues to a position about
129 2¼ cables from the front light.

Paragraph 4.69 2 Replace by: Paragraph 5.111 1--2 Replace by:


1 Leading lights:
2 Pilotage is compulsory for passage through Passe
Front light: Triângulo Oeste Light (green tower, red
de Thio. Pilots board by helicopter in position
bands, 4 m in height) (403870N 84457W).
213044S 1661991E. For details see 4.4 and
Rear light: Forte da Barra Light (white tower, 19 m in
ADMIRALTY List of Radio Signals Volume 6(4).
height) (403870N 84397W) (4½ cables from
front light).
French Notice 31/4(P)/22 [NP61--No 89--Wk 51/23] The alignment (0895) of these lights leads E
through Canal da Embocadura for about 4 cables.
2 Thence, Canal Principal, leads NE for about 1 mile
Nouvelle--Calédonie -- East coast -- Port de Thio
— Arrival information; pilotage to the vicinity of Monte Farinha Light (green tower, red
band, 4 m in height) (403948N 84350W) passing:
130 NW of the entrance to Doça de Serviços (403883N
84410W). Triângulo Norte Light (white round
Paragraph 4.73 1 lines 3--4 Replace by: tower, green bands, 4 m in height) is exhibited
from the S side of the entrance and Praia do Porto
...Pilots board at Canal de la Havannah (2.50), Passe de Light (green round tower, red band, 4 m in height)
Thio (4.69) and Passes Ouest de Houaïlou (4.121). from the N side of the entrance, thence:

French Notice 31/4(P)/22 [NP61--No 90--Wk 51/23] UKHO [NP67--No 48--Wk 51/23]

4.7 Wk51/23
IV

Arquipélago dos Açores -- Ilha Terceira -- Arquipélago dos Açores -- Canal Do Faial --
Porto de Angra do Heroísmo — Berth Areia Larga — Anchorage

240
233
Paragraph 8.156 Replace by:
Paragraph 8.108 including heading Replace by: 1 Anchorage may be obtained off Areia Larga, an
inlet in which there is a small shipyard, situated
6½ cables SE of Ilhéus da Madalena (8.146). The
Basins and berths anchorage is in a depth of about 29 m, fine sand, on
8.108 the alignment (018) of the E extremity of Ilhéu
1 Porto Pipas. The mole can accommodate vessels Deitado with Ilhéu em Pé (5¼ cables farther NNE)
up to 115 m LOA and 65 m draught. and on the alignment (0822) of a pair of leading
lights (383163N 283217W) at the shipyard.

UKHO [NP67--No 47--Wk 51/23] UKHO [NP67--No 46--Wk 51/23]

Wk51/23 4.8
V

UPDATES TO ADMIRALTY LIST OF LIGHTS AND FOG SIGNALS

NP74, Vol A Edition 2023. Weekly Edition No. 51, Dated 21 December 2023.
Last Updates: Weekly Edition No. 50, dated 14 December 2023.

WEST COAST. MORECAMBE BAY. FLEETWOOD


A4892 - Esplanade. Lts in line 156°. 53 55·72 N Iso W 2s 14 9 Stone tower Vis 1·5° each side of bearing.
Front 3 00·55 W 12 Shown 24 hours. Channel liable to
(GB:ABP) change
* *

A4892·1 - Esplanade. Lts in line 156°. 53 55·59 N Iso W 4s 28 9 Stone tower Vis 1·5° each side of bearing.
Rear. 320m from front 3 00·46 W 25 Shown 24 hours. Channel liable to
(GB:ABP) change
* *

A4911 - Dock Channel. W Jetty 53 55·16 N 2 F G(vert) 6 2 Black pile 2m apart.


(GB:ABP) 3 00·53 W TE 2023
*

A5285 - Middle Channel Rock 51 40·31 N Fl(3)G 7s 18 8 Black round metal (fl 0·1, ec 1·6) x 2, fl 0·1, ec 3·5
5 09·83 W tower, aluminium
lantern
*

HOLLANDSE KUST NOORD WINDFARM


A7484·405 - HNH4 52 42·71 N Mo(U)Y 15s .. 5 Wind turbine ..
(NL) 4 11·53 E
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. AIS .. .. .. MMSI No 992441113
* * * * * * * *

A7484·408 - HNI4 52 40·34 N Mo(U)Y 15s .. 5 Wind turbine ..


(NL) 4 09·84 E
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. AIS .. .. .. MMSI No 992441114
* * * * * * * *

A7484·409 - HNJ6 52 38·55 N Mo(U)Y 15s .. 5 Wind turbine ..


(NL) 4 08·63 E
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. AIS .. .. .. MMSI No 992441116
* * * * * * * *

A7484·41 - HNF4 52 44·90 N Mo(U)Y 15s .. 5 Wind turbine ..


(NL) 4 14·23 E
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. AIS .. .. .. MMSI No 992441112
* * * * * * * *

HELDER FIELD
A7484·42 - HND6 52 46·87 N Mo(U)Y 15s .. 5 Wind turbine ..
(NL) 4 16·64 E
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. AIS .. .. .. MMSI No 992441111
* * * * * * * *

HOLLANDSE KUST NOORD WINDFARM


A7484·43 - HNC6 52 47·19 N Mo(U)Y 15s .. 5 Wind turbine ..
(NL) 4 18·66 E
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. AIS .. .. .. MMSI No 992441110
* * * * * * * *

5.1 Wk51/23
V

NP74, Vol A Edition 2023 continued.

A7484·45 - HNB4 52 44·71 N Mo(U)Y 15s .. 5 Wind turbine ..


(NL) 4 21·54 E
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. AIS .. .. .. MMSI No 992441109
* * * * * * * *

HOLLANDSE KUST NOORD


A7484·5 - HNA4 52 42·76 N Mo(U)Y 15s 5 . . Wind turbine ..
(NL) 4 21·46 E
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. AIS .. .. .. MMSI No 992441108
* * * * * * * *

HOLLANDSE KUST NOORD WINDFARM


A7497 - HNL2 52 39·72 N Mo(U)Y 15s .. 5 Wind turbine ..
(NL) 4 17·41 E
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. AIS .. .. .. MMSI No 992441117
* * * * * * * *

A7503 - HNL3 52 39·02 N Mo(U)Y 15s .. 5 Wind turbine ..


(NL) 4 17·06 E
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. AIS .. .. .. MMSI No 992441118
* * * * * * * *

A7506 - HNL6 52 38·87 N Mo(U)Y 15s .. 5 Wind turbine ..


(NL) 4 14·07 E
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. AIS .. .. .. MMSI No 992441119
* * * * * * * *

A7509 - HNJ1 52 41·11 N Mo(U)Y 15s .. 5 Wind turbine ..


(NL) 4 16·15 E
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. AIS .. .. .. MMSI No 992441115
* * * * * * * *

WINTERSHALL FIELD
A7581·85 - Vlielend North TSS. 53 34·87 N Mo(U)W 15s .. 15 Platform ..
NL, HP2, 2685·0 Westward. L8-G 4 36·24 E
(NL)
---- .. 2FR .. .. .. ..
---- .. Horn Mo(U) .. .. .. ..
30s
---- .. AIS .. .. .. MMSI No 992456970
*

A7581·86 - Vlielend North TSS. 53 36·88 N Lit .. 15 Platform ..


Eastward. L9-FF-1 4 57·62 E
(NL)
---- .. AIS .. .. .. MMSI No 992441070
*

5.2 Wk51/23
V

NP75, Vol B Edition 2023. Weekly Edition No. 51, Dated 21 December 2023.
Last Updates: Weekly Edition No. 50, dated 14 December 2023.

B0107·1 - Entrance Channel. Ldg 51 13·63 N Iso W 4s 48 18 × on red metal mast, W068°-218°(150°).
BE, , 0444 Lts 143°. Rear 2 56·09 E white bands Unreliable (T) 2023
*

B0145 Westhinder. MOW 7. SW 51 23·31 N Fl(4)W 30s 22 12 Red post with small (fl 0·5, ec 0·5) x 3, fl 0·5, ec 26·5.
BE, , 0028 Side of Bank 2 26·27 E hut marked LED
WESTHINDER
--- .. Horn Mo(U) .. .. .. ..
30s
--- .. Racon .. .. .. ALRS Vol 2 Station 54000
*

BORSSELE WINDFARM
B0148·035 - B413 51 44·57 N Mo(U)Y 15s 17 5 Wind turbine ..
2 46·48 E
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. AIS .. .. .. MMSI No 992441147
* * * * * * * *

BORSSELE WINDFARM
B0149·395 - BJ8 51 34·50 N Mo(U)Y 15s 17 5 Wind turbine ..
3 03·77 E
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. AIS .. .. .. MMSI No 992441144
* * * * * * * *

BORSSELE WINDFARM
B0149·48 - B417 51 45·46 N Mo(U)Y 15s 17 5 Wind turbine ..
2 51·19 E
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. AIS .. .. .. MMSI No 992441146
* * * * * * * *

B0149·49 - B104 51 45·91 N Mo(U)Y 15s 17 5 Wind turbine ..


2 53·31 E
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. AIS .. .. .. MMSI No 992441145
* * * * * * * *

B0149·8 - BC7 51 47·98 N Mo(U)Y 15s 17 5 Wind turbine ..


3 03·77 E
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. AIS .. .. .. MMSI No 992441139
* * * * * * * *

B0151 - BF8 51 41·72 N Mo(U)Y 15s 17 5 Wind turbine ..


3 07·65 E
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. AIS .. .. .. MMSI No 992441141
* * * * * * * *

B0151·5 - BG5 51 40·29 N Mo(U)Y 15s 17 5 Wind turbine ..


3 07·25 E
-- .. Horn Mo(U) .. .. .. ..
30s
-- .. AIS .. .. .. MMSI No 992441142
* * * * * * * *

B0252·63 - Ldg Lts 009·7°. Front 51 14·43 N Oc G 5s 4 . . White mast ..


NL, HP2, 0128·5 3 48·64 E 5
*

5.3 Wk51/23
V

NP75, Vol B Edition 2023 continued.

B0252·631 - Ldg Lts 009·7°. Rear. 156m 51 14·51 N Oc G 5s 8 . . Mast ..


NL, HP2, 0128·6 from front 3 48·66 E 5
*

B0319·9 - Nauw van Bath. Ldg Lts 51 24·01 N Iso WR 3s 9 W 6 Red post, white band R248°-279°(31°), W279°-248°(329°)
NL, HP2, 0220 044°. Front. Middenketel 4 11·20 E R 4 10
* *

B0439·1 - Bergen op Zoom. 51 29·64 N Oc W 5s 8 . . Black daymark, white ec 2


NL, HP2, 0822 Molenplaat. Ldg Lts 119·5°. 4 13·89 E band on grey
Rear. 332m from front structure
5
*

B0646·41 - Kleine Beerkanaal. NW 51 58·54 N 2FR 5 . . White and red ..


NL, HP2, 1007·1 End 4 04·36 E daymark on grey post
with platform
*

B0650·2 - Beneluxhaven. S Side 51 56·58 N Iso WRG 2s 14 . . Red and white G178·1°-179·3°(1·2°),
NL, HP2, 1018·5 4 07·78 E chequered pedestal W179·3°-180·7°(1·4°),
R180·7°-182·3°(1·6°)
*

B0686·4 - Eemhaven. Prins Johan 51 53·30 N QW 2 . . Post ..


NL, HP2, 1112 Frisohaven. Entrance. N Side 4 24·30 E 3
*

B0688·5 - Heysehaven. W Side 51 53·87 N FG 4 . . Green post, white ..


NL, HP2, 1121 4 24·66 E bands
* * * * * * * *

B0688·8 - Heysehaven. E Side 51 53·90 N FR 4 . . Red post, white bands . .


NL, HP2, 1122 4 24·77 E
* * * * * * * *

B0725·5 - Uilenvlietse Haven 51 49·75 N Iso WRG 4s 3 W 5 Mast G090°-109°(19°), W109°-117°(8°),


NL, HP2, 1206 4 33·45 E R 5 R117°-139°(22°)
G 5
* * *

B0908·2 - West Terschelling. W Side 53 21·38 N Fl Y 10s .. . . Mooring post ..


NL, HP2, 2099·6 5 12·92 E
*

NP76, Vol C Edition 2023. Weekly Edition No. 51, Dated 21 December 2023.
Last Updates: Weekly Edition No. 50, dated 14 December 2023.

C3328 Renumbered; was previously C3334


LT, , 0049
Juodkrante 55 33·39 N LFl W 8s 75 18 White U on black fl 3.
21 06·95 E square metal Storm Signal
framework tower
with platform
20
*

C3334 Remove from list; renumbered to C3328

5.4 Wk51/23
V

NP76, Vol C Edition 2023 continued.

C6694·4 - Kalvö Hampetorp. Ldg Lts 59 27·52 N Iso WRG 3s 4 W 5 White lantern, red G073°-080°(7°), W080°-081·8°(1·8°),
081°. Front. Gliparna 16 11·25 E R 4 band on white base R081·8°-163°(81·2°)
G 3
* * *

NP77, Vol D Edition 2023. Weekly Edition No. 51, Dated 21 December 2023.
Last Updates: Weekly Edition No. 50, dated 14 December 2023.

D1488·3 - Bridge. N Side 43 17·00 N QR 4 3 White and red panel TE 2023


ES, I, 00296 2 07·90 W on Bridge pillar
*

D1652·5 - Puerto de Vega. W 43 34·07 N Fl G 5s 11 5 Green column fl 0·5.


ES, I, 02610 Breakwater. Head 6 38·82 W 3 TE 2023
*

D1678 - Dir Lt 196° 43 41·76 N Dir WR 1s 9 5 Red , on white Q R178°-194°(16°) over Los
ES, I, 02880 7 26·52 W tower Farallones.
8 Q W194°-about 198°(4°).
TE 2023
*

D1813 - Puerto O Grove. S 42 29·74 N VQ(3)W 5s 4 3 * on black beacon, ..


ES, I, 04501 Breakwater. Head 8 51·46 W yellow band
3
* * * *

D1831·58 - Puerto de Cabo Cruz 42 37·02 N Fl(2)W 7s .. 1 Black # on black fl 0·5, ec 1·5, fl 0·5, ec 4·5.
ES, I, 04306·10 8 53·34 W pillar, red bands TE; reported missing (T) 2023
*

D1862 - Río Lerez. Pontevedra. 42 24·86 N Fl R 5s 6 5 White and red square fl 0·5.
ES, I, 04670 Entrance. N Training Wall. 8 41·46 W tower on corner of TE; reported missing (T) 2023
Head building
*

D1893 - Canido. Ldg Lts 116·9°. 42 11·70 N QG 10 5 Green and white Irreg (T) 2023
ES, I, 05180 Front. Breakwater. Wharf. 8 48·06 W tower
Head 7
*

D1895·4 - Puerto de Cangas. Inner 42 15·63 N Fl(2+1)R 15s .. 1 Red lantern fl 0·5, ec 1·5, fl 0·5, ec 4·5, fl 0·5, ec
ES, I, 04850 Breakwater. Wharf. Head 8 46·95 W 7·5.
2m below top of Breakwater.
TE 2023
*

D2349·13 - Faginado. No 2. Dir Lt 36 49·77 N Dir W 4s 3 3 Red and white post Iso W326·8°-329·2°(2·4°).
ES, I, 09425 328° 6 21·39 W Shown 24 hours.
ES, I, 09426 TE 2023
--- .. Fl(2)R 7s 3 3 .. fl 0·5, ec 1·5, fl 0·5, ec 4·5
*

D2807·41 - Aerogenerador 28 02·50 N 2 Mo(U)W 15s 13 10 Wind turbine on TE 2023


ES, I, 12438·4 15 23·53 W yellow tower
83
-- .. 2FR 15 .. .. ..
-- .. Aero F R 83 .. .. Obstruction
*

5.5 Wk51/23
V

NP77, Vol D Edition 2023 continued.

D2814 - Punta Morro Colchas. 27 44·12 N Oc(2)W 10s 59 18 Brown truncated ec 1·5, lt 1·5, ec 1·5, lt 5·5.
ES, I, 12520 Maspalomas 15 35·92 W conical tower W251·5°-093°(201·5°)
56
*

ISLA DE TENERIFE
D2822·36 Remove from list; deleted

D2822·4 - Santa Cruz de Tenerife. 28 28·62 N Fl(3)G 9s 5 1 Green truncated (fl 0·5, ec 1·5) x 2, fl 0·5, ec 4·5
ES, I, 12700 Club Náutico. Muelle N. 16 14·48 W pyramidal tower
Head 2
* *

D2831·7 - Masca Beach. Jetty. Head 28 17·34 N Fl Y 5s 5 3 Yellow × on yellow ..


ES, I, 12918 16 51·78 W round column
5
* * * * * * * *

D2844·3 - Puerto de San Sebastián. 28 05·26 N Q(3)W 10s .. 3 * on black truncated . .


ES, I, 12960 Roque La Hila. Outer 17 06·36 W pyramid, yellow band
Breakwater. Extension. Head
*

D6686 - Minazi Mikinda. Ldg Lts 6 49·19 S QW .. 9 Yellow GRP tower, Light to be moved which will
205°. Front 39 18·46 E black bands change leading line to 202.8º (P)
11 2023
*

D7298·406 Umm Lajj. YA1/64 24 59·38 N Q(9)W 15s .. . . $ on yellow beacon, ..


36 56·92 E black band
* * * * * * * *

D7298·4071 Umm Lajj. 3 24 56·00 N Q(6)+LFl W .. . . " on black beacon, ..


37 04·58 E 15s yellow top
* * * * * * * *

D7298·4072 Umm Lajj. 1 24 59·04 N QW .. . . ) on yellow beacon, ..


37 12·62 E black top
* * * * * * * *

D7298·409 Umm Lajj. YA2/65 24 51·50 N Q(9)W 15s .. . . $ on yellow beacon, ..


36 59·90 E black band
* * * * * * * *

NP78, Vol E Edition 2023. Weekly Edition No. 51, Dated 21 December 2023.
Last Updates: Weekly Edition No. 50, dated 14 December 2023.

MAR MENOR
E0140·3 Remove from list; deleted

E0318·3 - Darsena de Porto Pi. Dique 39 33·02 N VQ(3)W 5s 16 5 * on black tower, W180°-047°(227°)
ES, II, 34530 del Oeste. Outer Elbow 2 38·35 E yellow band
ES, II, 34531 10
---- .. Siren Mo(P) .. .. .. bl 2, (si 2, bl 6) x 2, si 2, bl 2, si 8
30s
*

5.6 Wk51/23
V

NP78, Vol E Edition 2023 continued.

E0339 - Puerto de Cabrera. Wharf. 39 09·03 N Fl(2)R 10·5s 5 5 Red round tower on fl 0·5, ec 2·2, fl 0·5, ec 7·3.
ES, II, 35690 Head 2 55·99 E white base TE 2023
4
*

E0361·65 - Dir Lt 322·85° 39 53·41 N Dir WRG 4s 9 3 White house Iso G322°-322·6°(0·6°).
ES, II, 35960 4 17·23 E 8 Iso W322·6°-323·1°(0·5°).
Iso R323·1°-323·7°(0·6°).
Area of preferred use from Punta del
Lazareto Seawards.
TE 2023
-- .. AIS .. .. .. MMSI No 992241077
*

E0374·1 - Sant Carles de la Rápita. 40 36·93 N QG 2 1 Green post on round TE 2023


ES, II, 27895 Dársena Este. Harbour 0 36·21 E green base
Breakwater. Head 2
----- .. AIS .. .. .. MMSI No 992241151
*

E0380·2 - Barge No 2 40 46·57 N Q W 1s 3 1 ) on yellow post, ..


ES, II, 28306 0 44·30 E black top
2
*

E0489·32 Llansá. Breakwater. S Head 42 22·41 N Q(3)W 10s .. 3 * on black beacon, ..


ES, II, 31799 3 09·98 E yellow band
*

E2613·2 - Koper. Signal Station 45 33·61 N Fl Y 2s 10 2 Blue and grey pole fl 0·5
SI, , 1421 (Weather) 13 43·91 E 10
--- .. AIS .. .. .. MMSI No 992786104
* * * * * * * *

E6483·2 El Kala (La Calle) 36 53·90 N FW 17 10 . . Moiré pattern


DZ, , 4301A 8 26·32 E
FR, L2, 07400
*

E6483·3 El Kala (La Calle). Pointe 36 54·06 N Mo(N)R 5s 10 8 .. PA


DZ, , 4300A des Carrieres. S Breakwater. 8 25·55 E
Head
*

E6642·5 Port Cherchell. Spur. Jetty 36 36·87 N Oc(2)R 6s .. 6·5 . . Supervised.


DZ, , 2103A 2 11·55 E 13 TE 2023
*

E6649 Port de Ténès. Outer 36 31·70 N Iso G 4s 10 10 White round tower ..


DZ, , 2103 Breakwater. E Head 1 19·11 E 4
*

E6658 Cap Ivi (Ras Ouillis) 36 06·78 N Fl W 5s 118 28 Yellow 8-sided tower W064°-047°(343°).
DZ, , 1800 0 13·60 E on red dwelling Obscured 047°-064°(17°).
18 F W (T) 2023
*

E6708 Ras Falcon 35 46·24 N Fl(4)W 25s 104 29 White 8-sided stone (fl 0·2, ec 2·9) x 3, fl 0·2, ec 15·5.
DZ, , 1400 0 48·04 W tower, with building F R on Radio Masts 5·2M to the S
FR, L2, 10220 27
*

5.7 Wk51/23
V

NP79, Vol F Edition 2023. Weekly Edition No. 51, Dated 21 December 2023.
Last Updates: Weekly Edition No. 50, dated 14 December 2023.

PAULA PINANG
F1486 - Muka Head. Summit 5 28·34 N Fl W 10s 242 25 White granite tower fl 0·3
100 10·83 E 14
*

F1643 Melaka. Kesang 2 05·57 N Fl R 5s 10 5 4-sided metal ..


102 29·03 E framework tower, on
pile
*

F2538 - Sorsogon Bay. Bagatao 12 50·17 N Fl R 6s 13 7 Concrete tower ..


PH, , 0098 Island. NW Point 123 47·50 E 10
(PH:CG)
* *

F2645·8 - Cavite City. Cañacao Bay. 14 29·53 N Fl(2)R 3s 11 .. .. ..


San Antonio 120 54·32 E
(PH:CG)
*

F2728·5 - Cagayan River. Entrance. 18 21·67 N Fl W 5s 11 8 GRP ..


PH, , 0010 Aparri 121 37·79 E
* * *

F2728·8 - Cagayan. Baguey 18 17·35 N Fl R 5s .. .. .. ..


121 50·18 E
* *

F2729 - Port Casambalangan 18 24·04 N Fl G 5s 10 10 Concrete structure ..


PH, , 0009 (PH:CG) 122 07·52 E
*

F2730·5 - Port San Vicente. Palawig 18 28·02 N Fl W 5s 10 8 White concrete ..


PH, , 0008 (PH:CG) 122 08·61 E structure
* * *

F2789 - Bote. Locot Bay 13 33·57 N Fl(2)W 10s 12 18 White concrete tower . .
PH, , 0824 (PH:CG) 124 19·53 E 12
* *

NP82, Vol J Edition 2023. Weekly Edition No. 51, Dated 21 December 2023.
Last Updates: Weekly Edition No. 50, dated 14 December 2023.

J6879·24 - Wijdenbosch Bridge. NE 5 48·50 N Fl G 4s .. .. .. TE; replaced by light buoy Fl Y 4s


SR, 2218, WB·NE Side 55 09·68 W close NE (T) 2023
*

NP83, Vol K Edition 2023. Weekly Edition No. 51, Dated 21 December 2023.
Last Updates: Weekly Edition No. 50, dated 14 December 2023.

PORT PHILLIP. WEST SHORE. ALTONA BAY


K2417·2 Remove from list; deleted

5.8 Wk51/23
V

NP83, Vol K Edition 2023 continued.

PORT JACKSON. SYDNEY HARBOUR


K2642 - Sow and Pigs 33 50·21 S Fl(2)W 6s .. 2 Black # on black ..
151 16·25 E beacon, red band
* *

K2707·35 - Eleanor Bluffs 33 34·73 S VQ(3)W 5s .. 3·5 * on black beacon, ..


151 14·84 E yellow band
* *

K2707·808 - Hawkesbury Railway 33 32·21 S 2FR .. .. .. ..


Bridge 151 13·73 E
*

K2707·809 - Hawkesbury Railway 33 32·14 S 2FG .. .. .. ..


Bridge 151 13·72 E
*

K2707·825 - 33 32·88 S Fl G 3s .. . . Green beacon ..


151 14·32 E
* * * * * * * *

BROKEN BAY. HAWKESBURY RIVER


K2708·75 Remove from list; deleted

K2710·455 - Off Kourang Gourang Point 33 31·15 S LFl G 3s .. . . Green beacon ..


151 20·47 E
*

K2863·522 - Pumicestone Channel 27 03·93 S Fl Y 2·5s .. . . Yellow × on beacon TE; replaced by special light buoy
153 08·48 E Fl Y 2·5s in situ (T) 2023
*

K2900·855 - Rous Channel 27 23·34 S Fl Y 3s .. . . White beacon fl 0·3


153 20·89 E
* * * * * * * *

MORETON BAY. SOUTH PART


K2900·86 Remove from list; deleted

MORETON BAY. SOUTH PART


K2900·883 Remove from list; deleted

MORETON BAY. SOUTH PART. REDLAND BAY


K2903·011 - Barge Ramp Approach 27 36·75 S Q(6)+LFl W .. . . " on black beacon, ..
153 19·01 E 15s yellow top
*

K3083·6 - Clark Shoal 19 51·03 S Q(3)W 10s .. . . * on black beacon, ..


148 03·85 E yellow band
* *

K3111·5 - Magnetic Island. West 19 10·15 S Fl Y 2·5s .. . . Yellow × on yellow ..


Channel 146 48·55 E beacon
* * * * * * * *

5.9 Wk51/23
V

NP84, Vol L Edition 2023. Weekly Edition No. 51, Dated 21 December 2023.
Last Updates: Weekly Edition No. 50, dated 14 December 2023.

L0545·5 - Kyrholmskjæret. 62 12·51 N Oc(2)WRG 8s . . R3·6 Column G254·6°-281°(26·4°),


NO, , 302300 Åramsundet 5 28·17 E G3·6 W281°-298·3°(17·3°),
W4·3 R298·3°-019·6°(81·3°),
G019·6°-026·5°(6·9°),
W026·5°-037°(10·5°),
R037°-039·7°(2·7°),
G039·7°-049·1°(9·4°),
W049·1°-051·7°(2·6°),
R051·7°-057·2°(5·5°),
G057·2°-064·2°(7°),
R064·2°-117·2°(53°),
G117·2°-124·1°(6·9°)
* * * * * * * *

SØVIKA
L0811·7 - Kyrkjebakkneset. 62 32·10 N Iso G 2s 3 1·4 Post Floodlit
NO, , 336711 Hamnsund 6 15·79 E
* * * * * * * *

L1159·1 - Ramsøygalten 63 23·17 N Fl G 3s 5 3 Post ..


NO, , 439111 8 20·66 E 7
* * *

L1466 - Humlingsvær 63 45·47 N Oc(2)WRG 8s 6 W6·4 Post G030·9°-056·7°(25·8°),


NO, , 459500 (Humlingsværet). Likøytåen 8 25·04 E R4·5 7 W056·7°-067°(10·3°),
G4·2 R067°-105·1°(38·1°),
G105·1°-112·7°(7·6°),
R112·7°-177·5°(64·8°),
G177·5°-188·9°(11·4°),
W188·9°-191·3°(2·4°),
R191·3°-200·9°(9·6°),
G200·9°-248·5°(47·6°),
R248·5°-313·3°(64·8°),
W313·3°-319·9°(6·6°),
G319·9°-005°(45·1°).
Partially obscured by land
043°-054°(11°).
Partially obscured by land
071°-086°(15°).
Partially obscured by land
263°-303°(40°)
* * *

L1470 - Litlleiskjæret. Kyahølen 63 46·25 N Oc(3)WRG 12s 6 W5·3 Post G130°-184·1°(54·1°),


NO, , 460000 8 19·15 E R3·7 R184·1°-267·5°(83·4°),
G3·4 W267·5°-271·3°(3·8°),
G271·3°-292°(20·7°),
W292°-297·5°(5·5°),
R297·5°-074·2°(136·7°),
G074·2°-075·9°(1·7°)
* * * *

FROAN
L1534 Remove from list; deleted

L1535 - Sauøyskaget. Sauøya 63 59·62 N Fl R 5s 6 2·5 Post ..


NO, , 469502 9 10·90 E 6
* * * * * * * *

L1598 Gjæsingen. W Point. 63 53·19 N Oc(2)WRG 8s 15 W4·5 Post G336·3°-102·3°(126°),


NO, , 477700 Asenleia 9 39·93 E R3·4 3 W102·3°-105·7°(3·4°),
G3·4 R105·7°-122·4°(16·7°),
G122·4°-176·1°(53·7°)
* * * *

FOLDENFJORDEN
L1822·05 Remove from list; deleted

5.10 Wk51/23
V

NP84, Vol L Edition 2023 continued.

L1822·1 Krokøy. E. Abelvær 64 43·59 N QR 7 2·7 Post Floodlit


NO, , 524002 11 09·90 E 7
* * *

L2827 - Osneset 68 25·23 N Iso G 2s 6 2·7 Post Floodlit


NO, , 741517 15 08·46 E 8
* * * * * * * *

L3875 - Hønsebyfjorden. 70 32·80 N Fl R 3s 3 2·3 Post ..


NO, , 923302 Nordmannsneset 23 21·75 E 10
* * * * * * * *

NP85, Vol M Edition 2023. Weekly Edition No. 51, Dated 21 December 2023.
Last Updates: Weekly Edition No. 50, dated 14 December 2023.

M5005·9 - Sakiyamabana. Goto Shi. 32 40·31 N Fl(2)Y 6s .. 5 Wind turbine Other wind turbines exist in this area,
JP, 411, 6148·5 No. 1 128 57·46 E some marked by lights
* * * * * * * *

NOSHIRO KO
M7055·95 - N12 40 12·03 N Fl(2)Y 6s 26 5 Wind turbine Other wind turbines exist in this area,
JP, 411, 1418·12 139 57·87 E extending NE, some marked by lights
* * * * * * * *

M7056·4 - N9 40 11·55 N Fl(2)Y 6s 26 5 Wind turbine Other wind turbines exist in this area,
JP, 411, 1418·09 139 58·44 E some marked by lights
* * * * * * * *

M7056·7 - N5 40 10·73 N Fl(2)Y 6s 26 5 Wind turbine Other wind turbines exist in this area,
JP, 411, 1418·05 139 58·23 E some marked by lights
* * * * * * * *

M7056·8 - N1 40 10·68 N Fl(2)Y 6s 26 5 Wind turbine Other wind turbines exist in this area,
JP, 411, 1418·01 139 58·81 E some marked by lights
* * * * * * * *

M8029·5 - Mys Khayryuzova. Ostrvok 57 10·53 N LFl W 5s 86 9 Red metal framework fl 2.


RU, 2401, 2660 Ptichiy 156 35·19 E tower W040°-195°(155°).
3 Shown 30/6 to 30/11.
Destroyed (T) 2023
*

M8045 - My Okeanskiy 50 11·44 N Fl W 4s 82 9 Lantern on metal post fl 1.


RU, 2401, 2515 155 44·98 E on round concrete TE 2023
box
3
*

M8063·5 - Mys Kambal'nyy 51 06·24 N LFl W 6s 90 9 Black metal tower, fl 2.


RU, 2401, 2605 156 42·31 E white bands Destroyed (T) 2023
5
*

5.11 Wk51/23
V

NP86, Vol N Edition 2023. Weekly Edition No. 51, Dated 21 December 2023.
Last Updates: Weekly Edition No. 50, dated 14 December 2023.

N4266·31 - Vlychádas. Marina. E 36 20·17 N Fl G 3s 8 4 Metal framework fl 0·3.


GR, , 8755·1 Mole. Head 25 26·09 E with gallery, metal TE 2023
column, green band
6
*

N4658·82 Alaçati. Marina, S 38 15·21 N Fl(2)R 4s 2 3 White concrete fl 0·5, ec 1, fl 0·5, ec 2


TR, , 31045·4 Breakwater. Inner Arm 26 23·15 E tower, red bands
2
* * * *

N4665·27 - Torba Harbour. Fishing 37 05·23 N Fl R 3s 7 3 White tower, red fl 1


TR, , 31550·1 Harbour. Entrance 27 27·29 E band
6
* * * * * * * *

N4665·271 - Torba Harbour. Fishing 37 05·25 N Fl G 3s 7 3 White tower, green fl 1


TR, , 31550 Harbour. Breakwater. Head 27 27·33 E band
6
* * * * * * * *

N4854·7 - DFAO Çanakkale Pier 40 06·17 N Fl Y 3s 9 3 Yellow × on yellow ..


TR, , 21921 26 23·25 E tower
6
* * * * * * * *

MARMARA EREĞLİSİ
N4897·5 - Martaş. Jetty 40 57·70 N Fl(3)R 8s 9 5 White round tower, (fl 0·5, ec 1) x 2, fl 0·5, ec 4·5
TR, , 21328·5 27 55·84 E red bands
7
* * * * * *

N4962·5 Airport. Main Breakwater. 41 18·75 N Fl R 3s 8 5 White round tower, fl 1


TR, , 10637 Head 28 47·10 E red band
8
--- .. AIS .. .. .. MMSI No 992711552
* * *

N4962·6 Airport. Second Breakwater 41 18·84 N Fl G 3s 8 5 White round tower, fl 1


TR, , 10637·5 28 47·32 E green band
8
* * * *

N4964·1 Yaliköy. Şişecam Jetty 41 28·39 N Fl(4)Y 10s 14 4 Yellow tower (fl 0·5, ec 1) x 3, fl 0·5, ec 5
TR, , 10645 28 20·00 E 6
* * * * * * * *

N4965·1 Kıyıköy (Midye). 41 37·89 N Fl G 5s 14 5 White metal tower, fl 1


TR, , 10651 Fisherman's Shelter. Main 28 06·15 E green band
Breakwater. Head 11
---- .. AIS .. .. .. MMSI No 992711074
* * *

N4965·2 Kıyıköy (Midye). Secondary 41 37·85 N Fl R 5s 12 5 White concrete fl 1


TR, , 10652 Breakwater. Head 28 06·08 E tower, red band
9
--- .. AIS .. .. .. MMSI No 992711075
* * *

N5783·81 - Trabzon. Fishing Harbour. 41 00·21 N Fl(2)R 7s .. 5 White tower, red fl 1, ec 1, fl 1, ec 4


TR, , 10058·5 Inner Breakwater 39 45·88 E band
* * * * * * * *

5.12 Wk51/23
V

NP86, Vol N Edition 2023 continued.

N5784·2 Renumbered; was previously N5785.9

- Trabzon 41 00·28 N Aero Fl R .. 4 White support ..


39 44·11 E
* *

N5785·8 Renumbered; was previously N5787


TR, , 10069
- Yoroz. Fishing Harbour. 41 06·26 N Fl G 5s 11 5 White concrete tower . .
Outer Breakwater. Head 39 25·91 E 4
* *

N5785·9 Remove from list; renumbered to N5784.2

N5785·9 Renumbered; was previously N5787.2


TR, , 10069·5
- Yoroz. Fishing Harbour. 41 06·20 N Fl R 5s 11 5 White concrete tower . .
Inner Breakwater. Head 39 25·82 E 8
* * *

N5787 Remove from list; renumbered to N5785.8

N5787·2 Remove from list; renumbered to N5785.9

GIRESUN
N5787·48 - Eynesil. Barinma Yeri. N 41 04·59 N Fl G 3s 12 5 White metal tower, fl 0·5
TR, , 10084 Breakwater 39 10·53 E green band
8
* * * * * * * *

N5787·49 - Eynesil. Barinma Yeri. 41 04·54 N Fl R 3s 12 5 White metal tower, fl 0·5


TR, , 10084·5 Inner Breakwater 39 10·48 E red band
8
* * * * * * * *

N5787·5 - Eynesil. Kale Burnu 41 04·75 N Fl W 10s 29 10 White tower, black fl 1


TR, , 10085 39 09·78 E band
6
--- .. AIS .. .. .. MMSI No 992711303
* *

İSKENDERUN KÖRFEZİ
N5913·8 Remove from list; deleted

NP87, Vol P Edition 2023. Weekly Edition No. 51, Dated 21 December 2023.
Last Updates: Weekly Edition No. 50, dated 14 December 2023.

P3482 - Dahao Zhou (Tonggu Sha). 23 04·89 N Fl W 3s 9 5 White round GRP fl 0·3.
CN, G103, 4455 W Side Ldg Lts 132°27′. 113 28·30 E tower Tide gauge.
Front 8 TE 2023
*

P3482·1 - Dahao Zhou (Tonggu Sha). 23 04·81 N Iso W 2s 11 5 White round brick TE 2023
CN, G103, 4456 W Side Ldg Lts 132°27′. 113 28·39 E tower
Rear. 200m from front 10
*

5.13 Wk51/23
V

NP87, Vol P Edition 2023 continued.

P4710 - Hualien Gang. Fishing Port. 23 59·88 N Fl R 3s .. 1·6 Red metal post fl 0·5.
TW, 5, 41110 S 121 38·28 E TE 2022
*

P4710·1 - Hualien Gang. Fishing Port. 23 59·89 N Fl G 2s .. 1·6 Red metal post fl 0·5.
TW, 5, 41100 N 121 38·29 E TE 2022
*

NP88, Vol Q Edition 2023. Weekly Edition No. 51, Dated 21 December 2023.
Last Updates: Weekly Edition No. 50, dated 14 December 2023.

PULAU PISANG
Q1603·3 - Batuanyur Besar 1 23·65 S Fl W 3s 15 12 White beacon fl 1
ID, , 5917·1 (ID) 128 56·19 E 10
*

ROEBUCK BAY
Q1662·5 Remove from list; deleted

ROEBUCK BAY
Q1662·51 Remove from list; deleted

Q1757·79 Ocean Reef Boat Harbour. 31 45·61 S QW 13 10 U Vis 20° each side of leading line.
Ldg Lts 100°. Front. 310m 115 43·67 E To be decommissioned and
from front replaced. May not be operational
during replacement works. (P) 2023
*

Q1757·8 Ocean Reef Boat Harbour. 31 45·64 S F Bu 24 5 White U with red Front Q1757·79.
Ldg Lts 100°. Common rear 115 43·86 E band To be decommissioned and
replaced. May not be operational
during replacement works. (P) 2023
- Ldg Lts 042·5°. Common .. F Bu 24 5 .. Front Q1757·81.
rear To be decommissioned and
replaced. May not be operational
during replacement works. (P) 2023
*

Q1757·81 Ocean Reef Boat Harbour. 31 45·77 S Iso W 2s 13 10 U Vis 20° each side of leading line.
Ldg Lts 042·5°. Front. 340m 115 43·71 E To be decommissioned and
from rear replaced. May not be operational
during replacement works. (P) 2023
*

Q2129 Rivoli Bay. Cape Buffon 37 33·97 S Fl WR 2·5s 15 W 8 White metal column W059°-079°(20°), R079°-089°(10°),
140 06·47 E R 3 2 W089°-111°(22°), R111°-059°(308°).
TE 2023
*

5.14 Wk51/23
VI

ONGOING MAINTENANCE PROCESS IN ADMIRALTY RADIO SIGNALS VOLUMES


In order to guarantee the safety of Mariners at sea, avoid any unsafe and unnecessary duplication/updating of information
appearing in different paper and digital ADMIRALTY Radio Signals Volumes, the information will now be centralised into the most
relevant ADMIRALTY Radio Signals Volume.

For more information, a reference to the location of any required information will also be added to each ADMIRALTY
Radio Signals Volume.

UK COASTAL WARNING (WZ) NAVIGATIONAL WARNINGS


1. General Area Message Element
With effect from December 18th, 2023, UK Shipping Forecast Areas are used in the General Area message element of
UK Coastal Warning (WZ) Navigational Warnings to describe the broad geographic area each message refers to.
See ALRS Volume 3(1) (NP283(1)) diagram ‘United Kingdom Shipping Forecast Areas’ for full details of broad geographic
area limits. For further information on message elements of Navigational Warnings See ALRS Volume 3(1) (NP283(1)) entry
‘MARITIME SAFETY INFORMATION, Extracts from the revised Joint IMO/IHO/WMO Manual on Maritime Safety Information
(MSI) January 2016’.

2. GUNFACTS/SUBFACTS
With effect from December 18th, 2023, GUNFACTS/SUBFACTS negative reports (i.e., notifications when no hazardous operations
are taking place) will not be promulgated.

Wk51/23
6.1
VI

UPDATES TO ADMIRALTY LIST OF RADIO SIGNALS


Weekly Edition No. 51 dated 21 December 2023

The ADMIRALTY List of Radio Signals diagrams included in the paper version of the weekly Notice to Mariners (Section
VI) are printed in black and white. If required, a colour version of these diagrams can be downloaded from
[Link]/maritime-safety-information. To obtain the colour versions select View and download NMs – select
Weekly – select Year – select Week – go to Selected Week Content – select File (for example:
NP286(3)–WK01–14–PAGE149_Week01_2023.pdf)

VOLUME 1, NP281(1), Fourth Edition, 2023


Published Wk 42/23
(Last Updates: Weekly Edition No. 50 dated 14 December 2023)

MARITIME RADIO STATIONS

PAGE 207, MALTA.


MALTA RCC.
Delete entry and replace by:

MALTA RCC
Control Centre: 35°51′·30N 14°29′·30E MMSI 002150100 DSC VHF MF OBS Diagram page 46
Telephone: +356 22494202 Fax: +356 21809860
+356 21257267
+356 22494203
Inmarsat C: 421599999 Email: rccmalta@[Link]
Iridium: +881 641709216 Website: [Link]
NOTE(S): 1. Distress, Urgency and Safety traffic only.
2. Station operated by the Armed Forces of Malta (accepts Ships' Weather Reports addressed OBS METEO LUQA).
VHF
Ch 01 02 03 04 16 28 Ch 16: H24

RT (MF)
Position Transmits Receives Hours of Watch
2182
2182 H24
2625

RCC Malta correspondence (RSDRA2023000323601) 51/23

VOLUME 2, NP282(1), Fourth Edition, 2023


Published Wk 12/23
(Last Updates: Weekly Edition No. 50 dated 14 December 2023)

AUTOMATIC IDENTIFICATION SYSTEM (AIS)

PAGE 86, CHANNEL ISLANDS (UK).


Platte Fougère.
Delete entry and replace by:

Platte Fougère Lt 49°30′·83N 2°29′·14W 992356078 Real

(former update 50/23)


UKHO 51/23

PAGE 112, INDIA.


Karanja Lt Buoy.
Delete entry

Indian Chart IN2015 3rd Edition (RSDRA2023000317462) 51/23

Wk51/23
6.2
6.1
VI
VI

PAGE 112, INDIA.


Karanja Lt Buoy North.
Delete entry

Indian Chart IN2015 3rd Edition (RSDRA2023000317462) 51/23

PAGE 112, INDIA.


Mumbai Red Lt Buoy No 2 North.
Delete entry

Indian Chart IN2015 3rd Edition (RSDRA2023000317462) 51/23

PAGE 112, INDIA.


Mumbai Red Lt Buoy No 2 South.
Delete entry

Indian Chart IN2015 3rd Edition (RSDRA2023000317462) 51/23

PAGE 112, INDIA.


Mumbai Sunk Rock Lt.
Delete entry

Indian Chart IN2015 3rd Edition (RSDRA2023000317462) 51/23

PAGE 112, INDIA.


Mumbai Sunk Rock North.
Delete entry

Indian Chart IN2015 3rd Edition (RSDRA2023000317462) 51/23

PAGE 208, UNITED KINGDOM.


CampionWind Offshore Windfarm Fugro LiDAR Buoy WS197.
Delete entry

Northern Lighthouse Board correspondence & CampionWind Notice (RSDRA2023000317677) 51/23

VOLUME 2, NP282(2), Fourth Edition, 2023


Published Wk 12/23
(Last Updates: Weekly Edition No. 50 dated 14 December 2023)

RADAR BEACONS

PAGE 44, KOREA, SOUTH.


82596 Nabae Bridge Lt Bn.
Delete entry and replace by:

Nabae Bridge Lt Bn 34°18′·61N 126°01′·24E 3 6 20 M 82596

Korean List of Lights and Fog Signals Publication 410 2023 Edition (RSDRA2023000293913) 51/23

PAGE 46, KOREA, SOUTH.


82635 Jukdo Lt, Chagwido.
Delete entry and replace by:

Jukdo Lt, Chagwido 33°18′·69N 126°08′·76E 3 & 10 12 30 O 82635

Korean List of Lights and Fog Signals Publication 410 2023 Edition (RSDRA2023000293913) 51/23

6.2
6.3 Wk51/23
VI
VI

AUTOMATIC IDENTIFICATION SYSTEM (AIS)

PAGE 238, JAPAN.


Kuji Ko Offing ODAS Lt Buoy.
Delete entry

(former update 31/23)


Japanese Notice 48/508/23 (RSDRA2023000323784) 51/23

PAGE 280, TAIWAN, below Changhua Offshore Windfarm South Virtual Mark.
Insert:

F4 LiDAR ODAS Buoy 24°38′·83N 120°28′·67E 994161073 Real

UKHO 51/23

PAGE 280, TAIWAN.


Formosa 2 Offshore Windfarm Lt Buoy No BU02E.
Delete entry

UKHO 51/23

VOLUME 5, NP285, Fourth Edition, 2023


Published Wk 32/23
(Last Updates: Weekly Edition No. 50 dated 14 December 2023)

DISTRESS, SEARCH AND RESCUE

PAGES 352 and 353, NAVAREA III.


MALTA.
Delete entry and replace by:

MALTA See diagram R5


National SAR Agency: Rescue Coordination Centre Malta c/o Armed Forces of Malta Operations Centre
Address: Luqa Barracks, Luqa, Malta VLT 2000
Telephone: +356 22 494202
+356 21 257267
Fax: +356 21 809860
email: rccmalta@[Link]
RCC Malta is co-located in the Operations Centre of the AFM. RCC Malta is responsible for coordinating SAR Operations within the
Malta SRR which coincides with the Malta FIR. Transport Malta and Malta Air Traffic Services assist RCC Malta in the conducting of
such operations. RCC Malta works closely with neighbouring RCCs, particularly during incidents in remote areas of Malta SRR.
Distress information originating from Cospas-Sarsat and Inmarsat is transmitted to Malta RCC or the Malta International Airport plc Air
Traffic Control Tower.
Telephone +356 Fax +356 Others/Ship Earth Stations (SES)
RCC MALTA (Cospas-Sarsat SPOC) 21 257267 21 809860 AFTN: LMMCYCYX (For emergencies only)
22 494202 LMMLYCYC (For emergencies only)
22 494203 Inmarsat C: 421599999
Iridium: +881 641709216
email: rccmalta@[Link]
MALTA AIR TRAFFIC SERVICES 23 696520 23 695411 AFTN: LMMMZQZX
LTD
23 695339 23 695432
TRANSPORT MALTA 22 91 4490 21 222208 email: mershipmalta@[Link]
22 91 4491 21 241460
22 91 4492 22 914419
21 25 0360

RCC Malta correspondence (RSDRA2023000323601) 51/23

Wk51/23 6.3
6.4
VI
VI

VOLUME 6, NP286(1), Fourth Edition, 2023 PAGE 308, UNITED KINGDOM, GREAT YARMOUTH, below Haven
Published Wk 20/23
Bridge section.
Insert:
––––––––––––––––––
(Last Updates: Weekly Edition No. 50 dated 14 December 2023) Herring Bridge
PAGES 263 & 264, UNITED KINGDOM, BRIXHAM. LOCATION: 52°35′·58N 1°43′·56E
Delete entry and replace by:
CONTACT DETAILS:
Call: Herring Bridge
BRIXHAM 50°24′N 3°31′W VHF Channel: Ch 12
UNCTAD LOCODE: GB BRX
Telephone: +44(0)1493 448448
Deep Sea Pilots E-mail: bookings@[Link]
For details see ENGLISH CHANNEL AND NORTH SEA, including Skagerrak - DEEP HOURS: H24
SEA PILOTS.
PROCEDURE:
Local Pilots (Brixham Ship Agency Services) (1) Bookings must be made by all vessels regardless of size and whether they believe
a bridge lift will be required or not.
CONTACT DETAILS: (2) New Bookings must be made at least 2h in advance of transit time through the
VHF Channel: Ch 09 (PV) bridge.
Telephone: +44(0)1803 220696 (3) Booking revisions should be made as soon as possible, but no later than 30 mins
E-mail: ops@[Link] before the original booking time.
Website: [Link] (4) Bookings can be made by telephone, e-mail, VHF radio, or using the booking
HOURS: H24 form on the web portal: [Link]
Application.
PROCEDURE: (5) Specic vessel characteristics and passage details are required to be provided to
(1) Pilotage is compulsory within Tor Bay Harbour Limits for all vessels except the Herring Bridge Control. For full details on the information required for each class of
following: vessel please refer to the ‘Opening Procedures Guidance’, a copy of which is included
(a) United Kingdom Royal Navy or RFA vessels on the ‘Herring Bridge Information and Booking’ page on the website: [Link]
(b) Foreign warships navigating in the harbour for the purpose of taking up or [Link]/roads-and-transport/major-projects-and-improvement-plans/great-
leaving an anchorage yarmouth/third-river-crossing/herring-bridge-operations.
(c) Any vessel of less than 36m LOA entering or leaving an enclosed harbour and
not carrying a cargo of dangerous goods or marine pollutants Peel Ports Group Notice 36/23, (RSDRA2023000316770), 51/23
(d) Any vessel of less than 80m LOA providing they do not enter or leave an
enclosed harbour
(e) Any vessel engaged in towing where the length of such vessel aggregated with PAGE 344, UNITED KINGDOM, LIVERPOOL, Pilots, CONTACT
the length of the tow is less than 80m or less than 36m for those entering or DETAILS section.
leaving an enclosed harbour
Delete and replace by:
(f) Any shing vessel less than 47·5m LOA
(g) Any vessel proceeding to or departing from a designated anchorage provided
such vessel has been forced by stress of weather to seek shelter. Such vessels CONTACT DETAILS:
must contact Tor Bay Harbour on VHF Ch 14 before entering harbour limits Telephone: +44(0)151 9496137 (Option 3)
and again on departing harbour limits. Alternative contact can be made by +44(0)151 9496141 (Option 3)
telephone +44(0)151 9496132 (Outside normal office hours only)
(2) Notice of ETA: Vessels should send ETA 48h in advance to the Port by e-mail. Fax: +44(0)151 9496090
(3) Vessels should contact Tor Bay Harbour on VHF Ch 14, 2h before arrival.
(4) Vessels should contact the PV on VHF Ch 09, 1h before arrival. Liverpool Bar Pilot
(5) Pilot boards in position 50°25′·00N 3°25′·70W. Call: Liverpool Bar Pilot
VHF Channel: Ch 11 12
Port
Lynas Boarding Station (Alternate boarding station for Liverpool Pilots)
CONTACT DETAILS: Call: Lynas Pilot
Call: Brixham Port VHF Channel: Ch 09
VHF Channel: Ch 16; 14
Telephone: +44(0)1803 208443 The Mersey Docks and Harbour Company Limited
+44(0)7768 553881 (H24) Telephone: +44(0)151 9496000
E-mail: [Link]@[Link] E-mail: [Link]@[Link]
Website: [Link] Website: [Link]/marine/our-ports/liverpool

HOURS: 0900-1700 LT
Peel Ports correspondence, (RSDRA2023000324368), 51/23
PROCEDURE:
(1) Notice of ETA: Vessels should send ETA 48h in advance.
(2) All vessels intending to anchor or manoeuvre within the Tor Bay Harbour limits
should contact Bay Reporting on VHF Ch 14 2h before arrival.
(3) All vessels manoeuvring or at anchor within the Tor Bay Harbour limits should
maintain a continuous listening watch on VHF Ch 14.

(Former update 20/23)

Brixham Ship Agency Services correspondence,


(RSDRA2023000320793 & RSDRA2023000317558), 51/23

1
Wk51/23
6.5
VI
VI

PAGE 450, UNITED KINGDOM, TOR BAY HARBOUR, Port, CONTACT PAGE 271, NORWAY, HONNINGSVÅG, Pilots, PROCEDURE, section
DETAILS section. (2) (a).
Delete and replace by: Delete and replace by:

(a) Passenger vessels over 25 000 gt and STS vessels: 70°58′·00N 26°17′·00E
CONTACT DETAILS:
(optional for passenger vessels under 25 000 gt)
Call: Bay Reporting
VHF Channel: Ch 14
Norwegian Chart 313 2023 Edition, (RSDRA2023000323358), 51/23
Torquay Harbour
Call: Torquay Port
VHF Channel: Ch 16; 14 PAGE 278, NORWAY, KVINESDAL, Pilots, PROCEDURE, section (3)
Telephone: +44(0)1803 208443 Delete and replace by:
+44(0)1803 402727
E-mail: [Link]@[Link] (3) Pilot boards in position 58°10′·90N 6°32′·90E.
Website: [Link]
Brixham Harbour ENC NO5E0613, (RSDRA2023000289546), 51/23
Call: Brixham Port
VHF Channel: Ch 16; 14
Telephone: +44(0)1803 208443 PAGE 339, RUSSIA (Arctic Coast), DIKSON, Port section.
+44(0)7768 553881 (H24) Delete and replace by:
E-mail: [Link]@[Link]
Website: [Link]
Port
(Former update 20/23) CONTACT DETAILS:
Brixham Ship Agency Services correspondence, Call: MSCP-Dixon
(RSDRA2023000320793 & RSDRA2023000317558), 51/23 VHF Channel: Ch 16; 09
Telephone: +7 391 5224099 (Duty Officer)
–––––––––––––––––––––––––––––– +7(8)815 2689111 (Traffic Management)
Fax: +7(8)815 2689110 (Traffic Management)
E-mail: master@[Link] (Traffic Management)
VOLUME 6, NP286(2), Fourth Edition, 2023
Hr Mr
Published Wk 24/23 Call: Port Control
–––––––––––––––––– VHF Channel: Ch 16; 14
Telephone: +7 915 7506423
(Last Updates: Weekly Edition No. 50 dated 14 December 2023) E-mail: diksonmamp@[Link]
PAGE 136, GERMANY, BRUNSBÜTTEL ELBE PORT, Port section. HOURS: H24
Delete and replace by:
PROCEDURE:
(1) Notice of ETA: ETA should be advised 72h, 48h and 24h prior to arrival and the
Port following information advised no later than 6h prior to arrival to the Duty Officer who will
advise of any navigational closures:
CONTACT DETAILS: (a) Vessel’s draught
Call: Brunsbüttel Port (b) Intended approach channel
VHF Channel: Ch 06; 14 (2) There is no pilotage or tugs available for vessels in port area No 1. Pilotage and
Telephone: +49(0)4852 8840 tugs are available for vessels in port area No 2.
Fax: +49(0)4852 88426 (Port Supervisior) (3) The Hr Mr communicates information to vessels for entering and exiting the port at
+49(0)4852 88470 (Brunsbüttel Ports) [Link].
E-mail: info-bp@[Link] (4) All vessels within the port and at piers, shall maintain radio communications on
Website: [Link] VHF Chs 9 14 and 16.
Hr Mr Tugs
Telephone: +49(0)4852 88418 (H24)
CONTACT DETAILS:
Port Authority VHF Channel: Ch 14
Telephone: +49(0)4852 391370
E-mail: portauthority@[Link] Russian Bulletin 46/23, (RSDRA2023000310576), 51/23
PROCEDURE:
Vessels are required to report on the import of products containing hydrogen sulde
(H2S) and their concentration to the Port Authority 48h and 24h before arrival.

NOTE:
Brunsbuttle Port Authority operates the ports of Elbehafen, Oilport and OSTERMOOR.

German Bulletin 41/23, (RSDRA2023000286586), 51/23

2
Wk51/23
6.6
VI
VI

PAGE 392, SWEDEN, GENERAL NOTES, ICE-BREAKING SERVICE, PAGE 421, UKRAINE, GENERAL NOTES, below PILOTAGE section.
below INFORMATION SERVICE section. Insert new section:
Insert new section:
ICE-BREAKING SERVICE:
PUBLIC INFORMATION REPORTING:
PROCEDURE:
(1) Vessels ice-breaking in areas which may affect public access and transportation,
(1) Icebreaker assistance is provided in cold-water seaports and approaches to them
should report and include the following information:
for the purpose of ensuring their navigational accessibility and safety in conditions of
(a) When/where the ice will be broken (if possible, include a map of the location)
ice formation.
(b) Name of vessel and contact details
(2) The beginning and end of ice campaigns in individual regions of Ukraine are
(2) Vessels should report by the following means:
announced by an order of the Shipping Administration based on the information
(a) By e-mail to fartyg@[Link]. The content of the e-mail will automatically be
received from regional ice operation coordinators and are promulgated in Notices to
published on the website [Link]/mail/fartyg
Mariners by the State Hydrographic Service of Ukraine.
(b) By email to trakredaktionen@[Link]. Follow up by calling +46 20
(3) During an ice campaign, vessels must be escorted only by icebreakers, except for
999 444 or +46 8 784 50 00, making reference to your e-mail. Information
vessels with an ice class that enables safe passage under current ice conditions in
will be broadcast on channel P4 during weekdays 0600-1800 LT and will
a navigation area. Applications for an ice escort must be forwarded by the vessel: in
additionally be published on the website [Link]
ports, to the port manager and harbour master; at sea, additionally to the icebreaker’s
master.
(Former update 30/23)
(4) Vessels subject to icebreaker assistance under certain ice conditions must have
Swedish Bulletin 990/18138(T)/23, (RSDRA2023000317690), 51/23 an appropriate ice class assigned by a classication society. Such vessels must have
sufficient emergency supplies according to the established norms and be equipped
with serviceable drainage facilities and a two-way radio.
PAGE 392, SWEDEN, GENERAL NOTES, ICE-BREAKING SERVICE, (5) Requesting assistance: To request icebreaker assistance, vessels must, in
NOTES section. addition to information on arrival at the seaport, inform the harbour master of the
Delete and replace by: following:
(a) Displacement of the vessel
(b) Type, power and number of main engines
NOTE: (c) Ice class (ice strengthening category, if any)
Vessels should agree to comply with the general instructions and terms prior to (d) Aspects of vessel’s technical state affecting ice escort
navigating in a Finnish or Swedish assistance area, during the winter season. The (e) Number of propellers
vessel or shipping company is advised to send its reply by e-mail to Turku Radio (turku. (f) Propeller material
radio@fta.) in good time. The answer will affect the assistance of the vessel. For full (g) Amount of fuel, water and provisions, as well as their daily consumption
details and a link to the latest edition of Finland’s Winter Navigation publication please
see: [Link] Ukraine Bulletin 44/23, (RSDRA2023000323739), 51/23

(Former update 30/23) ––––––––––––––––––––––––––––––


Swedish Bulletin 990/18138(T)/23, (RSDRA2023000317690), 51/23
VOLUME 6, NP286(4), Fourth Edition, 2023
–––––––––––––––––––––––––––––– Published Wk 36/23

––––––––––––––––––
VOLUME 6, NP286(3), Fourth Edition, 2023
(Last Updates: Weekly Edition No. 50 dated 14 December 2023)
Published Wk 27/23
PAGE 19, AUSTRALIA, BARRY BEACH MARINE TERMINAL, Corner
––––––––––––––––––
Inlet, Victoria.
(Last Updates: Weekly Edition No. 46 dated 16 November 2023) Delete entry and replace by:
PAGE 96, FRANCE (Mediterranean Coast), SÈTE, Pilots, CONTACT
DETAILS section. BARRY BEACH MARINE TERMINAL, 38°43′S 146°23′E
Delete and replace by: Corner Inlet, Victoria
UNCTAD LOCODE: AU BAR

Pilots
CONTACT DETAILS:
Call: Sète Pilot PROCEDURE:
VHF Channel: Ch 12 Pilot boards in position 38°52′·03S 146°42′·03E.
Telephone: +33(0)4 34536390
E-mail: permanence@[Link] Terminal
Website: [Link] CONTACT DETAILS:

French Radiosignaux publication 93 Oct 2023, (RSDRA2023000272643), 51/23 Terminal Superintendant


VHF Channel: Ch 16
Telephone: +61(0)3 56880225
Fax: +61(0)3 56881495
HOURS: H24

continued on next page

3
Wk51/23
6.7
VI
VI

NOTE:
A certicate of local knowledge is compulsory for all trading vessels over 12m LOA and
all shing vessels over 35m LOA.

Australian Notice 24/1011/23, (RSDRA2023000318128), 51/23

PAGE 65, AUSTRALIA, MELBOURNE including Port Phillip, Victoria,


Vessel Traffic Service, CONTACT DETAILS section.
Delete and replace by:

CONTACT DETAILS:
Melbourne VTS
Call: Melbourne VTS
VHF Channel: Ch 16; 12
Telephone: +61(0)3 96449700
E-mail: melbournevts@[Link]
Lonsdale VTS
Call: Lonsdale VTS
VHF Channel: Ch 16; 12
Telephone: +61(0)3 52583500
E-mail: lonsdalevts@[Link]
arrivalnotication@[Link]

(Former update 44/23)

Australian Hydrographic Office Correspondence, (RSDRA2023000311010), 51/23

––––––––––––––––––––––––––––––

VOLUME 6, NP286(7), Fourth Edition, 2023


Published Wk 06/23

––––––––––––––––––
(Last Updates: Weekly Edition No. 48 dated 30 November 2023)

PAGE 70, BRAZIL, RIO AMAZONAS, Pilots, below Bacia Amazonica


Praticos - Grupo BAP section.
Insert:

Santarém River Pilots Office


Telephone: +55(0)93 35222870
Fax: +55(0)93 35232663
+55(0)93 35232923

Brazilian Bulletin 21/23, (RSDRA2023000316763), 51/23

––––––––––––––––––––––––––––––

4
Wk51/23
6.8
VII

UPDATES TO MISCELLANEOUS ADMIRALTY NAUTICAL PUBLICATIONS

There are no updates to miscellaneous Nautical Publications this week

UKRAINE NAVIGATIONAL INFORMATION

Owing to insufficient information, it is not always possible to ensure that ADMIRALTY Nautical
Publications are completely up-- to-- date for new dangers or changes to aids to navigation.

Mariners are therefore advised to exercise particular caution when navigating in Ukrainian waters.

7.1
Wk51/23
VIII

ADMIRALTY DIGITAL SERVICES


1. ENC / ECDIS and AVCS

a) ENCs temporarily withdrawn from AVCS


A list of ENCs that have been temporarily withdrawn from AVCS for safety reasons can be found in the README file and on the
AVCS Updates page, accessed from [Link]/avcs.

b) ENC [Link] file


The [Link] file located within the ENC_ROOT folder of AVCS Exchange sets contains important safety related information
relating to the use of ENCs in ECDIS. The file is also available on the AVCS Support page, accessed from [Link]/avcs.

This file should be consulted each week to ensure that all related issues are taken into consideration. The file header indicates the last
time that the README file was updated and the date that it was issued.

c) Temporary information in ENCs

Mariners should take temporary information into account when planning and executing a passage with ENCs and most ENC producers
now include temporary information in their ENCs. It is usually compiled as normal ENC updates, sometimes with the start and end dates
attributed or described as ‘Temporary’ in the pick report.

The latest confirmed status of T&P NM information in the ENCs that are available in ADMIRALTY services is shown in the ENC-
T&[Link] file at: [Link]/ENC-TP-NMs. Note that T&P NMs are compiled for paper charts and may not align with
any temporary information that is compiled into ENCs.

ADMIRALTY Information Overlay (AIO) includes ADMIRALTY T&P NMs for paper charts where the ENC Producer has not
confirmed that they include temporary information in their ENCs.

Further guidance can be found in the AIO User Guide on the AVCS Support page, accessed from [Link]/avcs.

d) Important notice for users of AVCS and ARCS Online Updating Services (AVCS OUS and ARCS OUS)

The email service for AVCS OUS was withdrawn at the end of February 2019 due to technology infrastructure changes at UKHO.

The ARCS Online Updating Service was withdrawn in July 2019.

2. ADMIRALTY Products Supporting Digital Navigation

i. ADMIRALTY ENC and ECDIS Maintenance Record (NP133C). This publication is designed to hold paper records on ENC
and ECDIS maintenance to assist information management and support inspections. Please note that V2.0 is the current
edition.

ii. ADMIRALTY Guide to ENC Symbols Used in ECDIS (NP5012). A companion to the ADMIRALTY Guide to Symbols and
Abbreviations Used on Paper Charts, NP5011. The 2nd edition of NP5012 includes the changes highlighted in the new S-52
standards and the new presentation library 4.0.

iii. ADMIRALTY Guide to the Practical Use of ENCs (NP231). Supports ECDIS training on the interpretation and use of ENC
data.

iv. ADMIRALTY Guide to ECDIS Implementation, Policy and Procedures (NP232). Provides clear guidance for any individual
or organisation responsible for the introduction of ECDIS, in particular those involved in the development of detailed ECDIS
operating procedures.

8.1
Wk 51/23
VIII

3. ADMIRALTY Digital Publications (ADP)

ADMIRALTY Sailing Directions: Removal of AIS and Racons


In 2018, the UKHO began the process of removing AIS and Racon information from ADMIRALTY Sailing Directions, as this is held in
greater detail within ADMIRALTY Radio Signals publications. During this transition, AIS and Racon information will be removed
from new editions of each Sailing Direction volume, and AIS and Racon information present in existing Sailing Direction volumes will
no longer be updated. For accurate, up-to-date information on AIS and Racons, refer to ADMIRALTY Radio Signals publications.

ADP V23 is available on the ADP Weekly Update DVD.


V19 and V23 are supported by the UKHO and are the only versions that allow users to receive tidal updates as they are made available.
Users of older versions of ADP should upgrade to a supported version at their earliest convenience.

ADMIRALTY TotalTide (ATT): German Tidal Stations predicted on LAT


The TotalTide application computes predictions for all German tidal stations based on Lowest Astronomical Tide (LAT).
Mariners using charts which refer to Mean Low Water Springs (MLWS) in German waters, must deduct 0.5m from all predicted tidal
heights for these ports before applying them to the depths on those charts to determine the correct predicted depth of water. This advice
will also be contained in the ‘Notes’ tab on the Prediction Windows in TotalTide for each German tidal station.

For information: Please note the UKHO will not be supporting V18 from 1st July 2023.

The ADP software and the Data updates can still be downloaded from weekly ADP Update and Software DVDs.

To get access to the ADP Update and Software DVD, please contact your ADMIRALTY Distributor.

For information: Ensure that Activation Key Requests and Update Data Requests for ADP are sent to ADPMailGateway@[Link]

4. ADMIRALTY e-Nautical Publications (AENP)

There is currently an e-Reader 1.3 enabling users to read Digital copies of our Sailing Directions paper publications.

A new e-Reader 1.4 was released to the Channel on 01/10/2020. This version 1.4 has got the same functionalities as the current version
1.3 but is more performant and user-friendly. While the current 1.3 version can be used on Windows 7 and 8.1 Operating Systems (OS),
the e-Reader 1.4 can only be used on Windows 8.1 and 10 OS, to follow the Microsoft guidelines of withdrawing support for Windows
7 OS.

To enable users to activate this new application, users might need to delete one e-Reader application from their Fleet Manager Licences
if the maximum 3 allowed has been reached.

Both the e-Readers 1.3 and 1.4 are supported at the UKHO.

The e-Reader 1.4 software and the Data updates can be downloaded from weekly ADP Update and Software DVDs.

To get access to the AENP Update and Software DVD, please contact your ADMIRALTY Distributor.

8.2
Wk 51/23
VIII

5. Status of ADMIRALTY Digital Services

Update status table

Product Last issue date/Week Reissue Date/Week


i. ADMIRALTY Vector Chart Service (AVCS) Base .zip download 13 July 2023 - 28
ii. ADMIRALTY Information Overlay (AIO) Base CD 31 March 2022 - 13
iii. ADMIRALTY Raster Chart Service (ARCS) Regional disc 1 09 November 2023 - 45
ADMIRALTY Raster Chart Service (ARCS) Regional disc 2 14 December 2023 - 50
ADMIRALTY Raster Chart Service (ARCS) Regional disc 3 23 November 2023 - 47
ADMIRALTY Raster Chart Service (ARCS) Regional disc 4 06 July 2023 - 27
ADMIRALTY Raster Chart Service (ARCS) Regional disc 5 21 September - 38
ADMIRALTY Raster Chart Service (ARCS) Regional disc 6 03 August 2023 - 31 01 February 2024 - 05
ADMIRALTY Raster Chart Service (ARCS) Regional disc 7 23 March 2023 - 12 15 February 2024 - 07
ADMIRALTY Raster Chart Service (ARCS) Regional disc 8 05 October - 40
ADMIRALTY Raster Chart Service (ARCS) Regional disc 9 22 June 2023 - 25
ADMIRALTY Raster Chart Service (ARCS) Regional disc 10 02 February 2023 - 05 18 January 2024 - 03
17 August 2023 - 33
ADMIRALTY Raster Chart Service (ARCS) Regional disc 11
Small-scale Planning Charts

ADMIRALTY Vector Chart Service (AVCS) DVDs and ADMIRALTY Information Overlay (AIO) CDs are issued
weekly and contain all base and update data available at the time of issue.

6. Supported ADMIRALTY Software Versions

Product Supported Versions


ADP V19, V23
ADMIRALTY e-Reader 1.3, 1.4
NavPac and Compact Data 4.2

If you are using an unsupported version, contact your Chart Distributor to upgrade to the latest version as soon as possible.

8.3
Wk 51/23
HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)

Reporting Port Information affecting ADMIRALTY Products

NAME OF PORT

APPROXIMATE POSITION Latitude Longitude

GENERAL REMARKS
Principal activities and trade.
Latest population figures and date.

Number of ships or tonnage handled per


year.

Maximum size of vessel handled.

Copy of Port Handbook (if available).

ANCHORAGES
Designation, depths, holding ground,
shelter afforded.

PILOTAGE
Authority for requests.

Embark position.

Regulations.

DIRECTIONS
Entry and berthing information.

Tidal streams.

Navigational aids.

TUGS
Number available.

WHARVES
Names, numbers or positions & lengths.

Depths alongside.

CARGO HANDLING
Containers, lighters, Ro-Ro etc.

REPAIRS
Hull, machinery and underwater.

Shipyards.

Docking or slipping facilities.


(Give size of vessels handled or
dimensions)

Divers.
HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)

RESCUE AND DISTRESS


Salvage, Lifeboat, Coastguard, etc.

SUPPLIES
Fuel.
(with type, quantities and methods of
delivery)

Fresh water.
(with method of delivery and rate of
supply)

Provisions.

SERVICES
Medical.

Ship Sanitation.

Garbage and slops.

Ship chandlery, tank cleaning, compass


adjustment, hull painting.

COMMUNICATIONS
Nearest airport or airfield.

Port radio and information service. (with


frequencies and hours of operating)

PORT AUTHORITY
Designation, address, telephone, e-mail
address and website.

VIEWS
Photographs (where permitted) of the
approaches, leading marks, the entrance
to the harbour etc.

ADDITIONAL DETAILS

NOTES:

1. Form H.I02A lists the information required for ADMIRALTY Sailing Directions and has been designed to help the
sender and the recipient. The sections should be used as an aide-memoir, being used or followed closely,
whenever appropriate. Where there is insufficient space on the form an additional sheet should be used.

2. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings
should be stressed and any firm expectation of being able to check the information on a succeeding voyage should
be mentioned.
HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
(To accompany Form H.102)

Chart/ENC in use
(SEE NOTE 3a) Latitude/Longitude of position read Latitude/Longitude of position read from Additional
Time/Date of
Edition Date & from Chart/ECDIS GNSS Receiver (on WGS84) Information/Remarks
Observation Number /
NM / ENC (SEE NOTE 3b) (SEE NOTE 3c) (SEE NOTE 3d)
ENC
update status
HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
(To accompany Form H.102)

NOTES:
1. This form is designed to assist in the reporting of observed differences between WGS84 datum and the geodetic datum of British
ADMIRALTY Charts by mariners, including yachtsmen and should be submitted as an accompaniment to Form H.102 (full instructions
for the rendering of data are on Form H.102). Where there is insufficient space on the form an additional sheet should be used.

2. Objective of GNSS Data Collection

The UK Hydrographic Office would appreciate the reporting of Global Navigation Satellite Systems (GNSS) positions, referenced to WGS84 datum, at
identifiable locations or features on British ADMIRALTY Charts. Such observations could be used to calculate positional shifts between WGS84 datum and the
geodetic datum for those British ADMIRALTY Charts which it has not yet been possible to compute the appropriate shifts. These would be incorporated in future
new editions or new charts and promulgated by Preliminary Notices to Mariners in the interim.

It is unrealistic to expect that a series of reported WGS84 positions relating to a given chart will enable it to be referenced to that datum with the accuracy
required for geodetic purposes. Nevertheless, this provides adequate accuracy for general navigation, considering the practical limits to the precision of 0.2mm
(probably the best possible under ideal conditions – vessel alongside, good light, sharp dividers etc), this represents 10 metres on the ground at a chart scale of
1:50.000.

It is clear that users prefer to have some indication of the magnitude and direction of the positional shift, together with an assessment of its likely accuracy,
rather than be informed that a definitive answer cannot be formulated. Consequently, where a WGS84 version has not yet been produced, many charts now
carry approximate shifts relating WGS84 datum to the geodetic datum of the chart. Further observations may enable these values to be refined with greater
confidence.

3. Details required

a. It is essential that the chart number, edition date and its correctional state (latest NM) are stated. For ENCs, please state the ENC name and latest
update applied.

b. Position (to 2 decimal places of a minute) of observation point, using chart graticule or, if ungraduated, relative position by bearing/distance from
prominent charted features (navigation lights, trig. points, church spires etc.).

c. Position (to 2 decimal places of a minute) of observation point, using GNSS Receiver. Confirm that GNSS positions are referenced to WGS84 datum.

d. Include GNSS receiver model and aerial type (if known). Also of interest: values of PDOP, HDOP or GDOP displayed (indications of theoretical
quality of position fixing depending upon the distribution of satellites overhead) and any other comments.
HYDROGRAPHIC NOTE ± H.102 INSTRUCTIONS (V9.0 Dec 2017)
1. Mariners are requested to notify the United Kingdom Hydrographic Office (UKHO) when new or suspected dangers to
navigation are discovered, changes observed in aids to navigation, or corrections to publications are seen to be necessary.
Mariners can also report any ENC display issues experienced. The Mariner's Handbook (NP100) Chapter 4 gives general
instructions. The provisions of international and national laws should be complied with when forwarding such reports.
2. Accurate position or knowledge of positional error is of great importance. Where latitude and longitude have been used to
specifically position the details of a report, a full description of the method used to obtain the position should be given. Where
possible the position should be fixed by GPS or Astronomical Observations. A full description of the method, equipment,
time, estimated error and datum (where applicable) used should be given. Where the position has been recorded from a
smart phone or tablet, this is to be specifically mentioned. When position is defined by sextant angles or bearings (true or
magnetic to be specified), more than two should be used to provide a redundancy check. Where position is derived from
Electronic Position Fixing (e.g. LORAN C) or distances observed by radar, the raw readings of the system in use should be
quoted wherever possible. Where position is derived after the event, from other observations and / or Dead Reckoning, the
methodology of deriving the position should be included.
3. Paper Charts: A cutting from the largest scale chart is often the best medium for forwarding details, the alterations and
additions being shown thereon in red. When requested, a new copy will be sent in replacement of a chart that has been
used to forward information, or when extensive observations have involved defacement of the observer's chart. If it is
preferred to show the amendments on a tracing of the largest scale chart (rather than on the chart itself) these should be in
red as above, but adequate details from the chart must be traced in black ink to enable the amendments to be fitted correctly.
4. ENCs: A screen shot of the largest scale usage band ENC with the alterations and additions being shown thereon in red.
If it is to report an issue with the display of an ENC, a screen shot of the affected ENC should be sent along with details of
the ECDIS make, model or age and version in use at the time.
5. When soundings are obtained The Mariner's Handbook (NP100) should where possible be consulted. It is important to
ensure that full details of the method of collection are included with the report. This should include but not limited to:
(a) Make, model and type of echo sounder used.
(b) Whether the echo sounder is set to register depths below the surface or below the keel; in the latter case the vessel's
draught should be given.
(c) Time, date and time zone should be given in order that corrections for the height of the tide may be made where
necessary, or a statement made as to what corrections for tide have already been made.
(d) Where larger amounts of bathymetric data have been gathered, only those areas where a significant difference to
the current chart or ENC should be specifically mentioned on the H102. The full data set may also be sent in, with
an additional note added to this effect. If no significant differences are noted, the bathymetric data may still be of
use, and sent in accordingly. Where full data sets are included, a note as to the data owner and their willingness for
the data to be incorporated into charts and ENCs included.
6. FRU (FKR 6RXQGHUV WKDW XVH HOHFWURQLF µUDQJH JDWLQJ¶ FDUH VKRXOG be taken that the correct range scale and
appropriate gate width are in use. Older electro-mechanical echo sounders frequently record signals from echoes
received back after one or more rotations of the stylus have been completed. Thus, with a set whose maximum range is
500m, an echo recorded at 50m may be from depths of 50m, 550m or even 1050m. Soundings recorded beyond the set's
nominal range can usually be recognised by the following:
(a) the trace being weaker than normal for the depth recorded;
(b) the trace passing through the transmission line;
(c) the feathery nature of the trace.
As a check that apparently shoal soundings are not due to echoes received beyond the set's nominal range,
soundings should be continued until reasonable agreement with charted soundings is reached. However,
soundings received after one or more rotations of the stylus can still be useful and should be submitted if they
show significant differences from charted depths.
7. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings should
be stressed and any firm expectation of being able to check the information on a succeeding voyage should be mentioned.
8. Reports of shoal soundings, uncharted dangers and aids to navigation out of order should, at the mariner's discretion, also
be made by radio to the nearest coast radio station. The draught of modern tankers is such that any uncharted depth under
30 metres or 15 fathoms may be of sufficient importance to justify a radio message.
9. Changes to Port Information should be forwarded on Form H.102A and any GPS/Chart Datum observations should be
forwarded on Form H.102B together with Form H.102. Where there is insufficient space on the forms additional sheets
should be used.
10. Reports on ocean currents, magnetic variations and other marine observations should be made in accordance with
The Mariner's Handbook (NP100) Chapter 4 with forms also available at [Link]/MSI.
Note. - An acknowledgement or receipt will be sent and the information then used to the best advantage which may mean
immediate action or inclusion in a revision in due course; for these purposes, the UKHO may make reproductions of any
material supplied. When a Notice to Mariners is issued, the sender's ship or name is quoted as authority unless (as
sometimes happens) the information is also received from other authorities or the sender states that they do not want to
be named by using the appropriate tick box on the form. An explanation of the use made of contributions from all parts of
the world would be too great a task and a further communication should only be expected when the information is of
outstanding value or has unusual features.
Hydrographic Note ± H.102
Reporting information affecting ADMIRALTY Maritime Products & Services

For emergency information affecting safety of life at sea forward to: navwarnings@[Link]
Or alternatively contact T: +44 (0)1823 353448 (direct line) +44 (0)7989 398345 (mobile) F: +44 (0)1823 322352
For new information affecting all ADMIRALTY Charts and Publications forward to: sdr@[Link]
This form H.102 and instructions are available online: [Link]/msi

Date Ref. number


Name of ship or sender IMO number
Address and general locality

E-mail / Tel / Fax of sender

Subject

Position
Latitude Longitude
(see Instruction 2)

GPS Datum Accuracy

ADMIRALTY Charts affected Edition

Latest Weekly Edition of


Notices to Mariners (NMs) held
Replacement copy of chart number IS / IS NOT required
(see Instruction 3)
ENCs affected

Latest update disk applied Week:

Make, model and or age of ECDIS if


applicable
Publications affected
(e-NP / DP number, edition number)
Date of latest supplement/update,
page & Light List number etc.
Details of anomaly / observation:

Name of observer / reporter

H.102A submitted Yes No H.102B submitted Yes No

Tick box if not willing to be named as source of this information

Alternatively use our H-Note App located here:


[Link]/H-note

You might also like