Alzheimers Biomarkers
Alzheimers Biomarkers
OF ALZHEIMER'S DISEASE
No part of this digital document may be reproduced, stored in a retrieval system or transmitted in any form or
by any means. The publisher has taken reasonable care in the preparation of this digital document, but makes no
expressed or implied warranty of any kind and assumes no responsibility for any errors or omissions. No
liability is assumed for incidental or consequential damages in connection with or arising out of information
contained herein. This digital document is sold with the clear understanding that the publisher is not engaged in
rendering legal, medical or any other professional services.
New York
CONTENTS
Preface
ix
Chapter I
Chapter II
11
29
Chapter III
Chapter IV
Chapter V
Chapter VI
Chapter VII
67
81
123
157
vi
Chapter VIII
Chapter IX
Chapter X
Index
Contents
The Leukocyte Expression of CD36 and
other Biomarkers: Risk Indicators of Alzheimers Disease
Antonello E. Rigamonti, Sara M. Bonomo,
Marialuisa Giunta, Eugenio E. Mller,
Maria G. Gagliano and Silvano G. Cella
The Role of Oxidative Stress and Vasoactive Substances
in the Pathophysiology of Alzheimers Disease
Gjumrakch Aliev, Celia J. Cobb, Gerardo Pacheco,
Justin C. Shenk, Paula I. Moreira, Ludis A. Morales,
Kathryn Fischbach, Eldar Gasimov and George Perry
Role of Apolipoprotein E in Neurodegeneration
Carlo Lovati
211
241
265
281
PREFACE
Alzheimers disease (AD) is characterized by the deposition into the brain of amyloid
peptide, which originates a cascade of inflammatory events leading eventually to neuronal
death. These pathological events likely occur several years before the clinical manifestation
of the disease, implying that potential therapeutical interventions are currently started too late
to give beneficial results. Recently, growing attention has been paid to the Mild Cognitive
Impairment (MCI), considered the prodromal phase of AD, as 80% of subjects with MCI
have been shown to develop AD within 5 years. Several studies aimed to identify biological
markers to differentiate between normal aging and incipient AD have been carried out,
including cerebrospinal fluid (CSF) analysis and neuroimaging. In particular, the evaluation
of CSF Amyloid beta (1-42) levels, together with tau and phospotau, are of help for
recognizing early AD. Besides, a number of additional molecules are altered in CSF. Other
early modifications have been observed in peripheral cells, such as fibroblasts and
leukocytes, as well as in serum from patients. Biomarkers for AD represent important tools
supporting the clinical diagnosis and the choice of potential therapeutic options. Moreover,
they would be of great help for the selection of cohorts of homogeneous patients for clinical
trials with new disease-modifying compounds.
This book is aimed to give an update about MCI as prodromal Alzheimers disease (AD),
to discuss the main known pathological mechanisms at the basis of AD and to describe the
possible biomarkers to be used for an early diagnosis of the disease.
Chapter I
ABSTRACT
Mild Cognitive Impairment (MCI) was proposed as a nosological entity referring to
elderly people with mild cognitive deficit but no dementia. In the first criteria for MCI,
which were proposed by Petersen et al in 1997, the emphasis was on the compulsory
presence of memory problems and memory disorders, implying that cases of MCI
represented a fairly uniform group of subjects. The criteria for MCI are the following:
memory complaints of the subject, objective memory disorders considering age, absence
of other cognitive disorders, intact basic activities of daily living, and absence of
dementia. This concept of MCI made it possible to define a group of patients at high risk
of developing dementia, particularly Alzheimer-type dementia, as 80% of MCI subjects
converted to dementia within 5 years. Based on whether predominant memory
impairment was present or not, two primary subtypes were delineated: amnestic and nonamnestic MCI. Regarding MCI diagnosis, the most commonly used rating systems for the
global stagings of cognitive impairment in older adults are the Global Deterioration Scale
and the Clinical Dementia Rating (CDR) scale. According to CDR, MCI had been
defined as score 0.5 of 3, representing the concept of questionable dementia. At present,
no pharmacological treatment has been proven to be effective in MCI subjects.
Correspondence concerning this article should be addressed to: Daniela Galimberti, phone +390255033847; Fax:
+390250320430; e-mail: [email protected].
In 2000, the Canadian Study of Health and Aging (CSHA) defined the concept of
cognitive impairment no dementia (CIND) on the basis of a consensus conference of
physicians, nurses and neuropsychologists [8]. The CIND concept reflects essentially the
presence of cognitive impairment in the absence of dementia, on the basis of clinical and
neuropsychological examination, regardless of its causes (neurological, psychiatric or
medical) and its degree [9]; aging-associated cognitive decline (AACD) was operatively
defined as a history of cognitive decline during at least 6 months, with difficulties in several
cognitive domains including, but not limited to, memory, and with low test scores in the
relevant domains, in absence of dementia [10]; this concept reflect a somewhat different
approach, focusing on patients and families complaints of memory and cognitive loss as
starting point. It is well known that elderly subjects might complain of memory loss as a
result of anxiety, mild depression or dementia in other family members or friends, but at the
same time other studies show that memory complaints in elderly people deserve to be taken
seriously, at least as early sign of actual decline, and investigated properly [11].
Other entities are based solely on test performance, and are called age-consistent
memory impairment and late-life forgetfulness [12]; the stage called questionable
dementia on the Clinical dementia Rating Scale (CDR) [13], rated as 0.5 on a scale of 0 to 3,
represents the same concept of preclinical dementia, but based on history and clinical
judgment, without considering neuropsychological test scores.
The most widely accepted concept to date is termed Mild Cognitive Impairment (MCI),
as defined by Petersen et al in 1999 [14]. Before the definition as an isolated memory deficit,
the term had already been used to define an early stage on the Global deterioration Scale
[15,16]. Having been broadened to include variants with impairments in other cognitive
domains, MCI describes a cognitive state intermediate between normal aging and dementia;
often with the implication that is a risk or prodromal state for AD or other dementias [17].
The clinical validity of MCI concept has been demonstrated both with cross-sectional studies
examining cognitive function [18] and longitudinal studies examining rates of decline in MCI
subjects [14]. However, some Authors argue that MCI cannot be a diagnostic entity, and that
it seems to increase risk not because it creates a predisposition for AD but because 20% of
those with MCI already have AD [19].
3. CLINICAL CONCEPT:
HETEROGENEITY OF MILD COGNITIVE IMPAIRMENT
MCI was proposed as a nosological entity referring to elderly people with mild cognitive
deficit but no dementia. In the first criteria for MCI, which were proposed by Petersen et al in
1997 [20] and 1999 [14], the emphasis was on the compulsory presence of memory problems
and memory disorders, implying that cases of MCI represented a fairly uniform group of
subjects. The criteria for MCI included as follows: memory complaints of the subject
(corroborated by an informant), objective memory disorders considering age, absence of
other cognitive disorders, intact basic activities of daily living, and absence of dementia. This
concept of MCI made it possible to define a group of patients at high risk of developing
dementia, particularly Alzheimer-type dementia. This definition of MCI, however, has been
criticized for being tautological: in fact when the concept of MCI is restricted to memory
disorder only, defined on the basis of tests generally used for the early diagnosis of AD, it
probably leads to the identification of people at a high risk of progression to AD.
As studies of nondemented cognitively impaired individuals expanded, it also became
clear that there were considerable numbers of subjects whose memory impairment was the
predominant but not the only cognitive problem that could be seen. Many individuals with
mild cognitive impairment that evolved to AD were slightly impaired also in domains such as
language or executive functions in addition to memory. Likewise, individuals were found
whose primary cognitive impairment was in domains other than memory (e.g. spatial skill or
attention).
The different clinical presentations of patients commonly observed in clinical contexts
led Petersen et al to propose an extension of the concept in 2001 [21], and in 2004 [22],
considering a syndrome-type classification, based on the clinical evaluation and associated to
different outcomes. Based on whether predominant memory impairment was present or not,
two primary subtypes were delineated: amnestic and non-amnestic MCI [22]. The revised
criteria also acknowledged the possibility that more than one cognitive domain might be
impaired within each of these subtypes (e.g. amnestic MCI, single or multiple domains
impaired). These revised criteria are conceptually similar to CIND concept, as they include a
broad range of cognitive deficits caused by multiple etiologies. In this context, the original
clinical criteria for MCI were clearly focused on amnestic MCI, and it was demonstrated that
amnestic MCI subjects (single or multiple domain impaired) are at increased risk of
progressing to AD over time, whereas single-domain non-memory MCI, characterized by
impairment of a cognitive domain other than memory, are thought to be the transitional phase
between normal aging and other dementias such as vascular dementia, Frontotemporal Lobar
Degeneration, Lewy body dementia and focal atrophy, or psychiatric disorders such as
depression.
Another important source of heterogeneity in MCI clinical concept, both in its severity
and nature, is the setting in which subjects are studied: the broader is the inclusion in a study,
the higher is the probability to include individuals with less severe underlying disease:
studies emerging from memory clinics in tertiary care settings report the highest proportion of
individuals who progress to AD over time [23], whereas studies that recruit broadly from
community are likely to have much lover rates of conversion to AD on follow-up [24].
4. EPIDEMIOLOGY OF MCI
4.1. Incidence
It is quite hard to estimate the incidence of healthy elderly patients who convert to MCI
each year because this would need wide studies on community-based samples. Data from
research clinic sample of cognitively normal elderly indicate a rate of conversion to MCI of
approximately 5%per year [25], whereas other Authors, using a mathematical model,
estimated the incidence of conversion to MCI for patients likely to develop AD to increase at
a rate of 8% per year with different rates according to age groups (0.5% at age 60 years, 2.3
% at age 70 years, 2.3% at age 80 years) [26].
4.2. Prevalence
At present, the prevalence of older individuals meeting the criteria for MCI has not been
clearly estimated. It is obviously expected that their proportion outnumber actually diagnosed
AD cases, because of the long time course of MCI and the great number of unknown cases.
The prevalence of MCI and its subtypes varies greatly in different studies, ranging from
3% to 17% of people over 65 years [27]; these data largely depend on the diagnostic criteria
used and on the type of cohort studied (longitudinal follow-up of cohorts or memory clinic
cohorts). First studies included only amnestic MCI, while more recent studies refer to the
wider concept of MCI. Epidemiological studies also suggest that the progression of MCI is
heterogeneous, and may be reversible, stable or progress to dementia [27-31], usually of the
AD type [32,33].
5. DIAGNOSIS OF MCI
The question as to how approach the diagnosis of MCI is very important. In 2001, the
Quality Standard Subcommittee of the American Academy of Neurology recommended that,
to make an effort to detect MCI early, screening instruments such as Mini Mental State
Examination (MMSE) were found useful, as were neuropsychological batteries [34], but at
present there is no agreement on the recommended way to diagnose or screen for MCI
according to literature, and no clear consensus exists in the literature for a specific diagnostic
approach. In fact, making MCI diagnosis using cut-off scores on established
neuropsychological scales, ignores the possibility that some subjects may have always
performed poorly and have no cognitive deterioration, while other patients might perform
well even in presence of significant deterioration, due to a high pre-morbid performance
level. As in Petersen criteria [14], it is clear that MCI diagnosis requires amnestic
information, documenting a meaningful cognitive deterioration. Thus clinicians must rely on
reports from family members or other informants to describe changes in cognitive
performance. These considerations have led to the development of structured interview with
the patient and with informants. The most commonly used rating systems for the global
staging of cognitive impairment in older adults are the Global Deterioration Scale (GDS) [35]
and the Clinical Dementia Rating scale (CDR) [13]. Many studies have used GDS stage 3 to
define MCI: subtle, clinically manifest cognitive functional impairment that may be of
sufficient magnitude to interfere with complex occupational or social tasks and that may be
accompanied by anxiety; according to CDR MCI had been defined as score 0.5 of 3,
representing the concept of questionable dementia.
REFERENCES
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
Chapter II
ABSTRACT
A marker is a specific sign for detecting indications of an illness and which allows
the disease under investigation to be diagnosed. Various putative neurobiological,
neuroradiological and neuropsychological markers have been designed to detect
Alzheimers Disease (AD). Cognitive markers are distinctive signs of impairment
identifiable through the patients performance in an array of psychometric tests.
An ideal cognitive marker should be capable of attaining levels of sensitivity and
specificity analogous to those of the overall diagnostic evaluation (anamnestic,
neurological, neuroradiological and neuropsychological data in combination with
laboratory findings) which, according to some authors, are around 85-90%. A marker
should be simple to carry out and should be able to provide a confident early diagnosis of
AD. Among the most well-known cognitive markers reported in literature the following
are worth particular mention: the closing-in phenomenon, the presence of globalistic
and odd answers on Raven Coloured Progressive Matrices, intrusion errors, false
recognitions and serial position effects in verbal list-learning tasks, failure in the clock
drawing test and errors in number transcoding. We assessed the accuracy of the main
cognitive markers. Lastly, we present a potential new battery which comprises several
Correspondence concerning this article should be addressed to: A. Monti, e-mail: [email protected].
12
1. INTRODUCTION
The need for screening and diagnostic tests for dementia of the Alzheimer type (AD) is a
growing concern in the scientific community and has given rise to an enormous increase in
research in this field [1]. The diagnosis of AD is a complex procedure that requires, in
addition to other examinations, an assessment of cognitive status. AD is characterised by an
insidious onset of episodic memory impairment associated with a disruption of both
semantic-lexical aspects of language and visual-spatial abilities, and by a progressive
deterioration of the patients personality. It is differentiated from other dementing illnesses by
excluding alternative causes for cognitive dysfunction. Morris et al. [2] estimated that the
criteria put forward by McKhann et al. [3] have an accuracy of 85%, and elsewhere [4] it has
been remarked that there is still a need for in vivo markers capable of better differentiating
AD from other forms of dementia.
The diagnostic framework for AD is complex and well structured, consisting of multiple
levels of analysis: anamnestic, neurological, neuroradiological, and neuropsychological tests
in combination with laboratory findings has allowed clinicians to formulate a hypothesis of
diagnosing AD with a global accuracy of 85-90% [5]. However, due to the large numbers of
clinical investigations, which are lengthy and expensive, researchers are trying to identify a
number of qualitative indices (markers) for the early diagnosis and prognosis of AD. In
general, a marker may be defined as a tool for the detection of specific indications of an
illness, allowing clinicians to identify the disease in question. Various biomarkers,
neuroradiological and neuropsychological markers exist for the detection of AD; patients
performances on several psychometric tests have revealed signs of AD and have led to these
being considered as markers.
An ideal cognitive marker should attain comparable levels of sensitivity and specificity
to those of the overall diagnostic evaluation (anamnestic, neurological, neuroradiological and
neuropsychometric data in combination with laboratory findings), around 85-90% according
to some authors [2,5] as mentioned above. It should, furthermore, be simple, non-invasive
and inexpensive.
13
14
15
determining different values of specificity and sensitivity. These two parameters must be
verified not only in pathological subjects and in normal controls, but also in different forms
of pathology or dementia, such as Vascular Dementia (VAD), Lewy Body Dementia (LBD),
Frontotemporal Dementia (FTD).
Table 2
A number of cognitive markers have been reported in the literature; Table 3 presents a
list of potentially interesting cogmarkers for AD diagnosis and prognosis.
16
17
A third issue raised in the literature concerns emotional distress, such as anxiety or
depression, since intrusions are often present in severely depressed or highly anxious subjects
who are not on medication. Current anticholinergic therapies must also be taken into
consideration because of their possible association with intrusion errors. Further
investigations have only in part confirmed Fuld and co-workers [8] observations [18,19].
In conclusion, intrusion errors may be of interest as a marker. However, although
sensitivity has been extensively confirmed, specificity has not, due to the fact that intrusion
errors also occur in other forms of dementia and in depressive pseudodementia [20,21].
Several potential AD markers in verbal memory tests were studied by Gainotti et al. [4]
who compared AD patients with patients suffering from Progressive Supranuclear Palsy
(PSP), Parkinsons Dementia Complex (PDC), Depressive Pseudodementia (DPD) and Multiinfarct dementia (MID). In particular, the following were evaluated with RAVLT: serial
position effects (i.e. primacy and recency) calculated with a recency/primacy ratio; rate of
forgetting evaluated by computing the ratio between the number of words retrieved both in
immediate and in delayed recall; intrusion errors in free recall evaluated by summing all the
unrelated words reported by the patient in either immediate or delayed recall; false alarms in
delayed recognition calculated by computing the number of distracters wrongly identified by
the patient as belonging to the list. Two additional markers were counted: the closing-in
phenomenon on copy drawing and the presence of odd and globalistic responses in Ravens
Coloured Progressive Matrices (RCPM) [22]. Of all six hypothesised markers, intrusions in
free recall and false alarms in delayed recognition turned out to be the most sensitive
markers, even though they had a lower specificity. On the other hand, other markers such as
the absence of primary effects, absolute memory decay and the closing-in phenomenon had a
higher specificity but a lower sensitivity. In a previous work, analysis of serial position
effects in differentiating between AD and MID populations in the RAVLT, suggested that the
lack of a consistent primacy effect should be considered as a typical cognitive marker of AD
patients since it reflects disruption of the long-term memory system [12]. In fact, while the
recency effect seems to be relatively spared, primacy is impaired.
Fuld et al. [8] and subsequently Gainotti and co-workers [12] found false positive errors
in delayed recognition, interpreted as an index of the degree of interference that previously
learned material exerts upon the memorandum in the long-term memory system, to be a
typical neuropsychological marker of AD.
Bondi et al. [23] used Delis et als [24] California Verbal Learning Test (CVLT) to
assess longitudinally the mnemonic performance of 56 non-demented elderly individuals,
potential candidates for AD. They found that in addition to poor learning and retention
following a delay interval, subjects with a positive family history of dementia also exhibited
more intrusion errors and heightened recency effects, compared with a matched group of
elderly patients with a negative family history of dementia. This is characteristic of memory
decline in AD patients. However, no data concerning the sensitivity and sensibility of these
markers was reported.
Howieson et al. [25] applied a series of cognitive markers to evaluate the preclinical
phase of AD in a prospective and longitudinal study. They found that the best single predictor
of conversion to AD was performance in the story recall task in the Logical Memory II at the
Wechsler Memory Scale-Revised (WMS-R) [26].
18
In summary, although memory indices seem to be the most promising cognitive markers
of AD, there is still a need for studies that take into account satisfactory levels of both
sensitivity and specificity.
As reported above, researchers have focussed not only on verbal memory but also on
visual-spatial functions in seeking possible neuropsychological markers of AD in domains
other than memory. In particular, some authors have focussed their attention on certain
behavioural patterns observed during the execution of visual-spatial tasks, such as the
tendency to give particular answers to the RCPM [22], a phenomenon evident in performing
copy drawing tasks, as well as impaired clock drawing.
RCPM is a widely used non-verbal reasoning test based on visual-spatial ability,
consisting of 36 incomplete coloured designs. The test contains three sections (A, Ab, and B)
each of which comprises 12 items. Subjects are presented with an incomplete design and six
alternatives from which the one which best completes the design must be chosen. The items
increase in difficulty over a given section and across the three sections. Costa et al. [27]
pointed out that the three sections (A, Ab, and B) are based on different processes: set A
mainly checks visual-spatial ability, set Ab gestalt-like processing and set B analogical and
abstract thinking. Each correctly solved item results in a score of 1 but qualitative errors are
also observed; there are in fact three different categories of incorrect responses: spatially
incorrect responses in which the correct form to complete the model is presented in an
incorrect spatial orientation; globalistic responses which reproduce the whole shape of the
model but on a reduced scale, and odd responses which differ completely to the missing part
and to the form of the model. This test is an attractive instrument for measuring fluid
intelligence in older populations because little verbal instruction is needed and because of its
culture-neutrality.
19
In Ravens [28] seminal work, it was noted that globalistic and odd responses, as
primitive answers, are generally observed in children and in conditions of severe brain
pathology. In 1992, Gainotti and colleagues [10] reported that in their clinical experience
globalistic and odd responses were more frequent in demented patients or in subjects with
widespread pathology than in patients affected by focal brain lesions (see Figure 2 for some
examples). These authors studied a group of patients (41 affected by AD and 34 affected by
vascular dementia-VAD) compared with 50 normal subjects carefully matched for age and
education. They sought to determine whether odd and globalistic responses in the RCPM
would be a good marker of dementia (both AD and VAD) and whether the incidence of these
types of error is similar in the two dementia groups. The results showed that these primitive
errors were extremely rare in normal controls and much more frequent in demented patients.
Errors were not equally distributed in the two forms of dementia, but were significantly more
frequent in AD than in VAD.
Monti et al. [29] recently extended the research instigated in the previous study. Their
sample was made up of 190 subjects (96 males and 94 females), 160 of whom had been
submitted to a neuropsychological assessment and referred to an Alzheimer Evaluation Unit.
Various cognitive domains were investigated: global cognitive functions, attention, executive
functions, language, problem solving, memory, visual-spatial functions, praxis and visual
recognition. Seventy-one of these subjects were diagnosed as AD according to the
NINCDS/ADRDA criteria [3]; 43 as MID (Multi-Infarct Dementia), according to the
NINDS-AIREN criteria [30]; 18 as SCD (Sub-Cortical Dementia), according to criteria
suggested by Kalra et al. [31]; 28 as DPD (Depressive Pseudo-Dementia), according to
criteria suggested by Reynolds et al. [32]. The control group consisted of thirty normal
subjects (comparable to the groups of demented patients in terms of age and education),
unaffected by focal or diffuse lesions and not demented. A qualitative analysis of the
tendency to give primitive answers in RCPM showed differences between the demented and
non-demented patients and also between the different etiological forms of dementia. The
specificity of this marker was good (98%), although its sensitivity was only 4.2%. In
summary, the results of this investigation showed that this clinical index is capable of
identifying AD patients at an acceptable level of specificity but is not sensitive enough to be
considered a good diagnostic marker alone for early forms of cognitive impairment. The
authors claim that when more than one cognitive marker is taken into account, a higher level
of sensitivity and specificity is attained.
Another visual-spatial task which has been considered as a marker is the closing-in
phenomenon, described by Mayer Gross in 1935 as the tendency to close in on a model while
performing a constructive task [33] (see Figure 3 for some examples). This phenomenon has
been studied in various pathological conditions [34]. In an analytical study Kwack and
colleagues [9] defined the closing-in phenomenon as the tendency of a subject to make a
copy of a model shape as close as possible to, or even within, the original, compared to
younger control subjects. In their work a subject was asked by an examiner to draw a copy of
a model shape below the original on a piece of paper but was not provided with a suggested
starting point. The authors analysed the distance between the original and copied shapes and
distinguished three different types of closing-in phenomena: the overlap type, consisting in
the tendency to overlap the lines of the model with the copy; the adherent type, consisting in
20
the tendency to make copies very close to, or adhering to, the model; and finally the near
type, consisting in the tendency for the copy end point to be located close to the original
model.
Gainotti [35] described the tendency to copy as near as possible to the model, or even
into it, in both children and brain damaged patients; he also showed that this trend is rarely
observed in patients with focal brain lesion, whereas it is commonly observed in demented
patients, its frequency increasing with the progression of the pathology. In 1992, Gainotti et
al. [10] considered the closing-in phenomenon in a group of patients (41 AD and 34 VAD)
compared with 50 normal subjects carefully matched for age and education. They studied
subjects behaviour during the execution of two types of drawing tasks, which consisted
firstly in a simple copy of a model (a square, a cube, a house) and secondly, in the copying of
a model with the help of programmation elements (landmarks). The results showed that none
of the normal controls tended to pass the pencil over the lines of the model or from the model
to the surrounding space (a classic variant of closing-in), nor did they tend to make a series of
independent drawings in close proximity to each landmark (variant of the closing-in). AD
patients presented both varieties more frequently than VAD patients. The classical form was
observed in 24% of AD patients and in only 6% of VAD patients, hence rather specific; the
variant version was observed in a greater number of AD patients (61%) but it was less
specific in VAD patients (30%).
Flebus et al. [36] studied 52 patients (20 males and 32 females) following
neuropsychological assessment in order to determine whether the closing-in phenomenon is a
good marker of dementia and to evaluate the sensitivity and the specificity of this test as a
diagnostic marker of AD. Different cognitive domains were investigated: global cognitive
function, attention, executive functions, language, problem solving, memory, visual-spatial
functions, praxis and visual recognition. Twenty-five of these subjects were diagnosed as
AD; 14 as MID (Multi-Infarct Dementia); 13 as other forms of dementia. Fifty-four normal
subjects, not demented nor affected by focal or diffuse lesions (matched with the groups of
21
demented patients for age and education) formed the control group. A statistically significant
correlation between the presence of the closing-in phenomenon and low scores on the MMSE
(Mini-Mental State Examination) was found, its absence correlating with high scores (rpb= 0.424 p < 0.005). This marker is therefore capable of identifying AD patients at an acceptable
level of specificity (85%), although the level of sensitivity (20%) is insufficient. The study
thus showed that by itself this marker cannot be considered a good diagnostic tool in the
initial stages of AD. Again, it seems that a higher level of sensitivity and specificity could be
reached by taking more than one cognitive marker into consideration.
Another promising tool, which provides a simple and reliable measure of visual-spatial
ability, is the Clock Drawing Test. This is a simple test, which can be used as part of a
neurological battery or as a screening tool for AD and other types of dementia. The person
undergoing testing is asked to draw a clock on a white sheet of paper, put in all the numbers
and set the hands at ten past eleven. The correct drawing of a clock seems to require the
integrity of several cognitive functions in addition to constructional praxis. It has been
proposed as a possible screening instrument for dementia in more than one study, although
several different versions and scoring methods exist. Wolf-Klein et al. [37] pointed out that
this task has a 65.2% sensitivity and 82% specificity in identifying AD patients. Tuokko et al.
[38] found 86% sensitivity and 92% specificity when comparing AD patients with normal
controls matched for age. Casartelli et al., [39] concluded that, with high sensitivity (92%)
and specificity (82.6%) values in identifying demented subjects and with a predictive positive
test value of 40%, this test could be useful as a basic screening tool for cognitive impairment
in the elderly. However, sensitivity may vary according to the level of cognitive impairment
and it could, furthermore, give rise to false positives in poorly educated people. It seems,
therefore, that it would be preferable to use this test in conjunction with other markers (see
Figure 4 for an example of clock drawing).
Figure 4. Example of the clock drawing test with a pre-drawn circle, performed by an AD patient.
22
Another promising task involved transcoding from Arabic to verbal code, or vice versa,
the errors being considered a particular early specific indication of disease. In an initial study,
Tegnr and Nybck [40] observed that AD patients often expressed numerical information in
a mixture of verbal and digital codes (e.g. 24twenty4our, 2742hundred and seventyfour). Eleven of the 13 patients assessed as AD exhibited these types of intrusion errors and
the authors concluded that numerical transcoding may be a simple bedside test for
dementia. Kessler and Kalbe [41] asked 12 AD patients and 22 normal subjects matched for
age to transcode from verbal to digital codes and vice versa. They observed both intrusions
and perseverations and found that intrusions were frequent in some AD patients but largely
absent from the transcoding operations of healthy populations and patients with other kinds
of brain damage, such as aphasia. Thioux, Seron, Turconi and Ivanoiu [42], reporting a single
case study, suggested that occurrences of intrusion errors and perseveration transcoding
errors may be particular early indications of AD. Della Sala et al. [43] expanded on this
research by analysing the error patterns of 20 AD patients and a group of age-matched
controls in six transcoding tasks (two with spoken and four with written input). The responses
were classified into nine different types of trancoding and confirmed the extreme rarity of
intrusions in the healthy population. However, their findings and those of other studies
reported in the literature did not corroborate claims that these types of error are peculiar to
AD nor that they appear at the earlier stages of the disease. Seven out of the 20 AD patients
made no intrusion errors at all over the 260 transcoding trials, and the severity of the disease
appeared to be a significant factor.
As for other markers, future studies examining the specificity and sensitivity of
numerical transcoding errors in different stages of AD and the presence of such errors in
other types of dementia seem to be necessary.
Gainotti et al. [4] studied six markers and stressed that none of the AD markers was
sensitive and specific enough by itself to be considered a good diagnostic tool. With the aim
of finding a more balanced relationship between sensitivity and specificity the authors
proposed a cumulative method in which two or more markers were computed by each
patient. Most AD patients responded positively to two or more markers whereas non-AD
patients responded to less then two. Taking the presence of two or more markers as a global
index suggestive of AD dementia, Gainotti et al. [4] reported a sensitivity of 88% and a
specificity of 87%.
Taking up this idea, Zago and collaborators [44] developed a new battery labelled CogMarkers which combines the principal markers previously discussed in the literature, in order
to increasing the diagnostic power of the cumulative method suggested by Gainotti et al. [4].
The battery consists of eight markers which are presented to the patient in this way: (1)
personal, temporal and spatial orientation, (2) written numerical transcoding, (3) an adapted
version of 15 Reys Words, (4) closing-in phenomenon on copy and the tendency to make the
copy very near or adherent to the model, (5) Clock Drawing Test, (6) an adapted version of
Buschkes Free and Cued Selective Reminding Test (FCSR), (7) an adapted version of
RCPM, (8) cognitive estimations and absurdities tests. A different procedure was used for
calculating each sub-test score (marker) with a maximum global score of 164.
The battery was administered to two groups of subjects (52 normal controls and 31
patients diagnosed as probable AD using clinical criteria) matched for age (range 70-89
23
years), years of schooling (range 3-13 years) and sex. Using as a cut-off the subtraction of
two standard deviations from the mean of elderly normal subjects (95/164) a clear distinction
in cognitive performance between AD patients and the elderly normal control subjects was
documented (see Figure 5). In particular, only one AD patient obtained higher score values.
Figure 5. Graph showing the clear distinction in cognitive performance between AD patients and
elderly normal control subjects.
3. CONCLUSIONS
The studies presented in this chapter illustrate that several qualitative cognitive indices
may serve as clinical markers for detecting AD. However, a measure of sensitivity and
specificity is lacking in many investigations, and none of the cognitive markers individually
considered seems to reach satisfactory values of specificity and sensitivity, especially in the
early stages of the disease. Thus, at present, no single cognitive marker is sufficient alone.
24
Hypothesising that by combining various markers to obtain a sort of global index, higher
levels of sensitivity and specificity could be attained; an attempt was made to apply the
cumulative method suggested by Gainotti et al. [4]. Zago and co-workers [44] proposed a
new battery in which a set of eight markers were combined, providing support for the use of
multiple accepted AD markers in the identification of AD patients. This strategy provides a
promising approach to the development of new tools for the early detection of AD.
REFERENCES
[1]
Dubois, B., Feldman, H.H., Jacova, C., DeKosky S.T., Barberger-Gateau P., Cummings
J., Delacourte A., Galasko D., Gautier S., Jicha G., Meguro K., OBrien J., Pasquier F.,
Robert P., Rossor M., Salloway S., Stern Y., Visser P.J. & Scheltens P., (2007).
Research criteria for the diagnosis of Alzheimers disease: revising the NINCDSADRDA criteria. Lancet Neurology, 6, 734-746.
[2] Morris, J.C., McKeel, D.W., Fulling, K., Torack, R.M. & Berg, L. (1988). Validation
of clinical diagnosis criteria for Alzheimers disease. Neurology, 38, 17-22.
[3] McKhann, G., Drachman, D., Folstein, M., Katzman, R., Price, D. & Stadlan,
E.M.(1984). Clinical diagnosis of Alzheimer's disease: report of the NINCDS-ADRDA
Work Group under Auspices of Department of Health and Human Services Task Force
on Alzheimer's Disease. Neurology, 34, 939-944.
[4] Gainotti, G., Marra, C., Villa, G., Parlato, V. & Chiaretti, F. (1998). Sensitivity and
specificity of some neuropsychological markers of Alzheimer Dementia. Alzheimer
Disease and Associated Disorders, 12, 152-162.
[5] Small, G.W. (1998). Differential diagnosis and early detection of dementia. American
Journal of Geriatric Psychiatry, 6, S26-S33.
[6] Jaeschke, R., Guyatt, G. & Sackett, D.L. (1994). Users' guides to the medical literature.
III. How to use an article about a diagnostic test. A. Are the results of the study valid?
Evidence-Based Medicine Working Group. Journal of the American Medical
Association, 271 , 389-391.
[7] Gifford, D.R., Mittman, B.S. & Vickrey, B.G. (1996). Diagnostic reasoning in
neurology. Neurologic Clinics, 14, 223-238.
[8] Fuld, P.A., Katzman, R., Davies, P. & Terry, R.D. (1982). Intrusions as a sign of
Alzheimer Dementia: chemical and pathological verification. Annals of Neurology, 11,
155-159.
[9] Kwak, Y.T. (2004). "Closing-in" phenomenon in Alzheimer's disease and subcortical
vascular dementia. BMC Neurology, doi: 10.1186/1471-2377-4-3.
[10] Gainotti, G., Parlato, V., Monteleone, D. & Carlomagno, S. (1992).
Neuropsychological markers of dementia on visual-spatial tasks: a comparison between
Alzheimers type and vascular forms of dementia. Journal of Clinical and
Experimental Neuropsychology, 14, 239-252.
[11] Spinnler, H.S., Della Sala, S., Bandera, S. & Baddeley, A. (1988). Dementia, aging and
the structure of human memory. Cognitive Neuropsychology, 5, 153-211.
25
[12] Gainotti, G., Parlato, V., Monteleone, D. & Carlomagno, S. (1989). Verbal memory
disorders in Azheimers disease and multi-infarct dementia. Journal of
Neurolinguistics, 3-4, 327-345.
[13] Kramer, J.M., Levin, B.E., Brandt, J. & Delis, D.C. (1989). Differentiation of
Alzheimers, Huntingtons and Parkinsons disease patients on the basis of verbal
learning characteristics. Neuropsychologia, 3, 111-120.
[14] Welsh, K., Butters, N., Hughes, J., Mohs, R. & Heyman, A. (1991). Detection of
abnormal memory decline in mild cases of Alzheimers disease using CERAD
neuropsychological measures. Archives of Neurology, 53, 245-249.
[15] Gainotti G. & Marra C. (1994). Some aspects of memory disorders clearly distnguish
dementia of the Alzheimers type fron depressive pseudo-dementia. Journal of Clinical
and Experimental Neuropsychology, 16, 65-78.
[16] Drachman, D.A. & Leavitt, J. (1972). Memory impairment in the aged: storage versus
retrieval deficit. Journal of Experimental Psychology, 93, 302-308.
[17] Smith, C.M. & Swash, M. (1979). Effect of cholinergic drugs on memory in patients
with Alzheimers disease. Presented at the International Society for Neurochemistry
Satellite Meeting on Aging of the Brain and Dementia, Florence, Italy, Aug 27-29.
[18] Gordon, B., Whitehouse, P.J., Cockrell, J.R., Mroz, B.J. & Steele, C. (1984). Intrusive
errors in Alzheimers and amnesia: Memory deficits in primary cause. Neurology, 34,
102.
[19] Loewenstein, D., DElia, L., Guterman, A., Eisdorfer, C., Wilkie, F., La Rue, A.,
Mintzer, J., & Duara, R. (1991). The occurence of different intrusive errors in patients
with Alzheimers disease, multiple cerebral infarctions and major depression. Brain
and Cognition, 16, 104-117.
[20] Gellin Shindler, A., Caplan, L.R. & Hier, D.B. (1984). Intrusions and perseverations,
Brain and Language, 23, 148-158.
[21] Dalla Barba, G., Parlato, V., Iavarone, A. & Boller, F. (1995). Anosognosia, intrusions
and frontal functions in Alzheimers disease and depression, Neuropsychologia, 33,
247-260.
[22] Raven, J.C. (1962). Coloured Progressive Matrices Sets A, AB, B. London: H.K. Lewis
(originally published in 1947, revised in 1956).
[23] Bondi, M.W., Monsch, A.U., Galasko, D., Butters, N., Salmon, D.P. & Delis, C.
(1994). Preclinical cognitive markers of dementia of the Alzheimer type.
Neuropsychology, 8, 374-384.
[24] Delis, D.C., Kramer, J.H., Kaplan, E. & Ober, B.A. (1987). California Verbal Learning
Test. San Antonio, TX: Psychological Corporation.
[25] Howieson, D.B., Dame, A., Camicioli, R., Sexton, G., Payami, H. & Kaye, J.A. (1997).
Cognitive markers preceding Alzheimers dementia in the healthy oldest old. Journal
of the American Geriatrics Society, 45, 584589.
[26] Wechsler, D. (1987). The Wechsler Memory Scale-Revised Manual. New York:
Psychological Corporation.
[27] Costa, L.D., Vanghan, H.G., Horwitz, M. & Ritter, W. (1969). Patterns of behavioral
deficit associated with visual spatial neglect. Cortex, 5, 242-263.
26
[28] Raven, J.C. (1973). Guide to using the Coloured Progressive Matrices. London: H.K.
Lewis.
[29] Monti, A., Zago, S., Poletti, B. & Flebus, G.B. (2005). Neuropsychological marker on
Ravens CPM. Atti della VIII Riunione Scientifica ITINAD (Italian Interdisciplinary
Network on Alzheimer Disease), Sorrento 26-28 maggio.
[30] Roman, G.C., Tatemichi, T.K., Erkinjuntti, T., Cummings, J.L., Masdeu, J.C., Garcia,
J.H., Amaducci, L., Orgogozo, J.M., Brun, A., Hofman, A., Moody, D.M., OBien,
M.D., Yanmaguchi, T., Grafman, J., Drayer, B.P., Bennet, D.A., Ficher, M., Ogata, J.,
Kokomen, E., Bernejo, F., Wolf, P.A., Gorelick, P.B., Bicj, K.L., Pajeau, K.L., Bell,
M.A., De Carli, C., Culebras, A., Korczyn, A.D., Bobousslavsky, J., Hartmann, A. &
Schenberg P. (1993). Vascular dementia: diagnostic criteria for research studies. Report
of the NINDS-AIREN International Workshop. Neurology: 43, 250-260.
[31] Kalra, S., Bergeron, C. & Lang A.E. (1996). Lewy body Disease and Dementia. A
review. Archives of Internal Medicine, 156, 487-493.
[32] Reynolds, C.F., Kupfer, D.J., Hoch, C.C., Stack, J.A., Houck, P.R., Sewitch, D.E.
(1986). Two years follow-up of elderly patients with mixed depression and dementia.
Clinical and electroencephalographic sleep findings. Journal of the American
Geriatrics Society, 34, 793-819.
[33] Mayer Gross, W. (1936) Further observation on apraxia. Journal of Mental Science, 82,
744-762.
[34] Muncie, W. (1938). Concrete model and abstract copy: a psychobiological
interpretation of the closing-in symptom of Mayer Gross. Journal of Nervous and
Mental Disease, 88, 1-11.
[35] Gainotti, G. (1972). A quantitative study of the closing-in symptom in normal
children and in brain-damaged patients. Neuropsychologia, 10, 1429-1436.
[36] Flebus, G.B., Zago, S., Monti, A., Poletti, B. (2005). Closing-in as an Alzheimer
disease neuropsychological marker: sensitivity and specificity. Atti della VIII Riunione
Scientifica ITINAD (Italian Interdisciplinary Network on Alzheimer Disease), Sorrento
26-28 maggio.
[37] Wolf Klein, G.P., Silverstone, F.A., Levy, A.P. & Brod M.S. e Breuer J. (1989).
Screening for Alzheimers disease by clock drawing. Journal of the American
Geriatrics Society, 37, 730-734.
[38] Tuokko, H., Hadjistavropoulos, T., Miller, J.A., Beattie, B.L. (1992). The clock test: a
sensitive measure to differentiate normal elderly from those with Alzheimer's disease.
Journal of the American Geriatrics Society, 40, 579-84.
[39] Casartelli, M., Caputo, L., Pesavento, N., Lucchi, T., Annoni, G. & Vergani, C. (1995).
Il test del disegno dellorologio come strumento di screening delle funzioni cognitive
nel soggetto anziano. Ricerche di Psicologia, 19, 87-101.
[40] Tegnr, R. & Nybck, R. (1990). To hundred and twenty4our: a study of trancoding
in dementia. Acta Neurologica Scandinavica, 81, 177-178.
[41] Kessler, J. & Kalbe, E. (1996). Written numerical transcoding in patients with
Alzheimers disease. Cortex, 32, 755-761.
27
[42] Thioux, M., Seron, X., Turconi, E. & Ivanoiu, A. (1999). Intrusions of the verbal code
during the production of Arabic numerals: a single case study in a patient with probable
Alzhemeirs disease. Cognitive Neuropsychology, 16, 749-773.
[43] Della Sala, S., Gentileschi, V., Gray, C. & Spinnler, H. (2000). Intrusion errors in
numerical transcoding by Alzheimer patients. Neuropsychologia, 38, 768-777.
[44] Zago, S., Poletti, B., Monti, A., Ferrucci, R. (2005). Cog-Markers: standardizzazione e
taratura di un nuovo strumento per la diagnosi e la stadiazione della malattia di
Alzheimer. Atti della VIII Riunione Scientifica ITINAD (Italian Interdisciplinary
Network on Alzheimer Disease), Sorrento 26-28 maggio.
Chapter III
ABSTRACT
The demographics of aging suggest a great need for an early diagnosis of dementia
and for the development of preventive strategies.
Neurodegeneration in Alzheimers disease (AD) is estimated to start even 2030
years before clinical onset, and the identification of biological markers for pre-clinical
and early diagnosis is the principal aim of research studies in the field.
It is still difficult to make diagnosis in the early disease stages. At the beginning the
patient might have a deficit limited to memory or to another single cognitive domain,
without any disorder of instrumental and daily activities. The cognitive impairment then
might proceed to a degree that allows the diagnosis of dementia. The transitional state
between normal ageing and mild dementia has been recently indicated by the term Mild
Cognitive Impairment (MCI).
In the last few years, a wide range of studies addressed this topic. Clinically, within
the group of MCI subjects, two separate subgroups have been described, those rapidly
converting to AD (MCI converters), in whom MCI represents the early stage of an
ongoing AD-related process, and those who remain stable (MCI non-converters), in
whom the isolated cognitive deficits represent a different condition without an increased
risk to develop dementia at short follow-up.
In this line, reliable markers for early AD detection could be useful both for
prognosis, and for identifying a potential target for therapeutic intervention, since
treatments are emerging which rather than reversing structural damage are likely to slow
or halt the disease process.
Correspondence concerning this article should be addressed to: Valentina Garibotto, [email protected].
30
1. INTRODUCTION
Age is a major risk factor for neurodegenerative diseases in general and particularly for
dementia. Dementia represents a major burden for many countries where life expectancy and
therefore proportion of aged people is growing: the incidence of dementia is expected to
double during the next 20 years (Katzman and Fox, 1999). Alzheimers disease (AD) is the
most common cause of dementia in all age groups, and account for the 50 to 75% of all cases
(Kawas, 2003).
This prospect has led to a considerable effort to unravel the pathophysiologic
mechanisms of AD and for the development of effective treatments against this devastating
disease. Over the last years, significant progress in the understanding of some of the
pathophysiologic mechanisms involved in AD has been made (Dickson, 2003).
The impairment of cognitive functions in dementia is the consequence of a severe loss of
functioning synapses and neurons in the brain, in particular in limbic and neocortical
association areas.
Histopathologically, AD is characterized by the accumulation of senile plaques and
neurofibrillary tangles. Whereas the senile plaques consist mainly of -amyloid peptides, the
fibrillary tangles consist of abnormal hyperphosphorylated insoluble forms of the -protein.
Not much is known about how these two lesions influence each other, e.g., if the
hyperphosphorylation of -proteins is triggered by the accumulation of -amyloid oligomers
(amyloid cascade hypothesis) or if a defect in the -protein leads to an accumulation of amyloid ( and tangle hypothesis) (Morris and Mucke, 2006). Both lesions can exert direct
and indirect neurotoxic effects and promote neuronal death by inducing oxidative stress and
inflammation (DeKosky, 2003; Pratic et al., 2002).
The neurofibrillary pathology in AD develops at first in the transentorhinal and
entorhinal regions, then spreads into the hippocampus, the limbic system, and finally to
neocortical regions (Braak and Braak, 1991).
31
While the pathway of the neurofibrillary tangles is very precise, the amyloid deposition
seems to be more heterogeneous and random, starting first in neocortical regions before it
affects allocortical regions and diencephalic structures (Dickson, 2003; Gtz et al., 2004;
Mudher and Lovestone, 2002; Soto, 2003; Taylor et al., 2002). The analysis of the amino
acid sequence of -amyloid allowed for the identification of the gene encoding its precursor,
the -amyloid precursor protein (APP) on chromosome 21, and thus for the identification of
the first series of mutations associated with increased amyloid production and AD. However,
such mutations account only for a small percentage of AD cases. The majority of AD patients
suffer from sporadic AD for which several risk factors in addition to age have been proposed
and are currently being explored, e.g., apolipoprotein E4 (ApoE4), hyperhomocysteinemia,
hyperlipidemia, and disturbances of the neuronal insulin signal transduction pathway
(Bertram and Tanzi, 2004).
Effective treatment is eagerly awaited. Some drugs that have a moderate symptomatic
effect, such as the cholinesterase inhibitors, are already available and some studies indicate
that they are able to postpone progression by several months (Winblad et al., 2006). Although
the etiology of AD is still not completely clear, the increasing knowledge about some of the
most important pathomechanisms in AD allows now for the first time to develop drugs aimed
at modifying particular aspects of the AD disease process, e.g., anti-inflammatory drugs,
statins, antioxidants, acetylcholinesterase inhibitors, and secretase inhibitors, sheet
disruptors, immunotherapy, neuro-protective agents, or neuroregenerative treatments (see
(Dickson, 2003; Irizarry and Hyman, 2001; Knopman, 2006; Mayeux and Sano, 1999;
Mudher and Lovestone, 2002) for more detailed reviews). Some of these compounds showed
promising results in animal models and are currently being tested in clinical treatment trials
in AD patients. In any case, an efficient treatment needs to be installed before a large number
of synapses and neurons have been damaged irreversibly, and therefore early markers of
disease have a central role.
32
gold standards, reach a diagnostic accuracy ranging from 6596%, and a specificity against
other dementias of only 2388% (Dubois et al., 2007).
This low specificity likely reflects the fact that AD shares many clinical features with
other forms of dementia, and must be addressed through both revised AD and accurate nonAD dementia diagnostic criteria.
Although clinical criteria for the diagnosis of AD in the early to middle stages of the
disease may not be perfect, its diagnosis in the very early or asymptomatic stage is an even
greater challenge. There is now increasing evidence that the molecular pathomechanisms of
AD become active several years before neurons start dying and cognitive deficits manifest
(DeKosky and Marek, 2003).
During this stage, an effective treatment of AD would have the greatest impact because
the cognitive function could be preserved at the highest level possible. Consequently, there
has been considerable interest in recent years to characterize the earliest clinical signs of the
degenerative process that is likely to evolve to AD. This effort led to the development of the
concept of Mild Cognitive Impairment (MCI), which represents the transitional zone between
normal aging and AD. Subjects with MCI are not demented but have significant but very
mild deficits in one or more cognitive domains and have an increased risk of dementia
(Petersen et al., 2001; Winblad et al., 2004). Depending on which cognitive domains are
impaired, different subtypes of MCI can be distinguished. The subtype most relevant for AD
is amnestic MCI, which is defined by the presence of subjective memory problems and an
objective memory impairment relative to the appropriate reference group, but otherwise
normal general cognitive functions and largely preserved activities of daily living (Petersen,
2004).
The annual conversion rate of amnestic MCI to AD is about 15% (range, 6% to 25%) per
year, which is considerably higher than the conversion rate of 1% to 2% per year observed
for age-matched non-MCI subjects (Gauthier et al., 2006). Histopathologic studies have
found that MCI subjects, as a group, usually have intermediate levels of AD pathology
compared with healthy controls and subjects with probable or possible AD (Bennett et al.,
2005). However, whereas the concept of MCI is very useful to identify a group of subjects
with a high risk of conversion to AD, it includes also a non-negligible number of subjects
whose disease never converts to AD, or in whom a different form of dementia will develop
and thus with different prognosis and perhaps no benefit from AD-specific treatment.
Therefore, additional measures that might help to more reliably distinguish between these
two MCI categories are needed.
Because of the limitations of clinical and neuropsychological measures for diagnosis and
monitoring of treatment effects, there has been considerable effort recently to identify
additional biomarkers that might provide complementary information. Diagnostic markers
will be also required to support treatment of patients at risk for AD. Of equal significance are
markers with the capacity to monitor the underlying biological burden of disease in terms of
extent and intensity. These markers will eventually prove to be important surrogate outcome
measures in clinical trials supplementing existing clinical data.
Potential biomarkers include blood and CSF measurements of protein concentrations,
gene screening, and also, importantly, neuroimaging.
33
3. NEUROIMAGING AS BIOMARKER IN AD
Traditionally, imaging, and in particular structural imaging, has been used to exclude
potentially reversible brain processes mimicking the clinical symptoms of AD, e.g., brain
tumours or epidural haematomas.
Recently, however, the potential of neuroimaging, not only to improve the accuracy of
the clinical diagnosis of AD, but also to monitor disease progression and treatment effects,
has been increasingly recognized.
Imaging might be particularly helpful in providing a marker for disease in early and
preclinical phases of AD. Attributes of neuroimaging that make it even superior to
neuropsychological tests in AD include increased diagnostic accuracy, freedom from
ethnic/cultural bias for interpretation, independence from level or quality of education, and
rater-independent objective measures of brain function (Zamrini et al., 2004).
Power analyses showed that neuroimaging as outcome markers in treatment trials would
allow for substantially smaller patient populations and shorter observation times than
cognitive or clinical outcome measures currently do. Alexander and colleagues calculated
that 36 patients in each group (placebo or drug group) would be needed to detect a 33%
treatment response with 80% power in a 1-year PET study (Alexander et al., 2002). Jack and
colleagues determined that 69 patients in each group would be necessary to detect a 25%
treatment effect with 90% power in a 1-year MRI study (Jack et al., 2004). In comparison, at
least 1277 patients in each arm would be necessary to detect a 25% treatment effect with 90%
power with a cognitive outcome measure (Alexander et al., 2002; Fox et al., 2000; Jack et al.,
2004; Reiman et al., 2001).
Recent reviews discuss in detail the increasingly important role played by neuroimaging
in clinical trials (Cummings et al., 2007; Thal et al., 2006).
There are two main categories of neuroimaging:
1. structural imaging, which includes Computer-assisted Tomography (CT) and
Magnetic Resonance Imaging (MRI)
2. functional imaging, which includes emission tomography techniques, such as Single
Photon Emission Computed Tomography (SPECT) and Positron Emission
Tomography (PET), and functional Magnetic Resonance Imaging (fMRI).
34
35
Unfortunately, neuron loss and atrophy are not specific for AD but are also found in
normal aging or other neurodegenerative diseases.
However, large cross-sectional and longitudinal studies have shown that there are
substantial qualitative and quantitative differences in pattern and rate of atrophy in aging and
AD, which allow a differentiation of these two processes.
For example, in normal aging, rates of global atrophy typically increase from 0.2% per
year at age 30 to 50 to 0.3% to 0.5% per year at age 70 to 80 and affect frontal and parietal
grey matter more than occipital and temporal grey matter, whereas changes in white matter
are more diffuse (Resnick et al., 2003). In AD, brain atrophy rates are significantly higher,
i.e., up to 2% to 3 % per year (Fox and Schott, 2004; Gunter et al., 2003) and so are atrophy
rates of hippocampus (controls, 1.0% to 1.2% per year; AD, 3.0% to 5.9% per year) and in
entorhinal cortex (controls, 1.4% to 2.9% per year; AD, 7.1% to 8.4% per year), all structures
known to be affected early in AD (Du et al., 2004; Jack et al., 2004).
MCI patients have significant hippocampal atrophy when compared to aged normal
controls. When comparing patients with probable AD to MCI subjects, hippocampal region
atrophy significantly extends to the neighboring temporal association neocortex (Chetelat and
Baron, 2003). Comparing the initial MRI data of at-risk subjects who convert to AD at
follow-up to those of non-converters suggests that a reduced association temporal neocortex
volume combined with hippocampal or anterior cingulate cortex atrophy may be the best
predictor of progression to AD (Dickerson et al., 2001; Visser et al., 1999). A recent
longitudinal study has specifically addressed this issue, observing a significantly greater gray
matter loss in converters relative to non-converters in the hippocampal area, inferior and
middle temporal gyrus, posterior cingulate, and precuneus (Boxer et al., 2006).
Figure 1. Results of a voxel based morphometry analysis of grey matter atrophy in patients with
Frontotemporal Dementia (FTD), showing a different pattern of atrophy in the two major clinical
variants of FTD: frontal variant (upper panel) and temporal variant (lower panel). See text for details.
36
Although there is some overlap between the brain regions with the most pronounced
atrophy in AD and atrophied brain in other types of dementia, degree of atrophy and pattern
of involved brain areas seem to be useful for supporting a differentiation between various
forms of dementia, describing patterns specific for the various nosologic entities, e.g., Lewy
Body Dementia (LBD), Parkinsons disease with dementia (PDD), Fronto-Temporal Lobar
Degeneration (FTLD) (Ballmaier et al., 2004; Borroni et al., 2007; Borroni et al., 2008;
Burton et al., 2004; Chtelat et al., 2005; Rabinovici et al., 2007; Tam et al., 2005). An
example of the results provided by such an approach is shown in Figure 1, showing the
pattern of grey matter atrophy in the two major variants of Frontotemporal Dementia (FTD),
frontal and temporal variants, respectively. VBM comparison with healthy controls is able to
reveal a selective atrophy, involving dorsolateral frontal cortex, anterior cingulate cortex,
insula, superior temporal gyrus in patients with the frontal variant of FTD, and left middle
and inferior temporal gyrus and superior frontal and orbitofrontal gyrus in patients with the
temporal variant of FTD (Borroni et al., 2007).
All the studies previously mentioned are based on the comparison of groups of subjects,
but an ideal biomarker should be able to provide useful information investigating single
subjects.
In this direction, two analysis methods for volumetric MRI data are currently tested and
used, with very promising results.
Tensor-based morphometry (TBM) evaluates longitudinal changes in single subjects, to
identify regions of faster progression of grey matter atrophy, as compared to controls (Kipps
et al., 2005; Leow et al., 2007). A few recent papers have demonstrated its usefulness
describing differential patterns of progression in dementias (Brambati et al., in press;
Brambati et al., 2007; Thompson et al., 2007).
A cortical thickness measurement, obtained with a specific surface reconstruction
process, has been used to detect the characteristic patterns of cortical thinning in AD, MCI,
and other types of dementia, and to test the relationship between cortical thickness and
cognitive impairment (Du et al., 2007; Singh et al., 2006). The results obtained with cortical
thickness analysis are in agreement with data obtained measuring grey matter volume, and
shown a higher sensitivity to subtle changes, therefore ideal for the very early disease phase.
Recently, a variety of other imaging techniques, in addition to the conventional structural
techniques, have been evaluated regarding their usefulness as diagnostic or prognostic
biomarkers in AD. Some of these new techniques have shown very promising results; further
studies allowing for rigorous assessment of testretest reliability, power calculations, and cost
effectiveness, in comparison with the established techniques, are necessary.
In particular, we will briefly summarize data obtained with the Diffusion Tensor Imaging
(DTI) technique. DTI is sensitive to the degree of microscopic motion of water molecules. In
tissues, this motion is hindered by the physical boundaries of the 3-dimensional tissue
microstructure and thus occurs preferentially perpendicular to those boundaries. In highly
structured tissues, e.g., white matter, the motion of the water molecules along the axonal
direction becomes anisotropic, and allows identifying fibre tracts. Damage to the tissue
microstructure results in a loss of anisotropy, which can be detected by DTI.
DTI has been used to identify age-related brain changes (Salat et al., 2005) and white
matter alterations in a number of neurodegenerative disorders including AD (Catani, 2006).
37
DTI abnormalities in AD were found in the corpus callosum, and in the white matter of the
parietal, temporal, and occipital lobes, posterior cingulate, and hippocampus (Fellgiebel et
al., 2004; Head et al., 2004; Kantarci et al., 2005; Taoka et al., 2006).
Although it is most likely that reduced anisotropy within the white matter is secondary to
cortical neuronal degeneration, comparative DTI and postmortem pathological studies are
necessary to understand the contribution of a primary white matter pathology to these
changes (Catani, 2006).
DTI tractography has been used to localize fractional anisotropy changes within specific
networks in ageing and AD. In AD, tract-specific measurements show fractional anisotropy
changes within long range association tracts of the temporal lobe but no changes in the visual
radiations (Taoka et al., 2006). Sullivan and colleagues used tract-specific measurements to
show ageing-related reduction of fractional anisotropy within fibres of the corpus callosum
(Sullivan et al., 2006). These changes correlated with performances in the Stroop task, and
were more evident in the frontal portion of the corpus callosum (genu) compared to the
posterior portions (e.g. splenium).
Although loss of white matter is prominent in later stages of the neurodegenerative
process, preliminary DTI studies in AD found fractional anisotropy reduction in vulnerable
white matter regions even at preclinical stages. For example DTI of the corpus callosum and
medial temporal lobe revealed that an increased genetic risk for developing AD (ApoE4
carriers) is associated with reduced fractional anisotropy well before the onset of dementia
(Persson et al., 2006).
In subjects with amnesic MCI, DTI-derived measures from a left hippocampal region-ofinterest demonstrate higher sensitivity (around 80%) than volume measurements of
hippocampal atrophy (50%) (Mller et al., 2007). These changes are probably related to the
underlying pathology as suggested by significant correlations between neuropsychological
assessment scores and regional DTI measures in MCI (Rose et al., 2006).
An increased water diffusivity in the hippocampus was found to be useful not only for
discrimination between AD and healthy controls but also for discrimination between MCI
and healthy controls and prediction of cognitive decline in MCI (Kantarci et al., 2001;
Kantarci et al., 2005).
Patterns of fibre tracts reductions appear also to be specific for the ongoing
neurodegenerative process, as shown in recent papers on dementias, such as LBD and FTLD
(Borroni et al., 2007; Borroni et al., 2008; Bozzali et al., 2005; Padovani et al., 2006).
3.2. Functional MRI
3.2.1 functional Magnetic Resonance Imaging (fMRI)
Functional magnetic resonance imaging (fMRI) is a tool that by exploiting the principles
of traditional MRI, allows visualizing regional brain activity non-invasively. Although the
exact mechanisms underlying the coupling between neural function and fMRI signal changes
remain unclear, fMRI studies have been successful in confirming task-specific activation in a
variety of brain regions, providing converging evidence for functional localization. In
particular, fMRI methods based on blood oxygenation level dependent (BOLD) contrast and
38
arterial spin labelling (ASL) perfusion contrast have enabled imaging of changes in blood
oxygenation and cerebral blood flow (CBF).
While BOLD contrast has been widely used as the surrogate marker for neural activation
and can provide reliable information on the neuroanatomy underlying transient sensorimotor
and cognitive functions, DSW and ASL imaging are mostly used for resting state perfusion
measurements (Detre and Wang, 2002).
BOLD
In response to neural activation, there is an increased rCBF to the relevant region, but for
reasons that are still not well understood, the rCBF increases far more (by 30-50%) than the
expected increase in oxygen demand (oxygen extraction increases by only 5%.) (Ogawa et
al., 1990). This leads to both local increase of oxyhaemoglobin concentration, which has
diamagnetic properties, and reduction of deoxyhaemoglobin, which has paramagnetic
properties. The presence of paramagnetic substances in the blood could act as vascular
markers, featuring as natural endogenous contrast agent. As such, the BOLD signal is an
indirect marker of brain activity, as it evaluates only haemodynamic changes, and usually
peaks with a delay of 6-9 seconds (Logothetis and Pfeuffer, 2004; Logothetis and Wandell,
2004; Logothetis et al., 2001).
fMRI has advantages in spatial and temporal resolution when compared to the PET
technique, and, in addition, the fact that no radionuclides are used makes it feasible to repeat
experiments several times on the same subject. However, fMRI imaging has some limits. The
main limit is that MRI does not allow molecular imaging, as compared with Emission
Tomography techniques. Also, there are interferences with the magnetic field in some
structures of the brain, in particular the orbito-frontal, inferior temporal regions and the
temporal pole, because of the air enclosed in adjacent structures (the middle ear and the
mastoid bone), resulting in a loss of signal detection (Gorno-Tempini et al., 2002).
Currently, fMRI activation studies are mostly used to gain a better understanding of the
neuronal networks involved in specific tasks in the healthy human brain. Much of the recent
neuroimaging research on ageing has focused on investigating the relationship between agerelated changes in brain structure/function and concomitant changes in cognitive/behavioural
abilities. Memory impairment is one of the hallmarks of ageing, and the majority of
neuroimaging studies in this area have focused on age-related changes during working
memory (WM) and episodic memory (EM) task performance (Craik and Salthouse, 2000).
Age-related deficits in WM and EM abilities are related to changes in prefrontal cortex (PFC)
function (Cabeza and Nyberg, 2005; Gazzaley et al., 2005; Persson et al., 2006). Noteworthy,
these age-related changes in PFC activity were associated either with poorer performance of
older subjects or with an absence of behavioural differences between elderly and young
subjects (Rypma and D'Esposito, 2000).
Reviews of these neuroimaging studies have generally concluded that with age there is a
reduction in the hemispheric specialization of cognitive function in the frontal lobes and
viewed the PFC as a homogeneous region. For example, Cabeza (2002) proposed the
hemispheric asymmetry reduction in old adults (HAROLD) model, which has been supported
by subsequent experimental findings (Cabeza, 2002). However, this model does not address
whether these laterality effects are specific to particular brain regions or common to all brain
39
regions and does not specify the underlying neural mechanisms for age-related reductions in
lateralized activity. A comprehensive qualitative meta-analytic review of all the fMRI and
PET ageing studies of WM and episodic memory that report PFC activation, indicates that in
normal ageing distinct PFC regions exhibit different patterns of functional change, suggesting
that age-related changes in PFC function are not homogeneous in nature (Rajah and
D'Esposito, 2005). Specifically, the effects of ageing that are related to neural degeneration
and changes in neurotransmitter systems, will result both in functional deficits and in
dedifferentiation of cortical function. These changes in turn result in functional compensation
within other PFC regions.
Only a minority of studies addresses the question of how these networks are altered in
subjects at risk for AD (MCI) or in subjects with very early AD. Studies conducted in
patients with a clinical diagnosis of AD consistently show that medial temporal lobe
activation is decreased in comparison to older controls (Machulda et al., 2003; Small et al.,
1999).
Some fMRI studies concern subjects whose cognitive function falls between that of
normal aging and mild AD, as in MCI, and the results so far have been inconsistent
(Dickerson et al., 2004; Machulda et al., 2003; Small et al., 1999). MCI is a heterogeneous
condition and this clinical heterogeneity may, in part, explain differences among previous
fMRI studies of MCI. An fMRI study investigated whether hippocampal and entorhinal
activation during learning is altered in the earliest phase of mild cognitive impairment. The
subjects with MCI performed similarly to controls on the fMRI recognition memory task,
whereas patients with AD had poorer performance. There were no differences in hippocampal
or entorhinal volumes, but significantly greater hippocampal activation was present in the
MCI group compared to controls. In contrast, the AD group showed hippocampal and
entorhinal hypoactivation and atrophy in comparison to controls. The authors hypothesize
that there is a phase of increased medial temporal lobe activation early in the course of
prodromal AD followed by a subsequent decrease as the disease progresses (Dickerson et al.,
2005).
The results of cognitive activation studies in aging and MCI are complex to interpret,
however, an important contribution is already starting to become clear. The largely implicit
logic, which tended to associate a larger activation with a better performance, is clearly
questionable. The situation appears to be more complex, with evidence of rearrangements and
recruitment of additional resources in order to support performance (D'Esposito et al., 2003).
Whereas such studies unquestionably give interesting insights into functional deficits and
compensatory mechanisms in AD, they might be less suited as diagnostic or prognostic
biomarkers because they depend very much on the compliance of the subject.
ASL and DWI
In the last few years, different MR techniques to measure brain perfusion have been
developed. ASL and Dynamic susceptibility weighted (DSW) MRI are based on the principle
that the passage of contrast material through the tissue microvasculature results in signal
intensity changes in T2-weighted images. DSW uses an exogenous paramagnetic contrast,
while ASL methods are based on the same principle but use an endogenous tracer, i.e., blood
water molecules in arteries providing the blood flow to the brain are magnetically tagged.
40
These tagged water molecules then diffuse across the bloodbrain barrier into the brain and
alter the local magnetization state of the brain tissue in proportion to the inflow of saturated
protons.
Like emission tomography techniques, both ASL and DWI have shown regions of
hypoperfusion in the temporo-parietal lobes and in the posterior cingulate in AD and MCI
(Bozzao et al., 2001; Harris et al., 1996; Johnson et al., 2005).
A recent work has investigated ASL MRI for detecting pattern of hypoperfusion in
frontotemporal dementia (FTD) and AD vs. cognitively normal control subjects, and found
specific hypoperfusion in right frontal regions in patients with FTD vs. control subjects, and a
higher perfusion than AD in the parietal regions and posterior cingulate: with further
development and evaluation, arterial spin labelling MRI could contribute to the differential
diagnosis between frontotemporal dementia and AD (Du et al., 2006).
However, further studies are still required to test the applicability of these methods also
for quantification purposes and in studies of single subjects, as compared with the extensively
validated emission tomography techniques.
41
42
In particular, a prospective study of FDG PET has addressed the issue of progression rate
of AD, and found that impairment of glucose metabolism in temporo-parietal or frontal
association areas measured with PET is significantly associated with dementia severity,
clinical classification as possible vs. probable AD, presence of multiple cognitive deficits,
and history of progression, and a prognostic indicator of clinical deterioration during followup (Herholz et al., 1999). The correlation between initial metabolic ratio and subsequent
decline of MMSE score during follow-up is particularly evident in mildly affected patients.
Thus, impairment of glucose metabolism in temporo-parietal and frontal association cortex is
not only an indicator of dementia severity, but also predicts progression of clinical symptoms
(Herholz et al., 1999).
Methods for automatic detection of abnormal metabolism on individual PET scans,
providing unbiased measurements, have also been developed. They require appropriate
reference data sets, spatial normalization of scans, and statistical algorithms to compare the
voxels in scan data with normal reference data, and suitable display of the results. Signorini
and colleagues demonstrated that this can be achieved by adapting the Statistical Parametric
Mapping (SPM) software package (Signorini et al., 1999). Some commercial software
packages provide similar approaches, but users should take care to check the validity of
normal reference data, statistics and normalization procedures. Studies that used voxel-based
comparisons to normal reference data clearly showed that the posterior cingulate gyrus and
the precuneus are also impaired early in AD (Minoshima et al., 1997). Thus, this potential
diagnostic sign is easily detected by automated analysis of FDG PET scans. An example of
SPM analysis in a single subject with early AD is provided in Figure 2.
Figure 2. FDG-PET scan in a subject with early AD (upper panel), and Statistical Parametric Mapping
comparison of the same PET scan with a group of healthy controls (lower panel). The images show the
typical pattern of hypometabolism, involving temporoparietal association cortices, and precuneus. See
text for details.
Other approaches has been proposed for the detection of abnormal voxels, aiming at the
automatic recognition of the typical metabolic abnormalities in AD. For example,
43
discriminant functions derived by multiple regression of regional data achieved 87% correct
classification of AD patients versus controls (Azari et al., 1993), and a neural network
classifier arrived at 90% accuracy (Kippenhan et al., 1994). The sum of abnormal t-values in
regions that are typically hypometabolic in AD has been used as an indicator with 93%
accuracy (Herholz et al., 2002). Patients with late-onset AD may show less difference
between typically affected and non-affected brain regions than usually seen in early-onset
AD, which could potentially lead to reduced diagnostic accuracy with FDG PET (Mosconi,
2005).
The main contribution of these methods is the ability to identify changes that occur in
single subjects and to describe pattern that orient and confirm clinical diagnosis.
According to neuropathological studies, the earliest pathological changes in AD develop
in the transentorhinal and entorhinal regions, then spread to the hippocampus and finally
towards the neocortex. Medial temporal reduction in metabolism can thus be expected to be
the earliest markers of the disease process. Yamaguchi and colleagues (1997) have shown
that the reduction in cortical metabolism is significantly correlated with hippocampal
atrophy, as shown with structural MR (Yamaguchi et al., 1997). Atrophy of hippocampus and
parahippocampal structures is a main finding of structural imaging in AD. Therefore, one
would expect also major functional changes of glucose metabolism in this brain area, but this
has not generally been the case (Ishii et al., 1998). It is difficult to identify hippocampal
metabolic impairment on FDG PET scans, because this region has lower resting metabolism
than neocortex, and pathological changes are not obvious by visual image analysis. However,
by coregistration with MRI for accurate positioning of regions of interest onto the
hippocampus in FDG PET scans a reduction especially of entorhinal metabolism has indeed
been observed in MCI and AD (Mosconi et al., 2005). In addition, in normal controls,
glucose metabolism in neocortex is correlated with entorhinal cortex across both
hemispheres, whereas in AD patients these correlations are largely lost (Mosconi et al.,
2004).
The observation that medial temporal lobe damage leads also to mnemonic dysfunction
have been advanced greatly by the study of neurodegenerative disorders patients. In AD, the
study of the correlations between memory test scores and metabolic values across a sample of
subjects provided a map of those brain structures whose synaptic dysfunction underlies the
particular neuropsychological alteration. The distribution of the sites of correlations with
specific memory deficits shows striking differences according to which memory system is
involved and to the severity of the impairment (Desgranges et al., 2002; Eustache et al.,
2000). In fact, significant correlations involved bilaterally not only several limbic structures
(the hippocampal/entorhinal cortex regions, posterior cingulate gyrus and retrosplenial
cortex), but also some temporo-occipital association areas. In the less severe subgroup, all
significant correlations were restricted to the parahippocampal gyrus and retrosplenial cortex,
in accordance with the known involvement of this network in normal and impaired memory
function, while in the more severe subgroup they mainly involved the left temporal
neocortex, which is known to be implicated in semantic memory. The authors suggest that,
when episodic memory is mildly impaired, limbic functions are still sufficient to subserve the
remaining performance, whereas with more severe memory deficit resulting from
accumulated pathology, the neocortical areas become more functionally involved
44
(Desgranges et al., 2002). This approach opens the way for the unravelling of the
neurobiological substrates of both cognitive impairment and compensatory mechanisms in
neurological diseases. Such studies in brain-diseased subjects are particularly useful for
establishing cognitive and neurobiological models of human memory, because they allow the
highlighting of the neural networks that are essential for memory function.
Furthermore, imaging with FDG and PET might also allow identifying the so-called
brain reserve. The concept of cognitive or cerebral reserve (brain reserve hypothesis) is
based on the clinical observation that highly intelligent or educated individuals appear to be
able to cope better with the onset of dementia, maintaining a normal functional level for a
longer time than less educated people (Christensen et al., 2007; Stern et al., 1992; Stern,
2002). This observation is documented by neuropathological and epidemiological studies
(Bennett et al., 2003; Goldman et al., 2001; Ince, 2001; McDowell et al., 2007; Ngandu et al.,
2007; Roe et al., 2007; Scarmeas et al., 2006; Snowdon et al., 1989)
FDG PET data provide supporting evidences, demonstrating that there is a significant
inverse relationship between educational/occupational level and regional glucose metabolism
in the posterior temporo-parietal association cortex and the precuneus in AD (see Figure 3),
showing that the level of education and occupation provides a functional reserve capacity
probably contrasting the clinical onset and progression of dementia (Garibotto et al., in press;
Perneczky et al., 2006).
Figure 3. Brain reserve provided by education in a group of subjects with early AD. Upper panel shows
the significant inverse correlation of education and brain glucose metabolism, located in the precuneus
and left temporoparietal cortex, as shown in the lower panel. See text for details.
45
46
47
48
deposition in AD will be a prerequisite for early treatment, and in vivo imaging represents the
ideal instrument to assess the effectiveness of antiamyloid therapy.
A recent study assessed beta amyloid deposition in MCI, and found values intermediate
between those obtained in healthy controls and in AD patients, and significantly different
from both groups (Small et al., 2006). Therefore, amyloid imaging can differentiate persons
with MCI from those with AD and those with no cognitive impairment.
A prospective study in MCI has demonstrated that those MCI subjects that later at
clinical follow-up converted to AD showed significant higher PIB retention compared to nonconverting MCI patients and HC, with a PIB retention comparable to AD patients (Forsberg
et al., in press). Correlations were observed in the MCI patients between PIB retention and
CSF A1-42, total Tau and episodic memory scores, respectively (Forsberg et al., in press).
An interesting perspective is suggested by a recent work (Pike et al., 2007). Beta amyloid
deposition may occur also in normal elderly people without apparent cognitive effect. The
authors examined this relationship using 11C-PIB PET vivo in healthy ageing (HA), MCI and
AD. Ninety-seven percent of AD, 61% of MCI and 22% of HA cases had increased cortical
11
C-PIB binding, indicating the presence of Abeta plaques. There was a strong relationship
between impaired episodic memory performance and 11C-PIB binding, both in MCI and HA.
This relationship was weaker in AD and less robust for non-memory cognitive domains.
Therefore, Abeta deposition in the asymptomatic elderly is associated with episodic memory
impairment. This finding, together with the strong relationship between 11C-PIB binding and
the severity of memory impairment in MCI, suggests that individuals with increased cortical
11
C-PIB binding are on the path to AD. Early intervention trials for AD targeted to nondemented individuals with cerebral Abeta deposition are warranted.
Amyloid imaging has been recently tested also for its potential in the differential
diagnosis of dementia. Preliminary data show that Semantic Dementia (Drzezga et al., 2008)
and Parkinsons Disease Dementia (Maetzler et al., 2007) have a significantly lower PIB
retention, as compared with AD.
Neurochemical Imaging in AD
Neurochemical imaging is one of the most established molecular imaging techniques.
There have been tremendous efforts expended to develop radioligands specific to various
neurochemical system. Investigational applications of neurochemical imaging in dementing
disorders are extensive. Cholinergic, dopaminergic, and serotoninergic systems, as well as
benzodiazepine receptors, opioid receptors, and glutamatergic receptors have been imaged in
AD and other dementing disorders. These investigations have provided important insights
into disease processes in living human patients (see for a review Minoshima et al., 2004).
We will focus mainly on the first two systems, cholinergic and dopaminergic, which have
the stronger impact in the clinical management and differential diagnosis of dementias.
Brain Acetylcholinesterase Activity
The first group encompasses carbon 11labelled acetylcholine analogues, which allow
for an in vivo measurement of the activity of the acetylcholine degrading enzyme
acetylcholinesterase (ACHE), such as 11C-MP4A. AD is associated with loss of cholinergic
neurons in the basal fore-brain and, thus, with decreased levels of acetylcholine and the
49
enzymes responsible for its synthesis and degradation in this region and connected cortical
regions. In accordance with this, several PET studies have found a reduction of the cortical
ACHE activity in AD compared with controls, particularly in the hippocampus and parietotemporal regions (Herholz et al., 2004; Iyo et al., 1997; Shinotoh et al., 2000).
The degree of the ACHE reduction was found to be well correlated with the degree of the
cognitive impairment (Bohnen et al., 2005). Furthermore, treatment with ACHE inhibitors
resulted in a measurable decrease of the remaining ACHE activity and was well correlated
with improvements of the cognitive measures (Kuhl et al., 2000; Shinotoh et al., 2001).
Therefore, this technique seems to be quite promising not only as a diagnostic biomarker but
also as a prognostic biomarker.
However, a validation of these data in larger cohort of subjects is required, to test the
diagnostic and prognostic potential of ACHE evaluation, and for this goal multicentre
european studies included in the DIMI network are ongoing (see the Research in progress
section).
With 11C-MP4A imaging of acetylcholinesterase activity and PET, Rinne and colleagues
found only a slight hippocampal acetylcholinesterase activity reduction in MCI and early AD
subjects, concluding that the value of in vivo acetylcholinesterase measurements in detecting
the early AD process is limited (Rinne et al., 2003).
On the contrary, Herholz and colleagues found a significant reduction of 11C-MP4A in 3
MCI, out of a 8 subjects group, and a significant association was found with progression to
AD within 18 months, suggesting that low cortical acetylcholinesterase activity may be an
indicator of impending dementia in patients with mild cognitive impairment (Herholz et al.,
2005).
Brain Dopaminergic Transmission
Neurochemical correlates of extrapyramidal symptoms frequently observed in AD are not
understood fully. A postmortem investigation suggested a correlation between neurofibrillary
tangle density in the substantia nigra and extrapyramidal signs in AD (Liu et al., 1997).
Dopaminergic imaging of dementing disorders can thus increase our understanding of the
neuronal correlates of cognitive as well as motor impairments in various dementing disorders.
This issue became a focus of PET and SPECT investigations. A study using 18Ffluorodopa PET indicated no significant reduction in 18F-fluorodopa uptake in the caudate or
putamen of rigid or non-rigid patients with AD versus normal controls. In contrast, there were
severe reductions in PD, indicating differential underlying mechanisms of extrapyramidal
symptoms in AD and PD (Tyrrell et al., 1990). The 123I-IBZM SPECT showed modest striatal
D2 receptor reductions of approximately 15% in AD without overt extrapyramidal signs, in
comparison to controls. This result suggested a decline of postsynaptic striatal dopamine
receptors as a part of AD pathophysiology that is different from prevalent presynaptic
nigrostriatal degeneration (Pizzolato et al., 1996). In contrast, subsequent dopamine
transporter imaging using a cocaine analogue, 2--carbomethoxy-3--(4-18F-fluorophenyl)
tropane (-CFT), showed more severe reductions in the putamen or caudate in patients with
AD with extrapyramidal symptoms (Rinne et al., 1998).
A further PET investigation using a dopamine D1 receptor antagonist, 11C-NNC 756, and
a D2 antagonist, 11C-raclopride, showed 14% reductions in D1 receptors in AD but no
50
Figure 5. Presynaptic dopamine transporters, as measured by 11C-FECIT and PET, in one subject with
AD (upper panel) and one subject with LBD (lower panel). PET images clearly show a pattern of
widespread reduction in the LBD patient. See text for details.
In particular, a recent multicentre study has investigated the sensitivity and specificity, in
the ante-mortem differentiation of probable LBD from other causes of dementia, of single
photon emission computed tomography (SPECT) brain imaging with the ligand I-FP-CIT
(McKeith et al., 2007). Abnormal scans had a mean sensitivity of 77,7% for detecting clinical
51
probable LBD, with specificity of 90,4% for excluding non-LBD dementia, which was
predominantly due to AD. A mean value of 85,7% was achieved for overall diagnostic
accuracy, 82,4% for positive predictive value, and 87,5% for negative predictive value. Interreader agreement for rating scans as normal or abnormal was high (Cohens =087).
Therefore, there is a high correlation between abnormal (low binding) DAT activity
measured with I-FP-CIT SPECT and a clinical diagnosis of probable LBD. The diagnostic
accuracy is sufficiently high for this technique to be clinically useful in distinguishing LBD
from AD. Low dopamine transporter uptake in basal ganglia demonstrated by PET and
SPECT imaging has been suggested as a supportive feature for LBD diagnosis (McKeith et
al., 2005).
4. RESEARCH IN PROGRESS
Over the last years, a number of genetic, biochemical, and imaging measures have been
explored regarding potential to improve the accuracy of the clinical diagnosis of AD or to
monitor disease progression and treatment effects. Considering the complexity of the AD
disease process, it seems also rather unlikely that such a single ideal diagnostic or prognostic
AD biomarker even exists. However, as these markers assess slightly different aspects of the
disease process, a combination of two or three of them might be much more powerful than
each of them alone (Herholz, 2003). Therefore, one of the currently most important issues of
clinical AD research is to identify the combination of the already-established biomarkers with
the highest diagnostic and prognostic power.
To address these questions, multicentre research projects are ongoing, both in Europe
and in the US.
In particular, two active networks are exploring neuroimaging biomarkers of AD and
other neurodegenerative disorders:
1. the Diagnostic and Molecular Imaging Network (DIMI), launched in June 2005, and
connecting many european centres (www.dimi.eu). The DIMI network is funded
only by the EU, and the workpackages included aim mainly at addressing
translational research from basic science to clinical trials in the identification of
novel markers of neurodegeneration and neuroinflammation.
2. the Alzheimers Disease Neuroimaging Initiative (ADNI), launched in October 2004,
and connecting many centres in United States and Canada. The ADNI is funded by
the National Institute on Aging (NIA) and the National Institute of Biomedical
Imaging and Bioengineering (NIBIB) of the National Institutes of Health (NIH), and
also by several pharmaceutical companies and foundations (Mueller et al., 2005)
5. FINAL REMARKS
The impact of neuroimaging in the diagnostic and prognostic management of AD has
been recognized also in many recently published guidelines of neurological societies (Dubois
et al., 2007; Knopman et al., 2001; Waldemar et al., 2007).
52
REFERENCES
Agdeppa, E.D., Kepe, V., Liu, J., Flores-Torres, S., Satyamurthy, N., Petric, A., Cole, G.M.,
Small, G.W., Huang, S.C., Barrio, J.R., 2001. Binding characteristics of radiofluorinated
6-dialkylamino-2-naphthylethylidene derivatives as positron emission tomography
imaging probes for beta-amyloid plaques in Alzheimer's disease. J Neurosci 21, RC189.
Agdeppa, E.D., Kepe, V., Liu, J., Small, G.W., Huang, S., Petric, A., Satyamurthy, N.,
Barrio, J.R., 2003. 2-dialkylamino-6-acylmalononitrile substituted naphthalenes (DDNP
analogs): novel diagnostic and therapeutic tools in Alzheimer's disease. Mol Imaging
Biol 5, 404-417.
53
Alexander, G.E., Chen, K., Pietrini, P., Rapoport, S.I., Reiman, E.M., 2002. Longitudinal
PET evaluation of cerebral metabolic decline in dementia: a potential outcome measure
in Alzheimer's disease treatment studies. Am J Psychiatry 159, 738-745.
Anchisi, D., Borroni, B., Franceschi, M., Kerrouche, N., Kalbe, E., Beuthien-Beumann, B.,
Cappa, S., Lenz, O., Ludecke, S., Marcone, A., Mielke, R., Ortelli, P., Padovani, A.,
Pelati, O., Pupi, A., Scarpini, E., Weisenbach, S., Herholz, K., Salmon, E., Holthoff, V.,
Sorbi, S., Fazio, F., Perani, D., 2005. Heterogeneity of brain glucose metabolism in mild
cognitive impairment and clinical progression to Alzheimer disease. Arch Neurol 62,
1728-1733.
Azari, N.P., Pettigrew, K.D., Schapiro, M.B., Haxby, J.V., Grady, C.L., Pietrini, P., Salerno,
J.A., Heston, L.L., Rapoport, S.I., Horwitz, B., 1993. Early detection of Alzheimer's
disease: a statistical approach using positron emission tomographic data. J Cereb Blood
Flow Metab 13, 438-447.
Ballmaier, M., O'Brien, J.T., Burton, E.J., Thompson, P.M., Rex, D.E., Narr, K.L., McKeith,
I.G., DeLuca, H., Toga, A.W., 2004. Comparing gray matter loss profiles between
dementia with Lewy bodies and Alzheimer's disease using cortical pattern matching:
diagnosis and gender effects. Neuroimage 23, 325-335.
Bennett, D.A., Schneider, J.A., Bienias, J.L., Evans, D.A., Wilson, R.S., 2005. Mild cognitive
impairment is related to Alzheimer disease pathology and cerebral infarctions. Neurology
64, 834-841.
Bennett, D.A., Wilson, R.S., Schneider, J.A., Evans, D.A., Mendes de Leon, C.F., Arnold,
S.E., Barnes, L.L., Bienias, J.L., 2003. Education modifies the relation of AD pathology
to level of cognitive function in older persons. Neurology 60, 1909-1915.
Bertram, L., Tanzi, R.E., 2004. The current status of Alzheimer's disease genetics: what do
we tell the patients? Pharmacol Res 50, 385-396.
Bohnen, N.I., Kaufer, D.I., Hendrickson, R., Ivanco, L.S., Lopresti, B., Davis, J.G.,
Constantine, G., Mathis, C.A., Moore, R.Y., DeKosky, S.T., 2005. Cognitive correlates
of alterations in acetylcholinesterase in Alzheimer's disease. Neurosci Lett 380, 127-132.
Borroni, B. and Garibotto, V., Agosti, C., Brambati, S., Zanetti, M., Bellelli, G., Gasparotti,
R., Padovani, A., Perani, D., 2008. Structural MRI changes and correlates of limbapraxia in corticobasal degeneration syndrome: a voxel-based morphometry and
diffusion tensor imaging study. Arch Neurol 65, 796-801.
Borroni, B., Anchisi, D., Paghera, B., Vicini, B., Kerrouche, N., Garibotto, V., Terzi, A.,
Vignolo, L.A., Di Luca, M., Giubbini, R., Padovani, A., Perani, D., 2006. Combined
99mTc-ECD SPECT and neuropsychological studies in MCI for the assessment of
conversion to AD. Neurobiol Aging 27, 24-31.
Borroni, B., Brambati, S.M., Agosti, C., Gipponi, S., Bellelli, G., Gasparotti, R., Garibotto,
V., Di Luca, M., Scifo, P., Perani, D., Padovani, A., 2007. Evidence of white matter
changes on diffusion tensor imaging in frontotemporal dementia. Arch Neurol 64, 246251.
Borroni, B., Perani, D., Broli, M., Colciaghi, F., Garibotto, V., Paghera, B., Agosti, C.,
Giubbini, R., Di Luca, M., Padovani, A., 2005. Pre-clinical diagnosis of Alzheimer
disease combining platelet amyloid precursor protein ratio and rCBF SPECT analysis. J
Neurol 252, 1359-1362.
54
Boxer, A.L., Geschwind, M.D., Belfor, N., Gorno-Tempini, M.L., Schauer, G.F., Miller,
B.L., Weiner, M.W., Rosen, H.J., 2006. Patterns of brain atrophy that differentiate
corticobasal degeneration syndrome from progressive supranuclear palsy. Arch Neurol
63, 81-86.
Bozzali, M., Falini, A., Cercignani, M., Baglio, F., Farina, E., Alberoni, M., Vezzulli, P.,
Olivotto, F., Mantovani, F., Shallice, T., Scotti, G., Canal, N., Nemni, R., 2005. Brain
tissue damage in dementia with Lewy bodies: an in vivo diffusion tensor MRI study.
Brain 128, 1595-1604.
Bozzao, A., Floris, R., Baviera, M.E., Apruzzese, A., Simonetti, G., 2001. Diffusion and
perfusion MR imaging in cases of Alzheimer's disease: correlations with cortical atrophy
and lesion load. AJNR Am J Neuroradiol 22, 1030-1036.
Braak, H., Braak, E., 1991. Demonstration of amyloid deposits and neurofibrillary changes in
whole brain sections. Brain Pathol 1, 213-216.
Brambati, S.M., Rankin, K.P., Narvid, J., Seeley, W.W., Dean, D., Rosen, H.J., Miller, B.L.,
Ashburner, J., Gorno-Tempini, M.L., in press. Atrophy progression in semantic dementia
with asymmetric temporal involvement: a tensor-based morphometry study. Neurobiol
Aging .
Brambati, S.M., Renda, N.C., Rankin, K.P., Rosen, H.J., Seeley, W.W., Ashburner, J.,
Weiner, M.W., Miller, B.L., Gorno-Tempini, M.L., 2007. A tensor based morphometry
study of longitudinal gray matter contraction in FTD. Neuroimage 35, 998-1003.
Bresjanac, M., Smid, L.M., Vovko, T.D., Petric, A., Barrio, J.R., Popovic, M., 2003.
Molecular-imaging probe 2-(1-[6-[(2-fluoroethyl)(methyl)amino]-2-naphthyl]ethylidene)
malononitrile labels prion plaques in vitro. J Neurosci 23, 8029-8033.
Burton, E.J., McKeith, I.G., Burn, D.J., Williams, E.D., O'Brien, J.T., 2004. Cerebral atrophy
in Parkinson's disease with and without dementia: a comparison with Alzheimer's
disease, dementia with Lewy bodies and controls. Brain 127, 791-800.
Cabeza, R., 2002. Hemispheric asymmetry reduction in older adults: the HAROLD model.
Psychol Aging 17, 85-100.
Cabeza, R., Nyberg, L., 2005. Cognitive neuroscience of aging., Oxford University Press.
Cai, L., Innis, R.B., Pike, V.W., 2007. Radioligand development for PET imaging of betaamyloid (Abeta)--current status. Curr Med Chem 14, 19-52.
Catani, M., 2006. Diffusion tensor magnetic resonance imaging tractography in cognitive
disorders. Curr Opin Neurol 19, 599-606.
Chetelat, G., Baron, J., 2003. Early diagnosis of Alzheimer's disease: contribution of
structural neuroimaging. Neuroimage 18, 525-541.
Christensen, H., Anstey, K.J., Parslow, R.A., Maller, J., Mackinnon, A., Sachdev, P., 2007.
The brain reserve hypothesis, brain atrophy and aging. Gerontology 53, 82-95.
Chtelat, G., Landeau, B., Eustache, F., Mzenge, F., Viader, F., de la Sayette, V.,
Desgranges, B., Baron, J., 2005. Using voxel-based morphometry to map the structural
changes associated with rapid conversion in MCI: a longitudinal MRI study. Neuroimage
27, 934-946.
Colloby, S.J., Fenwick, J.D., Williams, E.D., Paling, S.M., Lobotesis, K., Ballard, C.,
McKeith, I., O'Brien, J.T., 2002. A comparison of (99m)Tc-HMPAO SPET changes in
55
dementia with Lewy bodies and Alzheimer's disease using statistical parametric mapping.
Eur J Nucl Med Mol Imaging 29, 615-622.
Craik, F., Salthouse, T., 2000. The handbook of aging and cognition, 2nd ed., Lawrence
Erlbaum Associates.
Cummings, J.L., Doody, R., Clark, C., 2007. Disease-modifying therapies for Alzheimer
disease: challenges to early intervention. Neurology 69, 1622-1634.
D'Esposito, M., Deouell, L., Gazzaley, A., 2003. Alterations in the bold fMRI signal with
ageing and disease: a challenge for neuroimaging. Nat Rev Neurosci 4, 863-872.
DeKosky, S.T., 2003. Pathology and pathways of Alzheimer's disease with an update on new
developments in treatment. J Am Geriatr Soc 51, S314-20.
DeKosky, S.T., Marek, K., 2003. Looking backward to move forward: early detection of
neurodegenerative disorders. Science 302, 830-834.
Desgranges, B., Baron, J., Laleve, C., Giffard, B., Viader, F., de La Sayette, V., Eustache,
F., 2002. The neural substrates of episodic memory impairment in Alzheimer's disease as
revealed by FDG-PET: relationship to degree of deterioration. Brain 125, 1116-1124.
Detre, J.A., Wang, J., 2002. Technical aspects and utility of fMRI using BOLD and ASL.
Clin Neurophysiol 113, 621-634.
Dickerson, B.C., Goncharova, I., Sullivan, M.P., Forchetti, C., Wilson, R.S., Bennett, D.A.,
Beckett, L.A., deToledo-Morrell, L., 2001. MRI-derived entorhinal and hippocampal
atrophy in incipient and very mild Alzheimer's disease. Neurobiol Aging 22, 747-754.
Dickerson, B.C., Salat, D.H., Bates, J.F., Atiya, M., Killiany, R.J., Greve, D.N., Dale, A.M.,
Stern, C.E., Blacker, D., Albert, M.S., Sperling, R.A., 2004. Medial temporal lobe
function and structure in mild cognitive impairment. Ann Neurol 56, 27-35.
Dickerson, B.C., Salat, D.H., Greve, D.N., Chua, E.F., Rand-Giovannetti, E., Rentz, D.M.,
Bertram, L., Mullin, K., Tanzi, R.E., Blacker, D., Albert, M.S., Sperling, R.A., 2005.
Increased hippocampal activation in mild cognitive impairment compared to normal
aging and AD. Neurology 65, 404-411.
Dickson, D., 2003. Neurodegeneration: the molecular pathology of dementia and movement
disorders, Blackwell Publishing.
Donnemiller, E., Heilmann, J., Wenning, G.K., Berger, W., Decristoforo, C., Moncayo, R.,
Poewe, W., Ransmayr, G., 1997. Brain perfusion scintigraphy with 99mTc-HMPAO or
99mTc-ECD and 123I-beta-CIT single-photon emission tomography in dementia of the
Alzheimer-type and diffuse Lewy body disease. Eur J Nucl Med 24, 320-325.
Drzezga, A., Grimmer, T., Henriksen, G., Stangier, I., Perneczky, R., Diehl-Schmid, J.,
Mathis, C.A., Klunk, W.E., Price, J., Dekosky, S., Wester, H., Schwaiger, M., Kurz, A.,
2008. Imaging of amyloid plaques and cerebral glucose metabolism in semantic dementia
and Alzheimer's disease. Neuroimage 39, 619-633.
Drzezga, A., Grimmer, T., Riemenschneider, M., Lautenschlager, N., Siebner, H.,
Alexopoulus, P., Minoshima, S., Schwaiger, M., Kurz, A., 2005. Prediction of individual
clinical outcome in MCI by means of genetic assessment and (18)F-FDG PET. J Nucl
Med 46, 1625-1632.
Du, A., Schuff, N., Kramer, J.H., Rosen, H.J., Gorno-Tempini, M.L., Rankin, K., Miller,
B.L., Weiner, M.W., 2007. Different regional patterns of cortical thinning in Alzheimer's
disease and frontotemporal dementia. Brain 130, 1159-1166.
56
Du, A.T., Jahng, G.H., Hayasaka, S., Kramer, J.H., Rosen, H.J., Gorno-Tempini, M.L.,
Rankin, K.P., Miller, B.L., Weiner, M.W., Schuff, N., 2006. Hypoperfusion in
frontotemporal dementia and Alzheimer disease by arterial spin labeling MRI. Neurology
67, 1215-1220.
Du, A.T., Schuff, N., Kramer, J.H., Ganzer, S., Zhu, X.P., Jagust, W.J., Miller, B.L., Reed,
B.R., Mungas, D., Yaffe, K., Chui, H.C., Weiner, M.W., 2004. Higher atrophy rate of
entorhinal cortex than hippocampus in AD. Neurology 62, 422-427.
Dubois, B., Feldman, H.H., Jacova, C., Dekosky, S.T., Barberger-Gateau, P., Cummings, J.,
Delacourte, A., Galasko, D., Gauthier, S., Jicha, G., Meguro, K., O'brien, J., Pasquier, F.,
Robert, P., Rossor, M., Salloway, S., Stern, Y., Visser, P.J., Scheltens, P., 2007. Research
criteria for the diagnosis of Alzheimer's disease: revising the NINCDS-ADRDA criteria.
Lancet Neurol 6, 734-746.
Eustache, F., Desgranges, B., Aupee, A., Guillery, B., Baron, J., 2000. Functional
neuroanatomy of amnesia: positron emission tomography studies. Microsc Res Tech 51,
94-100.
Fellgiebel, A., Siessmeier, T., Scheurich, A., Winterer, G., Bartenstein, P., Schmidt, L.G.,
Mller, M.J., 2004. Association of elevated phospho-tau levels with Alzheimer-typical
18F-fluoro-2-deoxy-d-glucose positron emission tomography findings in patients with
mild cognitive impairment. Biol Psychiatry 56, 279-283.
Fellgiebel, A., Wille, P., Mller, M.J., Winterer, G., Scheurich, A., Vucurevic, G., Schmidt,
L.G., Stoeter, P., 2004. Ultrastructural hippocampal and white matter alterations in mild
cognitive impairment: a diffusion tensor imaging study. Dement Geriatr Cogn Disord 18,
101-108.
Forsberg, A., Engler, H., Almkvist, O., Blomquist, G., Hagman, G., Wall, A., Ringheim, A.,
Lngstrm, B., Nordberg, A., in press. PET imaging of amyloid deposition in patients
with mild cognitive impairment. Neurobiol Aging .
Foster, N.L., Heidebrink, J.L., Clark, C.M., Jagust, W.J., Arnold, S.E., Barbas, N.R., DeCarli,
C.S., Turner, R.S., Koeppe, R.A., Higdon, R., Minoshima, S., 2007. FDG-PET improves
accuracy in distinguishing frontotemporal dementia and Alzheimer's disease. Brain 130,
2616-2635.
Fox, N.C., Jenkins, R., Leary, S.M., Stevenson, V.L., Losseff, N.A., Crum, W.R., Harvey,
R.J., Rossor, M.N., Miller, D.H., Thompson, A.J., 2000. Progressive cerebral atrophy in
MS: a serial study using registered, volumetric MRI. Neurology 54, 807-812.
Fox, N.C., Scahill, R.I., Crum, W.R., Rossor, M.N., 1999. Correlation between rates of brain
atrophy and cognitive decline in AD. Neurology 52, 1687-1689.
Fox, N.C., Schott, J.M., 2004. Imaging cerebral atrophy: normal ageing to Alzheimer's
disease. Lancet 363, 392-394.
Frisoni, G.B., 2001. Structural imaging in the clinical diagnosis of Alzheimer's disease:
problems and tools. J Neurol Neurosurg Psychiatry 70, 711-718.
Garibotto, V., Borroni, B., Kalbe, E., Herholz, K., Salmon, E., Holtoff, V., Sorbi, S., Cappa,
S., Padovani, A., Fazio, F., Perani, D., in press, Education and occupation as proxies for
reserve in aMCI converters and AD: FDG-PET evidence. Neurology.
Gauthier, S., Reisberg, B., Zaudig, M., Petersen, R.C., Ritchie, K., Broich, K., Belleville, S.,
Brodaty, H., Bennett, D., Chertkow, H., Cummings, J.L., de Leon, M., Feldman, H.,
57
Ganguli, M., Hampel, H., Scheltens, P., Tierney, M.C., Whitehouse, P., Winblad, B.,
2006. Mild cognitive impairment. Lancet 367, 1262-1270.
Gazzaley, A., Cooney, J.W., Rissman, J., D'Esposito, M., 2005. Top-down suppression
deficit underlies working memory impairment in normal aging. Nat Neurosci 8, 12981300.
Gold, G., Giannakopoulos, P., Herrmann, F.R., Bouras, C., Kvari, E., 2007. Identification of
Alzheimer and vascular lesion thresholds for mixed dementia. Brain 130, 2830-2836.
Goldman, W.P., Price, J.L., Storandt, M., Grant, E.A., McKeel, D.W.J., Rubin, E.H., Morris,
J.C., 2001. Absence of cognitive impairment or decline in preclinical Alzheimer's
disease. Neurology 56, 361-367.
Gorno-Tempini, M.L., Hutton, C., Josephs, O., Deichmann, R., Price, C., Turner, R., 2002.
Echo time dependence of bold contrast and susceptibility artifacts. Neuroimage 15, 136142.
Gunter, J.L., Shiung, M.M., Manduca, A., Jack, C.R.J., 2003. Methodological considerations
for measuring rates of brain atrophy. J Magn Reson Imaging 18, 16-24.
Gtz, J., Schild, A., Hoerndli, F., Pennanen, L., 2004. Amyloid-induced neurofibrillary tangle
formation in alzheimerAlzheimer's disease: insight from transgenic mouse and tissueculture models. Int J Dev Neurosci 22, 453-465.
Halldin, C., Gulys, B., Farde, L., 2001. PET studies with carbon-11 radioligands in
neuropsychopharmacological drug development. Curr Pharm Des 7, 1907-1929.
Hansen, L.A., Masliah, E., Galasko, D., Terry, R.D., 1993. Plaque-only Alzheimer disease is
usually the Lewy body variant, and vice versa. J Neuropathol Exp Neurol 52, 648-654.
Harris, G.J., Lewis, R.F., Satlin, A., English, C.D., Scott, T.M., Yurgelun-Todd, D.A.,
Renshaw, P.F., 1996. Dynamic susceptibility contrast MRI of regional cerebral blood
volume in Alzheimer's disease. Am J Psychiatry 153, 721-724.
Haxby, J.V., Grady, C.L., Koss, E., Horwitz, B., Schapiro, M., Friedland, R.P., Rapoport,
S.I., 1988. Heterogeneous anterior-posterior metabolic patterns in dementia of the
Alzheimer type. Neurology 38, 1853-1863.
Head, D., Buckner, R.L., Shimony, J.S., Williams, L.E., Akbudak, E., Conturo, T.E.,
McAvoy, M., Morris, J.C., Snyder, A.Z., 2004. Differential vulnerability of anterior
white matter in nondemented aging with minimal acceleration in dementia of the
Alzheimer type: evidence from diffusion tensor imaging. Cereb Cortex 14, 410-423.
Herholz, K., 2003. PET studies in dementia. Ann Nucl Med 17, 79-89.
Herholz, K., Nordberg, A., Salmon, E., Perani, D., Kessler, J., Mielke, R., Halber, M., Jelic,
V., Almkvist, O., Collette, F., Alberoni, M., Kennedy, A., Hasselbalch, S., Fazio, F.,
Heiss, W.D., 1999. Impairment of neocortical metabolism predicts progression in
Alzheimer's disease. Dement Geriatr Cogn Disord 10, 494-504.
Herholz, K., Perani, D., Salmon, E., Franck, G., Fazio, F., Heiss, W.D., Comar, D., 1993.
Comparability of FDG PET studies in probable Alzheimer's disease. J Nucl Med 34,
1460-1466.
Herholz, K., Salmon, E., Perani, D., Baron, J.C., Holthoff, V., Frlich, L., Schnknecht, P.,
Ito, K., Mielke, R., Kalbe, E., Zndorf, G., Delbeuck, X., Pelati, O., Anchisi, D., Fazio,
F., Kerrouche, N., Desgranges, B., Eustache, F., Beuthien-Baumann, B., Menzel, C.,
58
59
and mild cognitive impairment measured with arterial spin-labeling mr imaging: initial
experience. Radiology 234, 851-859.
Kantarci, K., Jack, C.R.J., Xu, Y.C., Campeau, N.G., O'Brien, P.C., Smith, G.E., Ivnik, R.J.,
Boeve, B.F., Kokmen, E., Tangalos, E.G., Petersen, R.C., 2001. Mild cognitive
impairment and Alzheimer disease: regional diffusivity of water. Radiology 219, 101107.
Kantarci, K., Petersen, R.C., Boeve, B.F., Knopman, D.S., Weigand, S.D., O'Brien, P.C.,
Shiung, M.M., Smith, G.E., Ivnik, R.J., Tangalos, E.G., Jack, C.R.J., 2005. Dwi predicts
future progression to Alzheimer disease in amnestic mild cognitive impairment.
Neurology 64, 902-904.
Karas, G.B., Scheltens, P., Rombouts, S.A.R.B., Visser, P.J., van Schijndel, R.A., Fox, N.C.,
Barkhof, F., 2004. Global and local gray matter loss in mild cognitive impairment and
Alzheimer's disease. Neuroimage 23, 708-716.
Katzman, R., Fox, P., 1999. The world-wide impact of dementia. projections of prevalence
and costs. In Mayeaux, R., Christen, Y., (Eds.), Epidemiology of Alzheimer's disease:
from gene to prevention. Springer-Verlag, 1-17.
Kawas, C.H., 2003. Clinical practice. early Alzheimer's disease. N Engl J Med 349, 10561063.
Kemppainen, N., Ruottinen, H., Ngren, K., Rinne, J.O., 2000. PET shows that striatal
dopamine D1 and D2 receptors are differentially affected in AD. Neurology 55, 205-209.
Kepe, V., Huang, S., Small, G.W., Satyamurthy, N., Barrio, J.R., 2006. Visualizing pathology
deposits in the living brain of patients with Alzheimer's disease. Methods Enzymol 412,
144-160.
Kerrouche, N., Herholz, K., Mielke, R., Holthoff, V., Baron, J., 2006. 18FDG PET in
vascular dementia: differentiation from Alzheimer's disease using voxel-based
multivariate analysis. J Cereb Blood Flow Metab 26, 1213-1221.
Kippenhan, J.S., Barker, W.W., Nagel, J., Grady, C., Duara, R., 1994. Neural-network
classification of normal and Alzheimer's disease subjects using high-resolution and lowresolution PET cameras. J Nucl Med 35, 7-15.
Kipps, C.M., Duggins, A.J., Mahant, N., Gomes, L., Ashburner, J., McCusker, E.A., 2005.
Progression of structural neuropathology in preclinical huntington's disease: a tensor
based morphometry study. J Neurol Neurosurg Psychiatry 76, 650-655.
Klunk, W.E., Engler, H., Nordberg, A., Wang, Y., Blomqvist, G., Holt, D.P., Bergstrm, M.,
Savitcheva, I., Huang, G., Estrada, S., Ausn, B., Debnath, M.L., Barletta, J., Price, J.C.,
Sandell, J., Lopresti, B.J., Wall, A., Koivisto, P., Antoni, G., Mathis, C.A., 2004.
Imaging brain amyloid in Alzheimer's disease with pittsburgh compound-B. Ann Neurol
55, 306-319.
Knopman, D.S., 2006. Current treatment of mild cognitive impairment and Alzheimer's
disease. Curr Neurol Neurosci Rep 6, 365-371.
Knopman, D.S., DeKosky, S.T., Cummings, J.L., Chui, H., Corey-Bloom, J., Relkin, N.,
Small, G.W., Miller, B., Stevens, J.C., 2001. Practice parameter: diagnosis of dementia
(an evidence-based review). Report of the quality standards subcommittee of the
American Academy of Neurology. Neurology 56, 1143-1153.
60
Kuhl, D.E., Minoshima, S., Frey, K.A., Foster, N.L., Kilbourn, M.R., Koeppe, R.A., 2000.
Limited donepezil inhibition of acetylcholinesterase measured with positron emission
tomography in living Alzheimer cerebral cortex. Ann Neurol 48, 391-395.
de Leon, M., Mosconi, L., Blennow, K., DeSanti, S., Zinkowski, R., Mehta, P., Pratico, D., et
al., 2007. Imaging and csf studies in the preclinical diagnosis of Alzheimer's disease. Ann
N Y Acad Sci 1097, 114-145.
Leow, A.D., Yanovsky, I., Chiang, M., Lee, A.D., Klunder, A.D., Lu, A., Becker, J.T., Davis,
S.W., Toga, A.W., Thompson, P.M., 2007. Statistical properties of jacobian maps and the
realization of unbiased large-deformation nonlinear image registration. IEEE Trans Med
Imaging 26, 822-832.
Liu, Y., Stern, Y., Chun, M.R., Jacobs, D.M., Yau, P., Goldman, J.E., 1997. Pathological
correlates of extrapyramidal signs in Alzheimer's disease. Ann Neurol 41, 368-374.
Logothetis, N.K., Pauls, J., Augath, M., Trinath, T., Oeltermann, A., 2001.
Neurophysiological investigation of the basis of the fMRI signal. Nature 412, 150-157.
Logothetis, N.K., Pfeuffer, J., 2004. On the nature of the bold fMRI contrast mechanism.
Magn Reson Imaging 22, 1517-1531.
Logothetis, N.K., Wandell, B.A., 2004. Interpreting the bold signal. Annu Rev Physiol 66,
735-769.
Machulda, M.M., Ward, H.A., Borowski, B., Gunter, J.L., Cha, R.H., O'Brien, P.C., Petersen,
R.C., Boeve, B.F., Knopman, D., Tang-Wai, D.F., Ivnik, R.J., Smith, G.E., Tangalos,
E.G., Jack, C.R.J., 2003. Comparison of memory fMRI response among normal, MCI,
and Alzheimer's patients. Neurology 61, 500-506.
Maetzler, W., Reimold, M., Liepelt, I., Solbach, C., Leyhe, T., Schweitzer, K., Eschweiler,
G.W., Mittelbronn, M., Gaenslen, A., Uebele, M., Reischl, G., Gasser, T., Machulla, H.,
Bares, R., Berg, D., 2007. [(11)C]PIB binding in Parkinson's disease dementia.
Neuroimage 39, 1027-1033 .
Mayeux, R., Sano, M., 1999. Treatment of Alzheimer's disease. N Engl J Med 341, 16701679.
McDowell, I., Xi, G., Lindsay, J., Tierney, M., 2007. Mapping the connections between
education and dementia. J Clin Exp Neuropsychol 29, 127-141.
McKeith, I., O'Brien, J., Walker, Z., Tatsch, K., Booij, J., Darcourt, J., Padovani, A.,
Giubbini, R., Bonuccelli, U., Volterrani, D., Holmes, C., Kemp, P., Tabet, N., Meyer, I.,
Reininger, C., 2007. Sensitivity and specificity of dopamine transporter imaging with
123I-FP-CIT SPECT in dementia with Lewy bodies: a phase III, multicentre study.
Lancet Neurol 6, 305-313.
McKeith, I.G., Dickson, D.W., Lowe, J., Emre, M., O'Brien, J.T., Feldman, H., Cummings,
J., Duda, J.E., Lippa, C., Perry, E.K., Aarsland, D., Arai, H., Ballard, C.G., Boeve, B.,
Burn, D.J., Costa, D., Del Ser, T., Dubois, B., Galasko, D., Gauthier, S., 2005. Diagnosis
and management of dementia with Lewy bodies: third report of the DLB consortium.
Neurology 65, 1863-1872.
McKeith, I.G., Galasko, D., Kosaka, K., Perry, E.K., Dickson, D.W., Hansen, L.A., Salmon,
D.P., Lowe, J., Mirra, S.S., Byrne, E.J., Lennox, G., Quinn, N.P., Edwardson, J.A., Ince,
P.G., Bergeron, C., Burns, A., Miller, B.L., Lovestone, S., Collerton, D., Jansen, E.N.,
1996. Consensus guidelines for the clinical and pathologic diagnosis of dementia with
61
62
Mller, M.J., Greverus, D., Weibrich, C., Dellani, P.R., Scheurich, A., Stoeter, P., Fellgiebel,
A., 2007. Diagnostic utility of hippocampal size and mean diffusivity in amnestic MCI.
Neurobiol Aging 28, 398-403.
Ngandu, T., von Strauss, E., Helkala, E., Winblad, B., Nissinen, A., Tuomilehto, J., Soininen,
H., Kivipelto, M., 2007. Education and dementia: what lies behind the association?
Neurology 69, 1442-1450.
Nordberg, A., 2004. PET imaging of amyloid in Alzheimer's disease. Lancet Neurol 3, 519527.
Ogawa, S., Lee, T.M., Kay, A.R., Tank, D.W., 1990. Brain magnetic resonance imaging with
contrast dependent on blood oxygenation. Proc Natl Acad Sci U S A 87, 9868-9872.
Padovani, A., Borroni, B., Brambati, S.M., Agosti, C., Broli, M., Alonso, R., Scifo, P.,
Bellelli, G., Alberici, A., Gasparotti, R., Perani, D., 2006. Diffusion tensor imaging and
voxel based morphometry study in early progressive supranuclear palsy. J Neurol
Neurosurg Psychiatry 77, 457-463.
Pasquier, J., Michel, B.F., Brenot-Rossi, I., Hassan-Sebbag, N., Sauvan, R., Gastaut, J.L.,
2002. Value of (99m)Tc-ECD SPET for the diagnosis of dementia with Lewy bodies.
Eur J Nucl Med Mol Imaging 29, 1342-1348.
Perneczky, R., Drzezga, A., Diehl-Schmid, J., Schmid, G., Wohlschlger, A., Kars, S.,
Grimmer, T., Wagenpfeil, S., Monsch, A., Kurz, A., 2006. Schooling mediates brain
reserve in Alzheimer's disease: findings of fluoro-deoxy-glucose-positron emission
tomography. J Neurol Neurosurg Psychiatry 77, 1060-1063.
Persson, J., Lind, J., Larsson, A., Ingvar, M., Cruts, M., Van Broeckhoven, C., Adolfsson, R.,
Nilsson, L., Nyberg, L., 2006. Altered brain white matter integrity in healthy carriers of
the ApoE epsilon4 allele: a risk for AD? Neurology 66, 1029-1033.
Persson, J., Nyberg, L., Lind, J., Larsson, A., Nilsson, L., Ingvar, M., Buckner, R.L., 2006.
Structure-function correlates of cognitive decline in aging. Cereb Cortex 16, 907-915.
Petersen, R.C., 2004. Mild cognitive impairment as a diagnostic entity. J Intern Med 256,
183-194.
Petersen, R.C., Doody, R., Kurz, A., Mohs, R.C., Morris, J.C., Rabins, P.V., Ritchie, K.,
Rossor, M., Thal, L., Winblad, B., 2001. Current concepts in mild cognitive impairment.
Arch Neurol 58, 1985-1992.
Petit-Tabou, M.C., Landeau, B., Desson, J.F., Desgranges, B., Baron, J.C., 1998. Effects of
healthy aging on the regional cerebral metabolic rate of glucose assessed with statistical
parametric mapping. Neuroimage 7, 176-184.
Pike, K.E., Savage, G., Villemagne, V.L., Ng, S., Moss, S.A., Maruff, P., Mathis, C.A.,
Klunk, W.E., Masters, C.L., Rowe, C.C., 2007. Beta-amyloid imaging and memory in
non-demented individuals: evidence for preclinical Alzheimer's disease. Brain 130,
2837-44. .
Pizzolato, G., Chierichetti, F., Fabbri, M., Cagnin, A., Dam, M., Ferlin, G., Battistin, L.,
1996. Reduced striatal dopamine receptors in Alzheimer's disease: single photon
emission tomography study with the d2 tracer [123I]-IBZM. Neurology 47, 1065-1068.
Pratic, D., Clark, C.M., Liun, F., Rokach, J., Lee, V.Y., Trojanowski, J.Q., 2002. Increase of
brain oxidative stress in mild cognitive impairment: a possible predictor of Alzheimer
disease. Arch Neurol 59, 972-976.
63
Rabinovici, G.D., Seeley, W.W., Kim, E.J., Gorno-Tempini, M.L., Rascovsky, K., Pagliaro,
T.A., Allison, S.C., Halabi, C., Kramer, J.H., Johnson, J.K., Weiner, M.W., Forman,
M.S., Trojanowski, J.Q., Dearmond, S.J., Miller, B.L., Rosen, H.J., 2007. Distinct MRI
atrophy patterns in autopsy-proven Alzheimer's disease and frontotemporal lobar
degeneration. Am J Alzheimers Dis Other Demen 22, 474-488.
Rajah, M.N., D'Esposito, M., 2005. Region-specific changes in prefrontal function with age:
a review of PET and fMRI studies on working and episodic memory. Brain 128, 19641983.
Ransmayr, G., Seppi, K., Donnemiller, E., Luginger, E., Marksteiner, J., Riccabona, G.,
Poewe, W., Wenning, G.K., 2001. Striatal dopamine transporter function in dementia
with Lewy bodies and Parkinson's disease. Eur J Nucl Med 28, 1523-1528.
Reiman, E.M., Caselli, R.J., Chen, K., Alexander, G.E., Bandy, D., Frost, J., 2001. Declining
brain activity in cognitively normal apolipoprotein e epsilon 4 heterozygotes: a
foundation for using positron emission tomography to efficiently test treatments to
prevent Alzheimer's disease. Proc Natl Acad Sci U S A 98, 3334-3339.
Reiman, E.M., Caselli, R.J., Yun, L.S., Chen, K., Bandy, D., Minoshima, S., Thibodeau,
S.N., Osborne, D., 1996. Preclinical evidence of Alzheimer's disease in persons
homozygous for the epsilon 4 allele for apolipoprotein E. N Engl J Med 334, 752-758.
Reiman, E.M., Chen, K., Alexander, G.E., Caselli, R.J., Bandy, D., Osborne, D., Saunders,
A.M., Hardy, J., 2004. Functional brain abnormalities in young adults at genetic risk for
late-onset Alzheimer's dementia. Proc Natl Acad Sci U S A 101, 284-289.
Resnick, S.M., Pham, D.L., Kraut, M.A., Zonderman, A.B., Davatzikos, C., 2003.
Longitudinal magnetic resonance imaging studies of older adults: a shrinking brain. J
Neurosci 23, 3295-3301.
Rinne, J.O., Kaasinen, V., Jrvenp, T., Ngren, K., Roivainen, A., Yu, M., Oikonen, V.,
Kurki, T., 2003. Brain acetylcholinesterase activity in mild cognitive impairment and
early Alzheimer's disease. J Neurol Neurosurg Psychiatry 74, 113-115.
Rinne, J.O., Sahlberg, N., Ruottinen, H., Ngren, K., Lehikoinen, P., 1998. Striatal uptake of
the dopamine reuptake ligand [11C]beta-CFT is reduced in Alzheimer's disease assessed
by positron emission tomography. Neurology 50, 152-156.
Roe, C.M., Xiong, C., Miller, J.P., Morris, J.C., 2007. Education and Alzheimer disease
without dementia: support for the cognitive reserve hypothesis. Neurology 68, 223-228.
Rose, S.E., McMahon, K.L., Janke, A.L., O'Dowd, B., de Zubicaray, G., Strudwick, M.W.,
Chalk, J.B., 2006. Diffusion indices on magnetic resonance imaging and
neuropsychological performance in amnestic mild cognitive impairment. J Neurol
Neurosurg Psychiatry 77, 1122-1128.
Rypma, B., D'Esposito, M., 2000. Isolating the neural mechanisms of age-related changes in
human working memory. Nat Neurosci 3, 509-515.
Salat, D.H., Tuch, D.S., Greve, D.N., van der Kouwe, A.J.W., Hevelone, N.D., Zaleta, A.K.,
Rosen, B.R., Fischl, B., Corkin, S., Rosas, H.D., Dale, A.M., 2005. Age-related
alterations in white matter microstructure measured by diffusion tensor imaging.
Neurobiol Aging 26, 1215-1227.
Scarmeas, N., Albert, S.M., Manly, J.J., Stern, Y., 2006. Education and rates of cognitive
decline in incident Alzheimer's disease. J Neurol Neurosurg Psychiatry 77, 308-316.
64
Shinotoh, H., Aotsuka, A., Fukushi, K., Nagatsuka, S., Tanaka, N., Ota, T., Tanada, S., Irie,
T., 2001. Effect of donepezil on brain acetylcholinesterase activity in patients with AD
measured by PET. Neurology 56, 408-410.
Shinotoh, H., Namba, H., Fukushi, K., Nagatsuka, S., Tanaka, N., Aotsuka, A., Ota, T.,
Tanada, S., Irie, T., 2000. Progressive loss of cortical acetylcholinesterase activity in
association with cognitive decline in Alzheimer's disease: a positron emission
tomography study. Ann Neurol 48, 194-200.
Shoghi-Jadid, K., Small, G.W., Agdeppa, E.D., Kepe, V., Ercoli, L.M., Siddarth, P., Read, S.,
Satyamurthy, N., Petric, A., Huang, S., Barrio, J.R., 2002. Localization of neurofibrillary
tangles and beta-amyloid plaques in the brains of living patients with Alzheimer disease.
Am J Geriatr Psychiatry 10, 24-35.
Signorini, M., Paulesu, E., Friston, K., Perani, D., Colleluori, A., Lucignani, G., Grassi, F.,
Bettinardi, V., Frackowiak, R.S., Fazio, F., 1999. Rapid assessment of regional cerebral
metabolic abnormalities in single subjects with quantitative and nonquantitative
[18F]FDG PET: a clinical validation of statistical parametric mapping. Neuroimage 9,
63-80.
Silbert, L.C., Quinn, J.F., Moore, M.M., Corbridge, E., Ball, M.J., Murdoch, G., Sexton, G.,
Kaye, J.A., 2003. Changes in premorbid brain volume predict Alzheimer's disease
pathology. Neurology 61, 487-492.
Singh, V., Chertkow, H., Lerch, J.P., Evans, A.C., Dorr, A.E., Kabani, N.J., 2006. Spatial
patterns of cortical thinning in mild cognitive impairment and Alzheimer's disease. Brain
129, 2885-2893.
Small, G.W., Ercoli, L.M., Silverman, D.H., Huang, S.C., Komo, S., Bookheimer, S.Y.,
Lavretsky, H., Miller, K., Siddarth, P., Rasgon, N.L., Mazziotta, J.C., Saxena, S., Wu,
H.M., Mega, M.S., Cummings, J.L., Saunders, A.M., Pericak-Vance, M.A., Roses, A.D.,
Barrio, J.R., Phelps, M.E., 2000. Cerebral metabolic and cognitive decline in persons at
genetic risk for Alzheimer's disease. Proc Natl Acad Sci U S A 97, 6037-6042.
Small, G.W., Kepe, V., Ercoli, L.M., Siddarth, P., Bookheimer, S.Y., Miller, K.J., Lavretsky,
H., Burggren, A.C., Cole, G.M., Vinters, H.V., Thompson, P.M., Huang, S.,
Satyamurthy, N., Phelps, M.E., Barrio, J.R., 2006. PET of brain amyloid and tau in mild
cognitive impairment. N Engl J Med 355, 2652-2663.
Small, S.A., Perera, G.M., DeLaPaz, R., Mayeux, R., Stern, Y., 1999. Differential regional
dysfunction of the hippocampal formation among elderly with memory decline and
Alzheimer's disease. Ann Neurol 45, 466-472.
Smith, G.S., de Leon, M.J., George, A.E., Kluger, A., Volkow, N.D., McRae, T., Golomb, J.,
Ferris, S.H., Reisberg, B., Ciaravino, J., et al., 1992. Topography of cross-sectional and
longitudinal glucose metabolic deficits in Alzheimer's disease. pathophysiologic
implications. Arch Neurol 49, 1142-1150.
Snowdon, D.A., Ostwald, S.K., Kane, R.L., 1989. Education, survival, and independence in
elderly catholic sisters, 1936-1988. Am J Epidemiol 130, 999-1012.
Soto, C., 2003. Unfolding the role of protein misfolding in neurodegenerative diseases. Nat
Rev Neurosci 4, 49-60.
Stern, Y., 2002. What is cognitive reserve? theory and research application of the reserve
concept. J Int Neuropsychol Soc 8, 448-460.
65
Stern, Y., Alexander, G.E., Prohovnik, I., Mayeux, R., 1992. Inverse relationship between
education and parietotemporal perfusion deficit in Alzheimer's disease. Ann Neurol 32,
371-375.
Sullivan, E.V., Adalsteinsson, E., Pfefferbaum, A., 2006. Selective age-related degradation of
anterior callosal fiber bundles quantified in vivo with fiber tracking. Cereb Cortex 16,
1030-1039.
Talbot, P.R., Lloyd, J.J., Snowden, J.S., Neary, D., Testa, H.J., 1998. A clinical role for
99mTc-HMPAO SPECT in the investigation of dementia? J Neurol Neurosurg
Psychiatry 64, 306-313.
Tam, C.W.C., Burton, E.J., McKeith, I.G., Burn, D.J., O'Brien, J.T., 2005. Temporal lobe
atrophy on MRI in Parkinson disease with dementia: a comparison with Alzheimer
disease and dementia with Lewy bodies. Neurology 64, 861-865.
Taoka, T., Iwasaki, S., Sakamoto, M., Nakagawa, H., Fukusumi, A., Myochin, K., Hirohashi,
S., Hoshida, T., Kichikawa, K., 2006. Diffusion anisotropy and diffusivity of white
matter tracts within the temporal stem in Alzheimer disease: evaluation of the "tract of
interest" by diffusion tensor tractography. AJNR Am J Neuroradiol 27, 1040-1045.
Taylor, J.P., Hardy, J., Fischbeck, K.H., 2002. Toxic proteins in neurodegenerative disease.
Science 296, 1991-1995.
Thal, L.J., Kantarci, K., Reiman, E.M., Klunk, W.E., Weiner, M.W., Zetterberg, H., Galasko,
D., Pratic, D., Griffin, S., Schenk, D., Siemers, E., 2006. The role of biomarkers in
clinical trials for Alzheimer disease. Alzheimer Dis Assoc Disord 20, 6-15.
The Ronald and Nancy Reagan Research Institute of the Alzheimers Association and,
N.I.O.A.W.G., 1998. Consensus report of the working group on: "Molecular and
biochemical markers of Alzheimer's disease". The Ronald and Nancy Reagan research
institute of the Alzheimer's association and the national institute on aging working group.
Neurobiology of Aging 19, 109-116.
Thompson, P.M., Hayashi, K.M., Dutton, R.A., Chiang, M., Leow, A.D., Sowell, E.R., De
Zubicaray, G., Becker, J.T., Lopez, O.L., Aizenstein, H.J., Toga, A.W., 2007. Tracking
Alzheimer's disease. Ann N Y Acad Sci 1097, 183-214.
de Toledo-Morrell, L., Stoub, T.R., Bulgakova, M., Wilson, R.S., Bennett, D.A., Leurgans,
S., Wuu, J., Turner, D.A., 2004. MRI-derived entorhinal volume is a good predictor of
conversion from MCI to AD. Neurobiol Aging 25, 1197-1203.
Tyrrell, P.J., Sawle, G.V., Ibanez, V., Bloomfield, P.M., Leenders, K.L., Frackowiak, R.S.,
Rossor, M.N., 1990. Clinical and positron emission tomographic studies in the
'extrapyramidal syndrome' of dementia of the Alzheimer type. Arch Neurol 47, 13181323.
Valla, J., Berndt, J.D., Gonzalez-Lima, F., 2001. Energy hypometabolism in posterior
cingulate cortex of Alzheimer's patients: superficial laminar cytochrome oxidase
associated with disease duration. J Neurosci 21, 4923-4930.
Visser, P.J., Scheltens, P., Verhey, F.R., Schmand, B., Launer, L.J., Jolles, J., Jonker, C.,
1999. Medial temporal lobe atrophy and memory dysfunction as predictors for dementia
in subjects with mild cognitive impairment. J Neurol 246, 477-485.
Waldemar, G., Dubois, B., Emre, M., Georges, J., McKeith, I., Rossor, M., Scheltens, P.,
Tariska, P., Winblad, B., EFNS., 2007. Recommendations for the diagnosis and
66
magagement of Alzheimer's disease and other disorders associated with dementia: efns
guideline. European Journal of Neurology 14, e1-e26.
Walker, Z., Costa, D.C., Ince, P., McKeith, I.G., Katona, C.L., 1999. In-vivo demonstration
of dopaminergic degeneration in dementia with Lewy bodies. Lancet 354, 646-647.
Walker, Z., Costa, D.C., Janssen, A.G., Walker, R.W., Livingstone, G., Katona, C.L., 1997.
Dementia with Lewy bodies: a study of post-synaptic dopaminergic receptors with
iodine-123 iodobenzamide single-photon emission tomography. Eur J Nucl Med 24, 609614.
Walker, Z., Costa, D.C., Walker, R.W.H., Shaw, K., Gacinovic, S., Stevens, T., Livingston,
G., Ince, P., McKeith, I.G., Katona, C.L.E., 2002. Differentiation of dementia with Lewy
bodies from Alzheimer's disease using a dopaminergic presynaptic ligand. J Neurol
Neurosurg Psychiatry 73, 134-140.
Whitwell, J.L., Jack, C.R.J., 2005. Comparisons between Alzheimer disease, frontotemporal
lobar degeneration, and normal aging with brain mapping. Top Magn Reson Imaging 16,
409-425.
Winblad, B., Kilander, L., Eriksson, S., Minthon, L., Btsman, S., Wetterholm, A., JanssonBlixt, C., Haglund, A., 2006. Donepezil in patients with severe Alzheimer's disease:
double-blind, parallel-group, placebo-controlled study. Lancet 367, 1057-1065.
Winblad, B., Palmer, K., Kivipelto, M., Jelic, V., Fratiglioni, L., Wahlund, L.O., Nordberg,
A., Bckman, L., Albert, M., Almkvist, O., Arai, H., Basun, H., Blennow, K., de Leon,
M., DeCarli, C., Erkinjuntti, T., Giacobini, E., Graff, C., Hardy, J., Jack, C., Jorm, A.,
Ritchie, K., van Duijn, C., Visser, P., Petersen, R. C., 2004. Mild cognitive impairmentbeyond controversies, towards a consensus: report of the international working group on
mild cognitive impairment. J Intern Med 256, 240-246.
Yamaguchi, S., Meguro, K., Itoh, M., Hayasaka, C., Shimada, M., Yamazaki, H., Yamadori,
A., 1997. Decreased cortical glucose metabolism correlates with hippocampal atrophy in
Alzheimer's disease as shown by MRI and PET. J Neurol Neurosurg Psychiatry 62, 596600.
Zamrini, E., De Santi, S., Tolar, M., 2004. Imaging is superior to cognitive testing for early
diagnosis of Alzheimer's disease. Neurobiol Aging 25, 685-691.
Zuendorf, G., Kerrouche, N., Herholz, K., Baron, J., 2003. Efficient principal component
analysis for multivariate 3D voxel-based mapping of brain functional imaging data sets
as applied to FDG-PET and normal aging. Hum Brain Mapp 18, 13-21.
Chapter IV
ABSTRACT
Alzheimers disease (AD), Lewy-body disease (LBD) and Frontotemporal Dementia
(FTD) are the major causes of memory impairment and dementia. As new therapeutic
agents are under testing for the different diseases, there is an ultimate need for an early
differential diagnosis. Biomarkers can serve as early diagnostic indicators or as markers
of preclinical pathological changes. Therefore, diagnostic markers in the cerebrospinal
fluid (CSF) have become a rapidly growing research field, since CSF is in direct contact
with the central nervous system (CNS) and is supposed to reflect the brain environment.
So far, three CSF biomarkers, the 42 amino acid form of -amyloid (A), total tau
and phosphotau, have been validated in a number of studies. These CSF markers have
high sensitivity to differentiate early and incipient AD from normal aging, depression,
alcohol dementia and Parkinsons disease, but lower specificity against other dementias,
such as FTD and LBD.
This chapter reviews CSF biomarkers for AD, with emphasis on their role in the
clinical diagnosis.
1. INTRODUCTION
Alzheimers disease (AD) is the most common cause of dementia in the elderly, with a
prevalence of 5% after 65 years of age, increasing to about 30% in people aged 85 years or
68
Correspondence concerning this article should be addressed to: Eliana Venturelli, phone +390255033858; Fax:
+390250320430; e-mail: [email protected].
69
Figure 2. Schematic representation of the two major neuropathologic hallmarks of AD: extracellular
Amyloid (A) plaques and intracellular neurofibrillary tangles (NFTs).
1.2. Biomarkers
In view of existing and emerging therapeutic compounds there is a great need for reliable
biochemical diagnostic markers (biomarkers), allowing early and accurate diagnosis of
dementia, particularly for AD. Cerebrospinal fluid (CSF) is in direct contact with the
extracellular space of the brain, and thus biochemical changes in the brain are reflected in
CSF. A diagnostic marker for AD should reflect a central pathogenic process of the disorder,
such as the degeneration of neurons and their synapses and the defining lesions, naming,
senile plaques, deriving from the aggregation of A, and NFTs, resulting from
hyperphosphorylation of tau protein. A clinically useful diagnostic marker should have a
sensitivity exceeding 80% and a specificity above 80% according to the statement of the
Consensus Group for Biomarkers (The Ronald and Nancy Regan Research Institute of the
Alzheimers Association, 1998). The goals of this declaration were to define characteristics
of an ideal biological marker, to outline the process whereby a biological marker gains
acceptance in the medical and scientific community and to review the current status of all
proposed biomarkers for AD. According to the guidelines proposed, a diagnostic marker for
AD should reflect a central pathogenic process of the disorder. It must have the following
characteristics:
1. be able to detect a fundamental feature of Alzheimers neuropathology
2. validated in neuropathologically confirmed AD cases
3. precise (able to detect AD early in its course and distinguish it from other dementias)
4. reliable
5. non-invasive
6. simple to perform
7. inexpensive.
70
2. AMYLOID (A)
One of the first major findings in AD research was that Amyloid (A) is the main
protein constituent of senile plaques (Masters et al., 1985). A is produced continuously as a
soluble protein during normal cellular metabolism and is secreted into the extracellular space
and, thus, into the cerebrospinal fluid (CSF) (Seubert et al, 1992; Haass al., 1992). A is a
proteolytic cleavage product derived from the APP (Kang et al., 1987). The APP gene is
located on chromosome 21 (St George-Hyslop et al., 1987), has three major alternate splicing
variants with 770, 751 or 695 amino acids and is metabolized along two pathways. For the
generation of A, APP is cleaved after position 671 by a protease referred to as -secretase,
resulting in the release of a large N-terminal derivate called -secretase-cleaved soluble APP
(-sAPP), and in a second step by the -secretase complex releasing free A. The amyloid
peptides comprise a heterogeneous set of N- and C-terminally truncated peptides. The three
best known C-terminally truncated A peptides are A38, A40 and A42 (Schoonenboom et
al., 2005). A38 has been found to be the second prominent soluble A peptide species in
CSF after A40 (Wiltfang et al., 2002) (Figure 3).
71
Figure 3. APP Processing: -secretase and -secretase produce non-plaque forming p3, whereas secretase and -secretase produce amyloid plaque-forming A. The different regions of the APP protein
are indicated.
The role of APP in the central nervous system is not clear yet. A number of functional
domains have been mapped to the extra- and intracellular region of APP, including metal
(copper and zinc) binding motifs, extracellular matrix components (heparin, collagen and
laminin), neurotrophic and adhesion domains. Thus far, a thropic role for APP has been
suggested, as it stimulates neurite outgrowth in a variety of experimental settings. The Nterminal heparin-binding domain of APP also stimulates neurite outgrowth and promotes
synaptogenesis. In addition, an RHDS motif near the extralumenal portion of APP likely
promotes cell adhesion, possibly acting in an integrin-like manner. Similarly, APP
colocalizes with integrins on the surface of axons at sites of adhesion (Storey et al., 1996,
Yamazaki et al., 1997). Despite APP was initially proposed to act as a cell surface receptor,
the evidence supporting this hypothesis has been unconvincing.
72
Moderately low levels were also found in Lewy Body Dementia (LBD; Kanemaru et al.,
2000). A mild or moderate decrease in A42 was found in a percentage of patients with
Frontotemporal Dementia (FTD) and Vascular Dementia (VaD) (Sjgren et al., 2000),
whereas normal A42 were found in depression, Parkinsons disease and Progressive
Supranuclear Palsy (PSP) (Holmberg et al., 2003).
CSF A38 and A40 levels were similar in patients with AD compared with control
subjects. All three A peptides were related to each other, with the strongest correlation
between CSF A38 and A40 (Schoonenboom et al., 2005). The A42/A40 and A42/A38
ratios are considered to give information about the disease progression, typically in the early
stage of disease, because the cerebral deposition of A42 probably starts already before the
disease becomes clinically overt (Blennow and Hampel, 2003). This observation is in
agreement with an earlier report showing an increased A42/A40 ratio before the clinical
onset of AD (Kanai et al., 1998). CSF A42 alone is considered to be a stage marker,
reflecting the presence of the disease at certain stage. It would be of interest to investigate the
ratio of A42 to A40 and A38 in a group of patients with mild cognitive impairment,
observed longitudinally, to be informed when A42 starts to decrease in CSF, as compared
with A38 and A40, in relation with clinical progression.
73
contrast, subjects with other neurological disorders, including Parkinsons disease and PSP,
or psychiatric disorders (e.g. depression) showed normal CSF-T-tau levels (Blennow et al.,
1995; Morikawa et al., 1999; Urakami et al., 1999). T-tau therefore has a diagnostic value to
discriminate neurodegenerative disorders from pseudodementia due mainly to psychiatric
disorders.
74
2004). This implies that P-tau is considered to reflect the phosphorylation state of tau, being a
more direct biomarker for discriminating AD from others dementias.
Further, after acute stroke, there is a marked increase in CSF T-tau, while CSF P-tau
levels do not change (Hesse et al., 2001). These findings suggest that P-tau is not simply a
marker of neuronal damage (as T-tau is considered to be), but could specifically reflect the
phosphorylation state of tau, and thus possibly the formation of NFTs.
75
8. CONCLUSIONS
Combining data from several studies (Knopman, 2001; Blennow and Hampel, 2003), the
specificity for the three CSF biomarkers was 90% or more and the sensitivity was 86% for
A42, 81% for T-tau and 80% for P-tau. The combination of the three CSF biomarkers
enhances the precision of the AD diagnosis.
In summary, biological marker research is most advanced in the area of AD diagnosis.
Attention has been focused on finding one single marker for AD. This seems possible only if
the marker is related to a pathogenic step that is unique to AD. However, neural and synaptic
degeneration is not only found in AD, but in most chronic degenerative disorders of the brain.
Similarly, deposition of A is not specific for AD, but also found in normal aging (Beach,
2008) and LBD (Deramecourt et al., 2006), while formation of PHF into tangles may occur
also in normal aging and FTD (Von Bergen et al., 2001). This reduces the likelihood of
finding one single biochemical marker for AD. Today, the combined CSF biomarkers, when
used as adjuncts to the clinical diagnosis, have the potential to help differentiating AD from
normal aging (Castao et al., 2006), progressive supranuclear palsy (Holmberg et al., 2003),
FTD (Grossman et al., 2005), VaD (De Jong et al., 2006) and alcoholic dementia.
Future studies on CSF A42 and T-tau will assist in the characterization of risk
indicators by which measure the risk of cognitive decline and dementia for the initiation of
earlier intervention and possibly prevention strategies.
Lastly, it is reasonable to assume that the examined CSF markers should not be used as
isolated tests and the clinical diagnosis of AD should be based on cumulative information
gained from clinical examination (memory disturbance), neuropsychological test batteries,
brain-imaging (SPECT, MRI) and CSF biochemical assays. Biomarkers may have their most
important value early in the course of the disease when the diagnosis is the most troublesome
and may be an aid for clinicians in setting the diagnosis already at the first clinical
evaluation.
REFERENCES
American Psychiatric Association: Diagnostic and Statistical Manual of Mental Disorders,
ed4 (DSM-IV). Washington, American Psychiatric Association, 1994.
Andreasen N, Vanmechelen E, Van de Voorde A, Davidsson P, Hesse C, Tarvonen S, et al.
Cerebrospinal fluid tau protein as a biochemical marker for Alzheimers disease: a
community-based follow-up study. J Neurol Neurosurg Psychiatry 1998; 64: 298-305.
Andreasen N, Sjgren M, Blennow K. CSF markers for Alzheimers disease: total tau,
phospho-tau and Abeta42. World J Biol Psychiatry 2003; 4(4): 147-155.
Andreasen N, Vanmechelen E, Van de Voorde A, Davidsson P, Hesse C, Tarvonen S, et al.
Cerebrospinal fluid tau protein as a biochemical marker for Alzheimers disease: a
community-based follow-up study. J Neurol Neurosurg Psychiatry 1998; 64: 298-305.
Arai H, Nakagawa T, Kosaka Y, Higuchi M, Matsui T, Okamura N, et al. Elevated
cerebrospinal fluid tau protein level as a predictor of dementia in memory-impaired
patients. Alzheimers Res 1997; 3: 211-213.
76
77
Hampel H, Teipel SJ, Fuchsberger T, et al. Value of CSF beta-amyloid 1-42 and tau as
predictors of Alzheimers disease in patients with mild cognitive impairment. Mol
Psychiatry 2004; 9: 705-710.
Hansson O, Zetterberg H, Buchhave P, Londos E, Blennow K, Minthon L. Association
between CSF biomarkers and incipient Alzheimers disease in patients with mild
cognitive impairment: a follow-up study. Lancet Neurol 2006; 5: 228-234.
Hasegawa M. Biochemistry and molecular biology of tauopathies. Neuropathology 2006; 26:
484-490.
Hesse C, Rosengren L, Vanmechelen E, Vanderstichele H, Jensen C, Davidsson P, et al.
Cerebrospinal fluid markers for Alzheimers disease evaluated after acute ischemic
stroke. J Alzheimer Dis; 2000; 2: 199-206.
Hesse C, Rosengren L, Andreasen N, Davidsson P, Vanderstichele H, Vanmechelen E,
Blennow K. Transient increase in CSF-total-tau but not phospho-tau after acute stroke.
Neurosci Lett 2001; 297: 187-190.
Holmberg B, Johnels B, Blennow K, Rosengren L. Cerebrospinal fluid Abeta42 is reduced in
multiple system atrophy but normal in Parkinsons disease and progressive supranuclear
palsy. Mov Disord 2003; 18: 186-190.
Hoozemans JJM, Veerhuis R, Rozemuller JM, Eikelenboom P. Neuroinflammation and
regeneration in the early stages of Alzheimers disease pathology. Int J Neuroscience
2006; 24: 157-165.
Hu YY, He SS, Wang X, Duan QH, Grundke-Iqbal I, Iqbal K, et al. Levels of
nonphosphorylated and phosphorylated tau in cerebrospinal fluid of Alzheimers disease
patients: an ultrasensitive bienzyme-substrate-recycle enzyme-linked immunosorbent
assay. Am J Pathol 2002; 160: 1269-1278.
Hulstaert F, Blennow K, Ivanoiu A, et al. Improved discrimination of AD patients using
[beta]-amyloid(1-42) and tau levels in CSF. Neurology 1999; 52(8): 1555-1562.
Iqbal K, Grundke-Iqbal I. Machanism of Alzheimer neurofibrillary degeneration and the
formation of tangles. Mol Psychiatry 1997; 2: 178-180.
Ishiguro K, Ohno H, Arai H, Yamaguchi H, Urakami K, Park JM et al. Phosphorylated tau in
human cerebrospinal fluid is a diagnostic marker for Alzheimers disease. Neurosci Lett
1999; 270: 91-94.
Kanai M, Matsubara E, Isoe K, el at. Longitudinal study of cerebrospinal fluid levels of tau,
Abeta 1-40, and Abeta 1-42(43) in Alzheimers disease: a study in Japan. Ann Neurol
1998; 44: 17-26.
Kanemaru K, Kameda N, Yamanouchi H. Decreased CSF amyloid beta42 and normal tau
levels in dementia with Lewy bodies. Neurology 2000; 54: 1875-1876.
Kang J, Lemaire HG, Unterbeck A, Salbaum JM, Masters CL,Grzeschik KH, Multhaup G,
Beyreuther K, Muller-Hill B. The precursor of Alzheimers disease amyloid A4 protein
resembles a cell surface receptor. Nature 1987; 325: 733736.
Knopman DS. Cerebrospinal fluid -amyloid and tau proteins for the diagnosis of Alzheimer
disease. Arch Neurol 2001; 58: 349-350.
Kohnken R, Buerger K, Zinkowski R, Miller C, Kerkman D, De Bernardis J et al. Detection
of tau phosphorylated at threonine 231 in cerebrospinal fluid of Alzheimers disease
patients. Neurosci Lett 2000; 287: 187-190.
78
Maruyama M, Matsui T, Tanji H, et al. Cerebrospinal fluid tau protein and periventricular
white matter lesions in patients with mild cognitive impairment: implications for 2 major
pathways. Arch Neurol 2004; 61: 716-720.
Masters CL, Simms G, Weinman NA, Multhaup G, McDonald BL, Beyreuther K. Amyloid
plaque core protein in Alzheimers disease and Down syndrome. Proc Natl Acad Sci
1985; 82: 42454249.
McKhann G, Drachman DA, Folstein MF, Katzman R, Prince D, Stadlan EM: Clinical
diagnosis of Alzheimers disease: Report of the NINCDS-ADRDA work group under the
auspices of the Department of Health and Human Services task force on Alzheimers
disease. Neurology 1984; 34: 939-944.
Morikawa Y, Arai H, Matsushita S, Kato M, Higuchi S, Miura M, Kawakami H, Higuchi M,
Okamura N, Tashiro M, Matsui T, Sasaki H. Cerebrospinal fluid tau protein levels in
demented and non-demented alcoholics. Alcohol Clin Exp Res 1999; 23: 575-577.
Otto M, Wiltfang J, Tumani H, Zerr I, Lantsch M, Kornhuber J, Weber T, Kretzschmar HA,
Poser S. Elevated levels of tau-protein in cerebrospinal fluid of patients with CreutzfeldtJacob disease. Neurosci Lett 1997; 225: 210-212.
Parnetti L, Lanari A, Amici S, Gallai V, Vanmechelen E, Hulstaert F. CSF phosphorylated
tau is a possibile marker for discriminating Alzheimers disease from dementia with
Lewy bodies. Phospho-Tau International Study Group. Neurol Sci 2001; 22: 77-78.
Petersen RC. Normal aging, mild cognitive impairment, and early Alzheimers disease.
Neurologist 1995; 1: 326-344.
Petersen RC, Parisi JE, Hohnson KA, Waring SC, Smith GE. Neuropathological findings in
patients with a mild cognitive impairment. Neurology 1997, 48: A102.
Riemenschneider M, Lautenschlager N, Wagenpfeil S, Diehl J, Drzezga A, Kurz A.
Cerebrospinal Fluid Tau and -Amyloid 42 proteins identify Alzheimer Disease in
subjects with Mild Cognitive Impairment. Arch Neurol 2002; 59: 1729-1734.
Schoonenboom N, Mulder C, Van Kamp J, Mehta S, Scheltens P, Blankstein M, Mehta P.
Amyloid 38, 40 and 42 species in cerebrospinal fluid: more of the same? Ann Neurol
2005; 58: 139-142.
Seubert P, Vigo-Pelfrey C, Esch F, Lee M, Dovey H, Davis D, et al. Isolation and
quantification of soluble Alzheimers -peptide from biological fluids. Nature 1992; 359:
325327.
Sjgren M, Davidsson P, Wallin A, Granerus AK, Grundstrm E, Askmark H, et al.
Decreased CSF -amyloid42 in Alzheimers disease and amyotrophic lateral sclerosis
may reflect mismetabolism of -amyloid induced by separate mechanism. Dement
Geriatr Cogn Disord 2002; 13: 112-118.
Sjgren M, Vanderstichele H, Agren H, et al. Tau and A42 in cerebrospinal fluid from
healthy adults 21-93 years of age: establishment of reference values. Clin Chem 2001; 47
(10): 1776-1781.
Sjgren M, Minthon L, Davidsson P, Granrus AK, Clarberg A, Vanderstichele H, et al. CSF
levels of tau, -amyloid 1-42 and GAP-43 in frontotemporal dementia, other types of
dementia and normal aging. J Neural Transm 2000; 107: 563-579.
79
St George-Hyslop PH, Tanzi RE, Polinsky RJ, Haines JL, Nee L, Watkins PC, et al. The
genetic defect causing familial Alzheimers disease maps on chromosome 21. Science
1987; 235: 885890.
Storey E, Spurck T, Pickett-Heaps J, et al. The amyloid precursor protein of Alzheimer's
disease is found on the surface of static but not activity motile portions of neurites. Brain
Res. 1996; 735(1): 59-66.
Strozyk D, Blennow K, White LR, Launer LJ. CSF A42 levels correlate with amyloidneuropathology in a population-based autopsy study. Neurology 2003; 60: 652-656.
The Ronald and Nancy Regan Research Institute of the Alzheimers Association. The
National Institute on Aginig Working Group: Consensus report of the Working Group on
Molecular and Biochemical Markers of Alzheimers Disease. Neurobiol of Aging 1998;
19: 109-116.
Urakami K, Mori M, Wada K, Kowa H, Takeshima T. Harai H, et al. A comparison of tau
protein in cerebrospinal fluid between corticobasal degeneration and progressive
supranuclear palsy. Neurosci Lett 1999; 259: 127-129.
Vanmechelen E, Vanderstichele H, Davidsson P, Van Kerschaver E, Van Der Perre B,
Sjgren M, et al. Quantification of tau phosphorylated at threonine 181 in human
cerebrospinal fluid: a sandwich ELISA with a synthetic phosphopeptide for
standardization. Neurosci Lett 2000; 285: 49-52.
Von Bergen M, Barghom S, Li L, Marx A, et al. Mutations of tau protein in frontotemporal
dementia promote aggregation of paired helical filaments by enhancing local betastructure. J Biol Chem 2001; 276(51): 48165-74.
Wiltfang J, Esselmann H, Bibl M, et al. Highly conserved and disease-specific patterns of
carboxyterminally truncated Abeta peptides 1-37/38/39 in addition to 1-40/42 in
Alzheimers disease and in patients with chronic neuroinflammation. J Neurochem 2002;
81: 481-496.
Yamazaki T, Koo EH, Selkoe DJ. Cell surface amyloid beta-protein precursor colocalizes
with beta 1 integrins at substrate contact sites in neural cells. J Neurosci 1997;
17(3):1004-1010.
Chapter V
ABSTRACT
The development of validated biomarkers for Alzheimers disease is essential to
improve diagnosis and accelerate the development of new therapies. This chapter
provides a roadmap for AD biomarker development, illustrating the optimization,
qualification, and clinical validation of a potential assay through the example of a new
multiplex biomarker test (INNO-BIA AlzBio3) that quantifies key AD biomarkers in
cerebrospinal fluid. Both the product and analytical qualification of this assay are
presented in detail, followed by the clinical qualification of the test using autopsyconfirmed samples from demented patients. Finally, the analytical performance of the test
in a multicenter study carried out in the United States and Europe is discussed. It is clear
that the process of biomarker development in general, and for Alzheimers disease
biomarkers in particular, is fraught with particular challenges that must be addressed in
order to bring potential AD biomarkers to clinical utility.
82
83
Marker selection
Phase 1
Model building
Phase 2
Model validation
Phase 3
Figure 1. Biomarker clinical development scheme. Figure reproduced with permission from The
Thomson Corporation and De Meyer G, Shapiro F: Drug Development: The road to clinical utility.
Curr Drug Disc (May 2003):23-27. 2007 The Thomson Corporation.
84
85
diagnostic test (including biomarkers and model) is presented to registration authorities for
evaluation. In the area of the neurodegenerative diseases, however, this decision should
consider the potential gap between the early clinical diagnosis used for model building and
the gold standard of autopsy-confirmed diagnosis.
1.3.4. Cyclic Improvement of Biomarkers
The process of clinical development for biomarkers is more than just a finite set of
milestones towards a goal, but also as an iterative tool for further improvement of biomarker
performance. Indeed, going through a series of model validation and model building stages
offers real perspectives for substantial improvements in performance.
While cyclic model validation and model building are often the way ahead for some
applications, in other cases, building the first model can pose a real challenge. The area of
early AD diagnosis is a case in point. Here, much attention is being devoted to diagnosing
AD at its earliest stages, when therapeutic interventions might be most effective. However, it
is increasingly understood that AD begins insidiously, long before overt symptoms are
observed. Biomarkers, reflecting subtle biochemical or structural changes, may therefore be
particularly suitable for use in early diagnosis.
Nevertheless, the difficulties in developing AD biomarkers, especially for detecting AD
at its outset are manifold, given the poor understanding of early neuropathological events; the
paucity of early-stage pathological fingerprints that can help distinguish normal aging from
incipient disease; the challenge of knowing which of the dementias or whether mixed
pathologies are present; the very slow, insidious progression of AD; the often limited number
of well-defined clinical samples available at a particular location; and the resulting
impediments to set up clear-cut testing groups. This has frequently led to contradictory
results: what has been found to be statistically significant and promising in one study has
subsequently been shown to fall short during further development. On the other hand, it
should not be forgotten that negative or borderline results can prove invaluable irrespective
of whether they confirm or invalidate previous findings.
1.3.5. Accelerated Biomarker Development through Data Pooling
How can biomarkers emerge from this chicken and egg conundrum? Well-designed
longitudinal studies are one element, so that clear disease phenotypes eventually emerge or
not. Such studies take time. Another way over this hurdle is to join forces and combine
biomarker results from different clinical centers. Although conceptually simple, the notion of
data pooling (or data fusion) involves the sharing of information and samples. This means
transforming current attitudes towards collective benefits: switching from a mentality of own
data analysis towards a meta-analysis mode. The practical implementation of data pooling
faces many challenges (e.g., standardization of sample collection, storage, and processing,
assay format and data interpretation, as well as intellectual property rights). Care must be
taken, however, to maximize the information extracted from the samples over the background
noise generated by between-center variations. This can be met by applying a strict clinical
trial framework (design, efficacy criteria, statistical methodology, etc.). Alternatively, other
approaches can be envisaged such as collecting data in routine laboratories, provided that
data quality (including diagnosis) is sufficiently documented.
86
Given the emerging public health crisis caused by the age-related, exponential growth in
the number of cases of dementia and their concomitant costs, an increasing number of
worthwhile initiatives involving the cooperation of government, academia, foundations, and
industry have arisen in recent years to maximize the availability of useful data for sharing.
One well-known example is the National Institute of Agings Alzheimer Disease
Neuroimaging Initiative (ADNI). Data from this initiative, involving some 800 individuals
followed for 3 years, have already become available through the ADNI (www.adni-info.org/ )
and Laboratory of Neuroimaging, UCLA (LONI; www.loni.ucla.edu/ADNI/) websites as of
March 2008. The project has not only developed standardized neuroimaging and biochemical
marker methods to be used in AD trials, but seeks to validate AD neuroimaging and
biomarker findings by correlating them with neuropsychological and behavioural test data.
Another example of standardization is the PENN biomarker development program at the
University of Pennsylvania School of Medicine. The program uses data collected in
accordance with the Uniform Data set assessment protocol established by the National
Alzheimers Coordinating Center. This protocol is now used by all 32 Alzheimers Disease
Centers to standardize and objectivize the collection and reporting of data.
Examples of data sharing in Europe also are increasingly frequent. In Germany, the
Kompetenznetz Demenzen (the Dementia Competence Network) has been receiving support
from the Federal Ministry of Education and Research (BMBF) since 2002. One of its main
priorities is the development and optimization of methods for early diagnosis and treatment
of dementia. The collection of epidemiological data and the identification of risk factors will
also serve to provide new insights into the origin and course of dementing diseases. Plans are
also being drawn up to establish a central gene database for dementing diseases.
In Sweden, the Swedish Brain Power program started in 2005 based on funding from the
Invest in Sweden Agency (ISA) and five other foundations. The overall aim is to improve
early diagnosis, treatment, and care for people with neurodegenerative diseases. The Svenska
Demensregistret (the Swedish Dementia Register), is one useful by-product of this initiative.
Established in 2007, its aim is to build a national quality register with data on, among other
things, improved diagnostics, treatment, and follow-up for patients with dementia disorders.
This will create new possibilities to improve the quality of Swedish dementia care. Some 15
clinics and one health center have already begun to report their data to the register.
Such combined efforts will help accelerate the development of biomarkers to improve
early diagnosis and treatment of AD and other neurodegenerative conditions.
87
88
Protein isoforms
identification of potential protein biomarker candidates, including but not limited to TAR
DNA-binding protein 43 (TDP-43), -amyloid oligomers or protofibrils, truncated A
isoforms, phosphorylated tau forms (P-tau199P, P-tau181P, P-tau231P), and homocysteine
(Hampel et al. 2008; Shaw et al. 2007).
The levels of beta-amyloid (A) peptides, which are derived from the larger amyloid
precursor protein, are considered as a reflection of plaque formation, while levels of total
tau/phosphorylated tau (P-tau181P) reflect tangle formation (Ballatore et al. 2007). The origin,
structure, and function of these proteins are shown in Figure 3 for tau isoforms, and Figure 4
for A. Until now, testing has been limited to single-analyte assays run in parallel. Wellestablished ELISA-based testing methods are available for assessment of candidate CSF
biomarkers such as CSF A42, tau, and P-tau181P or P-tau231P.
adult
phosphorylation/dephosphorylation
mutations
covalent modification
other ?
fetal
Tau aggregation
kinase: upregulation
abberant activation
phosphatases: downregulation
mutations
covalent modification
other?
DIRECT
A-mediated toxicity
oxidative stress
inflammation
others?
Detachment from MT
Unbound tau
INDIRECT
Tau hyperphosphorylation
Misfolding
Pre-tangles
Loss of function
Detachment from MT
Loss of MT stabilizing function
Filamentous inclusions
(NFTs)
Neurotoxicity
Compromized axonal transport
Figure 3. The tau protein. The domain structure of the tau isoforms (tau gene location: 17q21) that are
expressed in the human brain are shown. The isoforms differ (1) in the number of tubulin-binding
domains (three or four repeats located in the C-terminal half of the protein; referred to as 3R or 4R tau
isoforms) and (2) in the presence or absence of either one or two 29-amino-acid-long, highly acidic
inserts at the N-terminal portion of the protein (the projection domain). The flow towards neurotoxicity
is shown. (MT = microtubule; NFT = neurofibrillary tangles; PHF = paired helical filaments).
Platform selection.
Platform feasibility evaluation for its intended use.
Analytical qualification of the assay developed on the selected platform.
89
Comparison of the clinical performance of the multiplex assay formats, with the
currently available single-analyte enzyme-linked immunosorbent assay (ELISA) for
the same analytes, widely accepted as the current standard (= clinical
qualification).
An extensive equivalence study to verify whether the different techniques may yield
different numerical results. Rapid acceptance by the market of a new multiplex
technology for use in clinical research is largely dependent on achieving equivalent
results to those obtained using ELISA techniques.
A
-secretase
KMDAEF
alpha-secretase
gamma-secretase
RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA . . V
NEP
ECE-1
Plasmin
IDE
Figure 4. The -amyloid peptide. A. Direct and indirect events that can contribute to -amyloid
pathogenesis. B. Amyloid precursor protein (APP) and A processing enzymes. (A = -amyloid; APP
= amyloid precursor protein; CTF = carboxy terminus-modified fraction; ECE = endothelin converting
enzyme; IDE = insulin-degrading enzyme; NEP = neprilysin).
90
91
Microspheres
- materials : polystyrene
- diameter : 5.5 M
2 fluorochromes
Gating
100
color-coded
microspheres
region
Regio
Signal
92
The design of the xMAP technology, together with its flexibility, allows simultaneous
measurement of more than 100 analytes. As the list of AD biomarkers is constantly growing,
and assuming that no limiting cross-reactivity occurs, one could envision the establishment of
panels to broadly address all clinical and research applications. An important pitfall of
customized assays (often prepared by vendors on request of customers) is the absence of full
qualification reports or a link of the assay accuracy in function of the protein combinations in
the panel. Another key concern in the evaluation of multiplex bead array assays is the
possibility that multiplexing, in itself, results in anomalies in quantification of some of the
analytes (~matrix effects). Interfering substances can result in faulty measurements. During
the development phase, the equivalent performance between single analyte measurements
and multiplex formats needs to be documented. One may not assume that a reliable singleanalyte assay can be automatically modified and transformed into a multiplex array format.
For a product targeting the in vitro diagnostic (IVD) market, the inclusion of an extra
biomarker in the panel is feasible when (i) there is a proven link to one of the hallmarks of
the disease, (ii) the clinical diagnostic performance, either on the level of diagnosis or
individual patient management, is significantly improved, or (iii) there is a well-documented
added value for the users of the test. Each new panel composition (or an extension of an
existing set of biomarkers) should be re-evaluated (full or partial validation), when
developing custom-made protein panel combinations.
93
ELISA
INNOTEST
-AMYLOID (1 -42)
10
11
12
13
14
15
16
18
19
20
21
22
23
24
INNOTEST hTAU Ag
2 h 40 min to 3 h 45 min
less
INNO-BIA AlzBio3
xMAP
17
time (h)
3 ELISA s
Hands -on time: 2 h 50 min - 4 h
Assay run t ime: 21 h 50 min to 22 h 40 min
Total handling steps: 15
xMAP
Hands -on time: 1 h 55 min to 2 h 10 min.
Assay run time: 18 h 55 to 19 h 10 min.
Handling steps: 5
= hands-on-time
= incubation
= reading + calculation
94
chemistry is optimized for each component individually in order to achieve an optimal signalto-noise ratio (= high signal in the biological samples together with low background values in
analyte-negative fluidics), an acceptable analytical sensitivity, a mAb that maintains its
specificity, affinity, and immunological stability over time.
The coupling of the mAbs to the solid phase, either by passive adsorption to plates
(ELISA) or by chemical coupling to beads (xMAP technology) is a crucial step in the process
of immunoassay development. For the covalent coupling of mAbs in the xMAP technology,
carboxylated polystyrene beads from different microsphere region numbers are chemically
coupled with the mAbs. The coupling procedure is optimized for each mAb individually by a
design of experiments approach (Figure 7). A number of variables are included in the test
protocol: the concentration of coupling reagents (e.g., 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC), sulphosuccinimidyl-2-(biotinamido)ethyl-1,3-dithiopropionate (SulphoNHS)) and mAbs; the instrumentation conditions (shaking protocol, centrifugation), and the
process boundary conditions (time and temperature). In-process control of mAb-coupling
homogeneity is obtained by the determination of (a) the amount of mAb coupled to the
microspheres (non-functional test format), (b) the coefficient of variation (CV) for counting
of 100 beads from the same region, and (c) the signal-to-noise ratio for a specific analyte
concentration (functional test format). In general, selection of the best coupling protocol
takes into account the combined results for analytical sensitivity, signals in biological
samples, coupling variability, and test precision (Figure 7).
Signal intensity
Signal variability
1.2
1.0
1.0
0.8
0.8
0.6
0.6
0.4
0.4
0.2
0.2
[ EDC ]
[ EDC ]
Variable 2
1.2
0.0
0.0
-0.2
-0.2
-0.4
-0.4
-0.6
-0.6
-0.8
-0.8
-1.0
0.6-1.0
0.4
0.2-1.2
0
-1.2
-0.2
-1.2
-1.2
-1.0
-0.8
-0.6
-0.4
-0.2
0.0
0.2
[ Ab ]
0.4
Variable 1
0.6
0.8
1.0
1.2
FUNCTIONAL
TEST
-1.0
-0.8
-0.6
-0.4
-0.2
0.0
0.2
0.4
0.6
0.8
1.0
1.2
[ Ab ]
1
0.8
0.6
0.4
0.2
Variable 1
Parameter settings
Figure 7. mAb coupling optimization. Design of experiments was used to optimize the coupling with
respect to signal intensity and signal variability. The numbering on the x-axis and y-axis refers to
concentration settings around the midpoint (settings 0). Areas in red (left) or green (right) represent
the most optimal conditions for the output variables. Results for two of the variables in the process are
depicted.
95
After identification of the target biomarker, internal and external qualification of the
suppliers for the critical raw materials (synthetic peptides, antibodies, detection conjugates)
or non-critical raw materials (filter plates, immunoplates) is done using predefined quality
control procedures. Product qualification requires documentation of lot-to-lot variability, inprocess control, and availability of long-term/freeze-thaw stability data. The latter aspect can
result in the loss of immunoreactivity for the key assay reagents, while a number of other
confounding factors (e.g., impurities, post-translation modifications, aggregation state, buffer
additives) may also contribute to the performance of the total assay.
96
97
21F12 - 3D6
xMAP
(Arbitrary units)
2000
ON
4
2
1
1500
1000
500
0
10 1
10 2
10 3
10 4
10 5
10 6
A1-42 (pg/mL)
Figure 8. Incubation time requirements to develop an assay for A1-42 using xMAP technology. A1-42
was incubated for various times using beads coupled with 21F12 and biotinylated 3D6-mAb. An
acceptable analytical sensitivity was only obtained after an overnight (ON) incubation step. (h =hours
of incubation).
4.1.5. mAbs
The mAb pairs were selected based on their intended use, their application range, and
their compatibility with the technology. Each analyte in the assay was quantified using a
combination of two different mAbs. Three mAbs [AT120 (IgG1), AT270 (IgG1), HT7
(IgG1)] were included in the kit to develop a combined T-tau/P-tau assay, while two mAbs
[4D7A3 (IgG1), 3D6 (IgG2b)] allow quantification of A1-42. The format of the ELISA and
the xMAP assays for each analyte are not fully comparable (see also Table 1).
For the tau assays, it was shown that the analytical sensitivity of the assay, verified using
recombinant tau, is largely dependent on the mAb combination used (Figure 9). Two bead
regions (region 2, region 69) were coupled individually with a phospho-specific mAb
(AT270, epitope: P176PAPKTP182; numbering related to the longest tau isoforms
(Vanmechelen et al. 2000)) or phosphorylation-independent mAb (AT120; epitope:
P218PTREPK224), while the biotinylated detector antibody (HT7) was able to bind all forms of
human tau (epitope: P159PGQK163). This resulted in combined quantification of levels of Ttau and P-tau181P. In the case of P-tau181P, an assay format with HT7 as capturing mAb,
instead of AT270, would have resulted in a better analytical sensitivity and an identical assay
concept to that of the ELISA assay. It is also not uncommon in immunoassay development
that the switch of the same antibody pair as capture and detector mAb can result in different
absolute values in biological samples, an effect which cannot be compensated for by the
calibrator curves.
98
HT7
- BT2
HT7
- AT270
HT7
- BT2/AT120
MFI
AT270 - HT7
1000
AT120 - BT2/HT7
100
BT2
- HT7
BT2
- HT7/AT120
HT9
- BT2/HT7
10
1
10
100
1000
10000
100000
Figure 9. Selection of mAbs to develop the T-tau immunoassay using xMAP technology. Different
combinations of mAbs were used to develop a tau assay. The epitopes of each mAb are shown in the
insert in the figure. A sandwich immunoassay was developed in which mAbs were used after coupling
to microspheres or after biotinylation. Recombinant tau was used to generate the calibration curves.
(MFI = median fluorescence intensity).
For A quantification, mAb 4D7A3 was included, which binds to A at the carboxyterminus. Since each mAb generated against the same protein can have different properties, a
comparison was performed on the different platforms (ELISA, xMAP) between the
immunoreactivity of 21F12 (used in the ELISA assay) and 4D7A3 (used in the xMAP assay)
using a set of 40 CSF samples. In both cases, biotinylated 3D6 was used as detector antibody.
A good correlation was obtained for the comparison of 4D7A3-21F12 using xMAP
technology (r2 = 0.937; slope: 1.122 0.047) or ELISA (r2 = 0.897; slope: 0.983 0.054).
Method comparison approaches (Olsson et al. 2005) revealed no major differences in
function of the technology platform between results obtained with 21F12 or 4D7A3,
indicating that the behavior of the mAbs was identical using the different technologies.
mAbs HT7 and 3D6 are human-specific. No immunoreactivity was observed with mouse
or rat A (data not shown).
99
Concentrations are only reported for values within the concentration ranges of the calibrator
series. For the xMAP assay, as well as for the single-analyte ELISAs, the concentration range
for each analyte covers the concentration range distribution for healthy subjects and AD
patients (Figure 11). The concentration range for T-tau, phosphorylated tau, and A1-42 in a
set of CSF samples (n=200, obtained from autopsy-confirmed dementia subjects and healthy
controls) are shown in Figure 11.
100000
Analyte
1000
100
OD (1/m)
MFI
10000
Total tau
A1-42
P-tau181P
10
1
0.1
bg
10
100
1000
0
10000
Concentration (pg/mL)
Figure 10. Analytical assay ranges for total tau, P-tau181P, and A1-42 using ELISA and xMAP
technology. Closed symbol = xMAP (MFI); Open symbol = ELISA (OD). (bg= background value;
MFI = median fluorescence intensity; OD = optical density).
Using CSF as the target sample, there is no direct need to broaden the applied
concentration range for the selected analytes in the currently available assay format, unless
CSF becomes an indicator to determine efficiency of A-lowering drugs or if new treatments
would result in increased levels of some of the analytes.
4.2.2. Analytical Sensitivity
In order to define the analytical sensitivity of the xMAP assay, 8 replicates of a
multiplexed, ready-to-use solution of calibrator peptides were added to the filter plates,
containing mAb-coupled microspheres from one production run. For each calibrator and
analyte, the average median fluorescence intensity (MFI) values, standard deviation (SD),
and % coefficient of variation (CV) were calculated. Concentrations in individual wells were
recalculated using all replicates of the calibrator curve concentrations. Blank samples (bl),
composed of sample diluent, were used to calculate the limit of detection (LOD; Meanbl + 3
SDbl) and the lower limit of quantitation (LLOQ; Meanbl + 10 SDbl). Results for LOD and
LLOQ are shown in Figure 12.
ELISA (OD)
xMAP (MFI)
100
50
10
40
30
20
10
Analyte
Total tau
P-tau181P
Figure 11. Concentration range in CSF for total tau, P-tau181P, and A1-42, as quantified using ELISA
and xMAP technologies. The same samples were used to quantify each analyte using the different assay
formats. Samples were tested on each platform at the same time. More details on the sample population
are described in Engelborghs et al. (2008). The concentration ranges for the healthy controls and
Alzheimer patients (AD) are shown as p(ercentile)25-p75 values. P5 values are shown using dashed
lines.
A1-42
P-tau181P
0
0
Production run
(Qualification runs)
Figure 12. Analytical sensitivity of the xMAP assay. Limit of Detection (LOD) and Lower Limit of
Quantitation (LLOQ) were determined using four different production runs. Open symbols = LOD;
Closed symbols = LLOQ.
101
T-tau
Curve type
25
1
2
3
4
15
1
2
3
4
20
% CV
% CV
20
Curve type
25
10
15
10
5
0
0
5000
10000
15000
P-tau181P
4000
6000
Curve type
25
1
2
3
4
20
% CV
2000
15
10
5
0
0
2000
4000
6000
8000
Figure 13. Effect of the analyte distribution concentration range over the range of measurement on
assay precision. Four different series of calibration curves were generated. The curve fit parameters
were calculated for each type using a four-parametric curve-fitting algorithm. The curve-fit parameters
were used to estimate the variation (%CV) in function of the concentration. (MFI = median
fluorescence intensity).
102
calibrators resulted in a reduction of the %CV for each analyte and/or concentration when
compared with assays performed with single-analyte curves, prepared from concentrated
stock solutions.
For the xMAP assay, precision profiling analysis was done in a set consisting of four
independent experiments, each including replicates (n=8) of a calibrator curve. For each data
point, the concentration was calculated based on the average calibration curve of the plate.
Resulting concentrations of each analyte were used to calculate the total variability (intra-run
precision plus inter-experiment precision) as a function of concentration. Precision profiles,
based on results for one test run on four different bead productions, revealed a %CV lower
than 10% in the CSF range for each analyte (Figure 14B).
1000
Total tau
A1-42
P-tau181P
14A.
% CV
100
10
10
100
1000
10000
Concentration (pg/mL)
20
14B.
% CV
15
10
5
(II
)
ta
u
18
1P
18
1P
(I)
P-
142
42
1-
(I)
Ta
u
Pta (II)
u
(II
)
Ta
u
(I)
Figure 14. Analytical precision of the xMAP assay. A. Intra-run precision, as quantified using four
different production runs of microspheres. B. Precision as determined using six ready-to-use calibrator
series for each analyte, as compared to a calibrators series, prepared for each individual experiment.
Values (I) and (II), shown after each analyte (on the x-axis) represent the results obtained using the
newly prepared series or ready-to-use calibrators, respectively. (Note: only four samples were analyzed
for A1-42).
The intra-assay precision for testing CSF samples, even at low analyte concentrations,
was high. A comparison was done for the intra-assay variability for a number of CSF
samples, using the single-analyte ELISA formats and for the same analyte and samples using
the xMAP technology. The median (interquartile range) intra-assay variability (%CV) was
lower for the xMAP assay than for the corresponding ELISAs: 2.6% (1.2% - 5.1%, n = 513)
103
compared with 3.5% (1.6% - 6.9%) for A1 42 (Wilcoxon matched-pairs test, P < 0.0001),
3.1% (1.4% - 5.8%, n = 462) compared with 4.3% (1.9% - 8.8) for T-tau (P<0.0001), and
2.1% (1.0% - 4.3%, n = 509) compared with 2.3% (0.9% - 4.5%) for P-tau181P (P>0.05).
4.2.4. Analytical Specificity
The specificity of the CSF immunoassays needs to be high, since they are used to
measure the analytes of interest without a prior sample extraction procedure. As already
mentioned, the specificity and selectivity of the product is dependent on the characteristics of
the selected mAbs. Different technology platforms and test concepts were applied during the
development phase for the characterization of the mAbs (Figure 15 shows results using the
xMAP technology). The consistency of mAb specificity was determined on cell culture
medium obtained from the mAb producing hybridoma cell lines, on purified mAbs, or after
coupling of the mAbs to the solid phase. An identical test procedure was applied throughout
development in order to verify the in-process control methods for mAb identification, lot
consistency, immunostability, or impurity evaluations. Besides SELDI-TOF, the specificity
of mAb-coupled beads was further evaluated by (i) incubation of the solid phase with
biotinylated synthetic peptides followed by detection with SV-PE. The detailed protocol for
epitope mapping is described in Olsson et al. (2005).or (ii) by performing a sandwich assay
with synthetic peptides covering the epitopes of both capturing and detector mAb (Figure
16).
40000
region
MFI - 3D6
30000
20000
10000
842
242
142
*1
-1
6
140
139
138
137
Peptide
Figure 15. Analytical specificity of the xMAP assay. The mAb specificity for mAb 3D6 was
determined using beads coupled with different synthetic A peptides. A-coupled beads were incubated
with the biotinylated 3D6 mAb. Afterwards, the amount of bound mAbs was quantified using
incubation with SV-PE. Peptide A1-16 is coupled with its amino-terminus at the coated beads,
resulting in the absence of immunoreactivity for 3D6.
The results show no obvious cross-reactivity between mAbs and peptides not containing
the epitope of the analyte of interest. The specificity of AT270 for P-tau181P was confirmed by
epitope mapping using synthetic peptides phosphorylated at Thr181, Thr175, and Thr181, or
non-phosphorylated. The mAb 4D7A3 is C-terminal specific, recognizing peptides with the
A42 sequence, and showing no reactivity with A40. The 4D7A3-3D6 mAb combination
preferentially detected the full-length A1-42. Limited or no reactivity towards peptides
104
modified at the amino terminus was detected. AT120 recognized peptides containing the
amino acid sequence PPTREPK.
4.2.5. Analytical selectivity
Assay analytical selectivity was determined (i) using samples containing only one of the
three analytes and (ii) by replacement of beads and/or detector mAbs with a non-analytebinding mAb
Tests performed with a sample containing only one of the three calibrators showed
no immunoreactivity towards the other calibrators.
No differences in CSF concentrations for each analyte were obtained when assays
were performed with a mixture of biotinylated mAbs or only one of the two
biotinylated detector mAbs (3D6, HT7), currently included in the assay format
(Figure 16A).
No immunoreactivity was measured in a number of CSF samples when the 3D6/HT7
mAb combination was replaced with a non-relevant biotinylated mAb (Figure 16B).
The replacement of mAb-coupled beads with control mAbs resulted in background
values for CSF samples.
T-tau
P-tau181P
A1-42
Concentration (pg/mL)
1000
100
10
3
M
4
S
5
M
S6
CSF samples
Figure 16. Analytical selectivity of the xMAP assay. A. Experiments were performed using biotinylated
detector mAbs, containing HT7 or 3D6 (S), or a combination of HT7 and 3D6 (M). The effects of the
different conjugates on analyte concentrations in CSF were determined. B. The concentration of the
analytes in three CSF samples was determined using an assay format in which the biotinylated mAbs
were replaced with a control mAb not recognizing tau,or A, or buffer. (Note: bio-Mabs = biotinylated
mAbs).
In the current multi-analyte assay format, interference caused by the presence of autoantibodies against A or tau cannot be ruled out. The presence of A auto-antibodies in
105
samples from healthy individuals or diseased persons has been documented (Henkel et al.
2007). More investigation is required to determine whether it is necessary to verify their
presence within each sample and their impact on the outcome of the tests.
4.2.6. Analytical Accuracy
The accuracy for detection of the AD biomarkers is difficult to investigate since no
reference material (gold standard) is currently available. Proteins from different sources can
vary in their immunoreactivity due to the production and/or purification processes. In
addition, the reference material may not be truly representative of the native protein due to
differences in post-translational modifications (e.g., phosphorylation, dimerization,
glycosylation, deamidation, isomerization). To our knowledge, no standard has been
deposited with any organization, such as the World Health Organization (WHO) or United
States Pharmacopoeia (USP), thus hampering the comparison between commercially
available assays.
For A, data have been published indicating the possibility of defining absolute levels of
A proteins using liquid chromatography-tandem mass spectrometry (LC-MS/MS). The
accuracy and precision of the LC-MS assay means that it will be a useful complement to
existing ELISA assays for monitoring therapeutic interventions designed to modulate CSF
A1-42 concentrations in individual AD patients. Moreover, the introduction of stable isotopelabeled internal standards offers the potential to achieve a more rigorous account of the
influence of methodological effects related to sample collection and processing (Oe et al.
2006).
A
A1-42
1-42
150 -
100 100
125
150
175
Predicted (pg/mL)
200
55 -
30 40
150 -
1
2
3
4
100 50 50
100
150
Predicted (pg/mL)
200
P-tau181P
P-tau
181P
80 Measured (pg/mL)
T-tau
tau
200 -
1
2
3
4
Measured (pg/mL)
Measured (pg/mL)
200 -
1
2
3
4
50
60
70
Predicted (pg/mL)
80
Figure 17. Analytical linearity of the xMAP assay. Different sets of CSF samples, containing high and
low concentrations of each analyte, were combined in different ratios. The concentrations in the
unmixed samples were used to determine the predicted concentrations. Results for predicted, versus
calculated concentrations for each analyte are shown. Values 1-4 represent the results of four different
experiments.
106
107
Figure 18. Effect of CSF sample processing on analyte concentrations. A. Effect of centrifugation. B.
Effect of the number of freeze-thaw cycles. C. Short-term stability. D. Long-term stability. More details
on the experimental protocol are described in section 4.3.
108
109
Disease
Autopsy-based diagnosis
AD
AD, DLB
65 AD
1
AD,DLBvariant
MXD
MXD-DLB
CJD
1 NON-AD
CJD(Heidenhain variant)
DLB
FTD
PDD
SCA
VAD
12
N
73
27
(AD = Alzheimers disease; CJD = Creutzfeldt-Jakob disease; DLB = dementia with Lewy bodies; FTD
= frontotemporal lobe dementia; MXD = mixed dementia; PDD = Parkinsons disease with dementia;
SCA = spinocerebellar ataxia; VAD = vascular dementia).
Table 3. Number and percentage (in parentheses) of females and males per disease
category
GENDER
FEMALE
MALE
AD
37 (50.1)
36 (49.9)
NON-AD
10 (37.0)
17 (63.0)
48 (48.0)
52 (52)
110
AD
C
NON-AD
0.00
-0.25
-0.50
-0.75
-1.00
1.5
2.0
2.5
3.0
Total tau
0.25
have been (accidentally) swapped during re-labeling and were excluded from the analysis.
One sample contained serum instead of CSF. After quantification, at least one biomarker
concentration was out of range for 14 subjects. These data were excluded from the analysis.
A1-42
0.4
AD
C
NON-AD
0.0
-0.4
-0.8
1.5
2.0
2.5
3.0
P-tau181P
0.4
AD
C
NON-AD
0.0
-0.4
-0.8
0.5
1.0
1.5
2.0
2.5
Figure 19. Comparison of quantification in CSF of total tau, P-tau181P, and A1-42 using ELISA and
xMAP technology. More details on the procedure used to compare results are described in Olsson et al.
2005. The patient population for the study is described in Engelborghs et al. (2008). (AD = Alzheimers
disease; C = healthy controls; NON-AD = non-Alzheimers Disease).
The concentrations for each analyte obtained with the xMAP assay correlated quite well
with those obtained with the single ELISA tests (Spearman correlation coefficients (r) of
0.83, 0.84, and 0.91 for T-tau, A1-42, and P-tau181P, respectively). This is in line with
previously published findings (Lewczuk et al. 2008; Reijn et al 2007).
Notwithstanding the good correlation, concentrations in CSF samples differed in absolute
values between the two assay formats (Figure 19). This could be related to differences in the
mAb combinations, assay format, assay test conditions (time, temperature), and to the fact
that the calibrator series, provided in the assay, was not provided in a CSF-like matrix.
Given the analytical differences for the concentrations measured, it is of key importance to
investigate the clinical relevance of the xMAP measurements.
400
111
Total tau
A1-42
Concentration (pg/mL)
Concentration (pg/mL)
1000
300
200
100
750
500
250
AD-F
AD-F
AD-M
C-F
C-M
AD-M
C-F
C-M
NONAD-F NONAD-M
NONAD-F NONAD-M
SUBJECT GROUP
SUBJECT GROUP
Concentration (pg/mL)
200
P-tau 181P
150
100
50
0
AD-F
AD-M
C-F
C-M
NONAD-F NONAD-M
SUBJECT GROUP
Figure 20. Biomarker concentration in function of diagnostic group and gender. (AD = Alzheimers
disease; C = healthy controls; F=female; M=male; NON-AD = non-Alzheimers disease).
A1-42
Total tau
Concentration (pg/mL)
Concentration (pg/mL)
400
AD
C
NON-AD
1200
800
400
AD
C
NON-AD
300
200
100
0
0
0
25
50
75
Age (years)
25
50
75
100
Age (years)
P-tau181P
AD
C
NON-AD
250
Concentration (pg/mL)
100
200
150
100
50
0
0
25
50
75
100
Age (years)
Figure 21. Biomarker concentrations in function of age and diagnostic groups. The relation of each
biomarker to age was not dependent on the disease category: the change in biomarker concentration per
year of age was similar in AD, NON-AD, and healthy controls. (AD = Alzheimers disease; C =
healthy controls; NON-AD = non-Alzheimers disease).
112
113
Table 4. Logistic regression models selected after backward elimination of nonsignificant predictor variables
Modelling results for different comparisons between diagnostic groups are shown in
Table 4. Using the multi-analyte assay to determine the concentration of the three biomarkers
in CSF, an optimal discrimination between control and demented patients could be obtained
using an algorithm obtained with A1-42 and T-tau, while for differential diagnosis between
AD and NON-AD, best separation was obtained with a combination of P-tau181P and A1-42.
The performance of these models is quantified in terms of the area under the curve (AUC) in
receiver operating characteristic (ROC) analysis. Independent of the clinical classification
and platform, the logistic regression model using a combination of biomarkers showed better
diagnostic performance than single-analyte analysis (Table 5).
Table 5. Comparison of classification performance based on combined biomarker
information versus classification using single biomarker information
Classification is expressed in area under the curve with 95% confidence intervals.
Upper table Healthy controls: n=98; Dementia: n=84. Lower table AD: n=64; NON-AD: n=20.
(AD = Alzheimers disease; AUC = area under the curve; Ln = natural log; NON-AD
= non-Alzheimers disease).
114
No significant differences in the AUC were observed for each individual biomarker when
results of ELISA or multi-analyte assays were compared for different paradigms (e.g., AD
versus NON-AD, healthy controls versus dementia) (Table 6).
Table 6. Comparison of individual biomarker classification performance in terms of
area under the curve between test results obtained with xMAP and ELISA
Classification is expressed in area under the curve with 95% confidence intervals.
Upper table Healthy control: n=98; Dementia: n=84.
Lower table AD: n=64; NON-AD: n=20.
(AD = Alzheimers disease, NON-AD = non-Alzheimers disease).
Healthy controls (n=96) versus dementia (n=66)
ELISA
xMAP
100
100
80
Sensitivity
Sensitivity
80
60
40
60
40
20
20
P = 0.239
0
0
20
40
60
100-Specificity
80
100
P = 0.343
0
0
20
40
60
80
100
100-Specificity
Figure 22. Comparison of model building using ELISA and xMAP technology in function of the
clinical classification. Classification is expressed in area under the curve with 95% confidence intervals.
The numbers of subjects in each group are shown at the top of each figure. (AD = Alzheimers disease;
C = healthy controls; NON-AD = non-Alzheimers disease).
115
No differences in AUC were observed between regression models based on the platform,
independent of the clinical classification (Figure 22).
Notwithstanding the differences in measured concentrations for each analyte, the results
clearly show that a comparable clinical performance can be obtained when T-tau, A1-42, and
P-tau181P are analyzed in CSF using a multiplexed format or single-analyte tests.
116
are cognitively normal. A negative predictive value of 100% indicates that the test
completely rules out the possibility that the individual has the disease when the test is
performed.
Table 7. Diagnostic performance of laboratory tests for AD
Sensitivity
Specificity
Prior probability
To address these and other compelling needs required for the timely development of AD
biomarkers for diagnosis, clinical trials, and other uses, the Alzheimers Disease
Neuroimaging Initiative (ADNI) was launched by the National Institutes of Health (NIH) in
October, 2004 by a public/private consortium of stakeholders to define and validate
informative neuroimaging and chemical biomarkers of AD and to identify the transition from
MCI to early AD (Shaw et al. 2007). Briefly, the goals of ADNI are to: (1) Develop
standardized neuroimaging and (bio-) chemical biomarker methods for AD clinical trials; (2)
Determine optimum methods for acquiring and processing brain images; (3) Validate AD
neuroimaging and (bio-)chemical biomarker findings by correlating them with
neuropsychological and behavioral test data from the ADNI cohorts; (4) Provide a database
for all ADNI findings that will be available to qualified scientific investigators for further
data mining (Mueller et al. 2005).
Thus, beginning in 2004, ADNI began enrolling a total of 200 cognitively normal elderly
controls, 200 AD patients, and 400 subjects with MCI (for a 3-year observational study at
~60 clinical sites throughout the United States and Canada). All subjects undergo periodic
neuroimaging studies, blood and urine samples are collected from all subjects, while CSF is
obtained from ~50% of individuals at baseline and one year thereafter, so that longitudinal
studies of chemical AD biomarkers can be conducted over a 1- to 3-year observation period.
Data from periodic clinical evaluations are correlated with neuroimaging and chemical
biomarker findings as well as with neuropsychological and behavioral data. To accelerate
achieving these goals, all data collected from ADNI subjects are publicly accessible.
The ADNI Biomarker Core was established at the University of Pennsylvania and it is
led by Drs. Leslie M. Shaw and John Q. Trojanowski. This Biomarker Core developed all of
the standard operating procedures for sample collection and shipping, and the Core continues
117
to bank all biological samples (blood, urine, CSF) from all participating sites, and conducts
studies of selected AD biomarkers including ApoE genotype, isoprostanes, tau (total tau,
phosphorylated tau), A, and homocysteine. While these analytes were selected for study in
the Penn Biomarker Core based on a consensus of AD biomarker experts (Frank et al. 2003),
this Core also will make banked ADNI biosamples available for studies of additional
biomarkers by other investigators according to procedures outlined on the ADNI Web site
(http://www.adni-info.org/index.php). Prior to the conduct of biomarker studies of CSF, the
study methodologies are validated by ADNI.
One such study was designed to evaluate the analytical performance of a quantitative
multi-analyte immunoassay across 7 centers in the United States and Europe using the xMAP
platform and INNO-BIA AlzBio3 reagents. The reproducibility of the results for the
following sample specimens were incorporated into the study design: 1) calibration
specimens, 2) quality control samples, 3) pools of CSF from routine clinical investigations.
Notably, this is the platform and reagents that the ADNI Biomarker Core planned to use for
these measurements in ADNI CSF samples, and it therefore was expected that this
multicenter study would provide a study-based definition of the analytical criteria governing
the analyses performed in the ADNI Biomarker Core. Based on experience with other method
transfer studies, it was also deemed essential to conduct a qualification exercise that included
full documentation of important platform and assay details as the first stage. Completion of
this qualification exercise was a requirement for participation in the formal analyses of the
CSF pools. Further, beyond the transferability of a multiplexed quantitative immunoassay
among experienced laboratories, there were other important questions to be addressed
including comparison of this platform and immunoassay method with expert laboratory
ELISAs currently in use for measuring CSF tau and A.
The qualifying exercise was completed successfully by all 7 sites and this was rapidly
followed by the implementation of the full validation study. While the data from these studies
are currently being analyzed and prepared for publication, the results were promising enough
to launch formal studies of ADNI CSF samples using the same xMAP platform and INNOBIA AlzBio3 reagents by early 2008.
Thus, even at this early stage in the ADNI Biomarker Core studies, we are sufficiently
encouraged by these initial studies to believe that the unique public/private commitment to
implement ADNI will culminate in important public health benefits as a result of efforts to
validate informative AD biomarkers and to translate these laboratory studies into widely
accessible biomarker assays so they can be used to accelerate the pace of AD drug discovery.
ACKNOWLEDGEMENTS
We thank our colleagues for their contributions to the work summarized here. In the
U.S., this work was supported by grants from the NIH (P01 AG09215, P30 AG10124, P01
AG11542, P01 AG14382, P01 AG14449, P01 AG17586, PO1 AG19724, P01 NS-044233,
UO1 AG24904), and the Marian S. Ware Alzheimer Program. We are especially indebted to
our patients and their families whose commitment to research has made our work possible.
This research was also supported by the Special Research Fund of the University of Antwerp,
118
the Institute Born-Bunge, the central Biobank facility of the Institute Born-Bunge
University of Antwerp, the agreement between the Institute Born-Bunge and the University
of Antwerp, International Alzheimer Research Foundation (Stichting voor Alzheimer
Onderzoek), Medical Research Foundation Antwerp, Neurosearch Antwerp, the Thomas
Riellaerts Research Fund, the Research Foundation - Flanders (FWOF; grant no G.0127.07),
the Institute for Promotion of Innovation through Science and Technology in Flanders (IWTVlaanderen) and the Interuniversity Attraction Poles program P6/43 of the Belgian Science
Policy Office. S.E. is a postdoctoral fellow of the FWO-F. The authors acknowledge the
expert assistance of Eugeen Vanmechelen, the technical assistance of L. Demeyer, S. Van
Remoortere, M. Blser, N. Le Bastard, G. Vandevijver, F. Franck and T. Aerts, the
administrative assistance of S. Hicketick and W. Wittebolle and the clinical staff involved,
and the expert editorial assistance of A. Farmer.
REFERENCES
Andreasen N, Hesse C, Davidsson P, Minthon L, Wallin A, Winblad B, Vanderstichele H,
Vanmechelen E, Blennow K. Cerebrospinal fluid -amyloid (1-42) in Alzheimer disease:
differences between early-and late-onset Alzheimer disease and stability during the
course of disease. Arch Neurology. 1999; 56:673-680.
Ballatore C, Lee VM, Trojanowski JQ. Tau-mediated neurodegeneration in Alzheimer's
disease and related disorders. Nat Rev Neurosci. 2007; 8:663-672.
Biomarkers Definitions Working Group. Biomarkers and surrogate endpoints: preferred
definitions and conceptual framework. Clin Pharm Ther. 2001;69:89-95.
Blennow K, Wallin A, Agren H, Spenger C, Siegfried J, Vanmechelen E Tau protein in
cerebrospinal fluid: a biochemical marker for axonal degeneration in Alzheimers
disease? Mol Chem Neuropathol. 1995;26:231-245.
Blennow K, de Leon MJ, Zetterberg H. Alzheimer's disease. Lancet. 2006;368:387-403.
Clark CM, Davatzikos C, Borthakur A, Newberg A, Leight S, Lee VM-Y, Trojanowski JQ
Neurosignals. 2008;16:11-18.
Consensus report: Ronald & Nancy Reagan Institute of the Alzheimers Association &
National Institute on Aging Working Group on Biological Markers of Alzheimers
Disease Disease. Consensus report of the Working Group on Biological Markers of
Alzheimers Disease. Neurobiol Aging. 1998;19:109-116.
De Meyer G, Shapiro F. Biomarker development: The road to clinical utility. Curr Drug
Discov. 2003;May:23-27.
Eckman EA and Eckman CB. Abeta-degrading enzymes: modulators of Alzheimer's disease
pathogenesis and targets for therapeutic intervention. Biochem Soc Trans. 2005;
33:1101-1105.
Engelborghs S, De Vreese K, Van de Casteele T, Vanderstichele H, Van Everbroeck B, Cras
P, Martin J-J, Vanmechelen E, De Deyn PP. Diagnostic performance of a CSF-biomarker
panel in autopsy-confirmed dementia. Neurobiol Aging. 2008;29:1143-1159.
Finehout EJ, Franck Z, Choe LH, Relkin N, Lee KH. Cerebrospinal fluid proteomic
biomarkers for Alzheimers disease. Ann Neurol. 2007;61:120-129.
119
Frank RA, Galasko D, Hampel H, Hardy J, de Leon MJ, Mehta, PD, Rogers J, Siemers E,
Trojanowski JQ. Biological markers for therapeutic trials in Alzheimers disease.
Proceedings of the biological measures working group: NIA Initiative on Neuroimaging
in Alzheimers Disease. Neurobiol Aging. 2003;24:521-536.
Gordon RF, McDade RL. Multiplexed quantification of human IgG, IgA, and IgM with the
FlowMetrix system. Clin Chem. 1997;43:1799-1801.
Guidance for Industry. Bioanalytical Method Validation. U.S. Department of Health and
Human Services Food and Drug Administration, Center for Drug Evaluation and
Research (CDER), Center for Veterinary Medicine (CVM). May 2001.
Hampel H, Brger K, Teipel SJ, Bokde ALW, Zetterberg H, Blennow K. Core candidate
neurochemical and imaging biomarkers of Alzheimers disease. Alzheimers Dement.
2008;4:38-48.
Hansson O, Zetterberg H, Buchhave P, Londos E, Blennow K, Minthon L. Association
between CSF biomarkers and incipient Alzheimers disease in patients with mild
cognitive impairment: a follow-up study. Lancet Neurol. 2006;5:228-234.
Henkel AW, Dittrich PS, Groemer TW, Lemke EA, Klingauf J, Klafki HW, Lewczuk P,
Esselman H, Schwille P, Kornhuber J, Wiltfang J. Immune complexes of auto-antibodies
against A1-42 peptides patrol cerebrospinal fluid of non-Alzheimer's patients. Mol
Psychiatry. 2007;12:601-610.
Hulstaert F, Blennow K, Ivanoiu A, Schoonderwaldt HC, Riemenschneider M, De Deyn PP,
Bancher C, Cras P, Wiltfang J, Mehta PD, Iqbal K, Pottel H, Vanmechelen
E,Vanderstichele H. Improved discrimination of AD patients using -amyloid(1-42) and
tau levels in CSF. Neurology. 1999;52:1555-1562.
Ilyin SE, Belkowski SM, Plata-Salamn CR. Biomarker discovery and validation:
technologies and integrative approaches. Trends Biotechnol. 2004;22:411-416.
Knopman DS, DeKosky ST, Cummings JL, Chui H, Corey-Bloom J, Relkin N, Small GW,
Miller B, Stevens JC. Practice parameter: diagnosis of dementia (an evidence-based
review). Report of the Quality Standards Subcommittee of the American Academy of
Neurology. Neurology. 2001,56:1143-1153.
Lee JW, Devanarayan V, Barrett YC, Weiner R, Allinson J, Fountain S, Keller S, Weinryb I,
Green Mn Duan L, Rogers JA, Millham R, OBrien PJ, Sailstad J, Khan M, Ray C,
Wagner JA. Fit-for-purpose method development and validation for successful biomarker
measurement. Pharm Res. 2006;23:312-328.
Lewczuk P, Beck G, Esselmann H, Bruckmoser R, Zimmermann R, Fiszer M, Bibl M, Maler
JM, Kornhuber J, Wiltfang J. Effect of sample collection tubes on cerebrospinal fluid
concentrations of tau proteins and amyloid beta peptides. Clin Chem. 2006;52:332-334.
Lewczuk P, Kornhuber J, Vanderstichele H, Vanmechelen E, Esselmann H, Bibl M, Wolf S,
Otto M, Reulbach U, Klsch H, Jessen F, Schrder J, Schnknecht P, Hampel H, Peters
O, Weimer E, Perneczky R, Jahn H, Luckhaus C, Lamla U, Supprian T, Maler JM,
Wiltfang J. Multiplexed quantification of dementia biomarkers in the CSF of patients
with early dementias and MCI: A multicenter Study. Neurobiol Aging. 2008; 29:812-818.
Epub 2007 Jan 19.
120
Mueller SG, Weiner MW, Thal LJ, Petersen RC, Jack CR, Jagust W, Trojanowski JQ, Toga
AW, Beckett L. Ways toward an early diagnosis in Alzheimer's disease: The Alzheimer's
Disease Neuroimaging Initiative (ADNI). Alzheimers Dement. 2005; 1:55-66.
Oe T, Ackermann BL, Inoue K, Berna MJ, Garner CO, Gelfanova V, Dean RA, Siemers ER,
Hotzman DM, Farlow MR, Blair IA. Quantitative analysis of amyloid peptides in
cerebrospinal fluid of Alzheimer's disease patients by immunoaffinity purification and
stable isotope dilution liquid chromatography-negative electrospray ionization/tandem
mass spectrometry. Rapid Commun Mass Spectrom. 2006;20:3723-3735.
Oliver KG, Kettman JR, Fulton RJ. Multiplexed analysis of human cytokines by use of the
FlowMetrix system. Clin Chem. 1998;44:2057-2060.
Olsson A, Vanderstichele H, Andreasen N, De Meyer G, Wallin A, Holmberg B, Rosengren
L, Vanmechelen E, Blennow K. Simultaneous measurement of A(1-42), total tau, and
phosphorylated tau (Thr181) in cerebrospinal fluid by the xMAP Technology. Clin Chem.
2005;51:336-345.
Pepe MS. The statistical evaluation of medical test for classification and prediction (2003).
Oxford University Press, Oxford UK, pp 214-217.
Rai AJ. Biomarkers in translational research: focus on discovery, development and
translation of protein biomarkers to clinical immunoassays. Expert Rev Mol Diagn. 2007;
7:545-553.
Reijn TSM, Rikkert MO, van Geel WJA, de Jong DD, Verbeek MM. Diagnostic accuracy of
ELISA and xMAP technology for analysis of amyloid 42 and tau proteins. Clin Chem.
2007;53:859-865.
Shaw LM, Korecka M, Clark CM, Lee VM-Y, Trojanowski JQ. Biomarkers of
neurodegenertaion for diagnosis and monitoring therapeutics. Nat Rev Drug Discovery.
2007;6:295-303.
Solomon PR, Murphy CA. Should we screen for Alzheimers disease? A review of the
evidence for and against screening for Alzheimers disease in primary care practice.
Geriatrics. 2005;60:26-31.
Steinerman JR, Honig LS. Laboratory biomarkers in Alzheimers disease. Cur Neurol
Neurosci Rep. 2007;7:381-387.
Sunderland T, Linker G, Mirza N, Putnam KT, Friedman DL, Kimmel LH, Bergeson J,
Manetti GJ, Zimmermann M, Tang B, Bartko JJ, Cohen RM..Decreased beta-amyloid142 and increased tau levels in cerebrospinal fluid of patients with Alzheimer disease.
JAMA. 2003;289:2094-103.
Vandermeeren M, Mercken M, Vanmechelen E, Six J, Van de Voorde A, Martin J-J, Cras P.
Detection of proteins in normal and Alzheimers disease cerebrospinal fluid with a
sensitive sandwich enzyme-linked immunosorbent assay. J Neurochem. 1993;61:18281834.
Vanderstichele H, Van Kerschaver E, Hesse C, Davidsson P, Buyse M-A, Andreasen N,
Minthon L, Wallin A, Blennow K, Vanmechelen E. Standardization of measurement of
-amyloid(1-42) in cerebrospinal fluid and plasma. Amyloid: Int J Exp Clin Invest. 2000;
7: 245-258.
Vanderstichele H, Demeyer L, De Roo K, Van Remoortere S, Mortier V, Olsson A,
Vandecasteele L, Kostanjevecki V, Blennow K, Vanmechelen E. Standardized
121
Chapter VI
ABSTRACT
The diagnostic criteria for Alzheimers disease are currently under revision. The
proposed new diagnostic criteria include cerebrospinal fluid (CSF) protein biomarkers as
a core supportive diagnostic feature. This chapter reviews the role of the CSF analysis in
dementia diagnosis. Firstly, the CSF composition, its physiological barriers, anatomical
constraints and sampling are discussed. Secondly, there is an overview on biomarkers in
general, followed by a detailed review of selected CSF biomarkers (tau, amyloid beta,
neurofilaments, neuronspecific enolase). The chapter concludes by recapitulating the
relevance of these new CSF protein biomarkers to the laboratorysupported differential
diagnosis of dementia, the improvement of prognostic accuracy, the provision of a
surrogate for cognitive decline and their value as a secondary outcome measure for future
treatment trials.
1. INTRODUCTION
The early diagnosis of Alzheimers disease (AD) is important as new treatments are
increasingly becoming available. These diseasemodifying treatment strategies intervene in a
neurobiological cascade ultimately leading to amyloid deposition, hyperphosphorylated tau
and neurodegeneration. Thus early intervention, ideally in the prodromal phase of AD is
likely to be most effective [1]. In a recently proposed revision of the diagnostic criteria the
cerebrospinal fluid (CSF) analysis has moved from being an exclusion criterion for other
forms of dementia to being one of the core supportive diagnostic features [2]. This is because
124
Axel Petzold
the development of the CSF analysis over the past thirty years focused on protein biomarkers
which can help detecting early and subclinical forms of neurodegeneration [3,4].
Thus the reason for performing a CSF analysis in dementia is twofold: firstly, to
exclude any other nondementing disease and secondly, to aid with the differential diagnosis
within the spectrum of neurodegenerative dementias. In addition there are three more areas
where the CSF analysis in dementia may help in the future:
1. improving prognostic accuracy. This is of relevance for predicting which of those
patients with minimal cognitive impairment will eventually develop AD [2]
2. as a source for surrogate markers for cognitive deficit
3. as a secondary outcome measure in treatment trials
In order to discuss these points this chapter is structured in three parts. Firstly, the scene
is set by reviewing the very basics of the CSF composition, the blood brain barrier, the
anatomical constraints of the CSF spaces and the performance of the lumbar puncture.
In the second part biomarkers are introduced. The core biomarkers for the CSF analysis
in dementia are discussed in detail. For more indepth discussion the interested reader is
directed to the chapter on CSF markers in mild cognitive deficit by Venturelli et al; as well as
the important methodological and analytical aspects of biomarker research discussed by
Vanderstichele et al.
2. CEREBROSPINAL FLUID
The normal cerebrospinal fluid (CSF) is clear and colorless and 70% the CSF water
content originates from the choroid plexus [5,6]. Water1 is filtered through the choroid plexus
at a filtration rate of up to 40 mL per hour during night [7]. About 30% of the CSF water is
derived from the meninges and the bloodnerve barrier at level of the nerve roots and
importantly also from the ECF of the brain parenchyma. The CSF flow rate varies from the
ventricles to the lumbar sac. The CSF flow rate is an important variable which modifies the
CSF composition by influencing the diffusion rate of proteins from the plasma into the CSF
[8]. Plasma proteins diffuse through the bloodnerve barrier along the length of the spinal
cord. Therefore the lumbar CSF has the highest concentration plasma derived proteins.
Strictly speaking the CSF represents and ultrafiltrate rather then water.
125
Similarly a defective blood brain barrier allows serum proteins to leak into the CSF. In order
to understand this relationship the blood brain barrier will be briefly discussed.
2.2. Blood Brain Barrier
The human blood brain barrier (BBB) is a filter which prevents unselective diffusion of
substances into the brain parenchyma (Figure 1A). Because small changes in the
protein/lipid/ion content or pH of the extracellular fluid (ECF) instantly interferes with
neuronal function it is important to maintain brain homoestasis. Protection of the brain
homoestasis is a crucial role of the BBB and helps in securing the reliable function of
millions of neurons in the human brain. Strictly speaking one should distinguish the BBB
from the bloodCSF barrier (BCB) which is a sieve (Figure 1A) that permits small substances
to diffuse from the blood into the CSF [10].
Figure 1. (A) A simplified diagram of the tight bloodbrain barrier (BBB) which separates the blood
from the extracellular fluid (ECF) of the brain parenchyma. The very tight cell membrane prevents
proteins from the cytosol diffusing into the ECF. The less tight bloodCSF barrier (BCB) allows
substances to diffuse from the blood into the CSF. (B) Breakdown of the bloodCSF barrier results in
leakage of albumin from the blood into the CSF. (C) Cellular death following brain damage leads to
disintegration of the cellular membrane. Biomarkers leak from the cytoplasm into the adjacent ECF.
From the ECF these biomarkers then equilibrate with the CSF. (Figure adapted with permission from
reference [11]).
The gold standard for assessment of the BBB/BCB function is the measurement of
albumin in the CSF and serum [12]. Albumin is produced by the liver and therefore all
albumin measured in the CSF has diffused from the blood through the meninges into the CSF
[13]. If the BBB/BCB is intact it will only allow a small amount of albumin into the CSF
(normal range 144336 mg/L). The normal CSF to serum albumin quotient is smaller than
0.0074 [12]. If the BCB barrier breaks down, serum albumin leaks into the CSF (Figure 1B),
the CSF albumin rises and the CSF to serum albumin quotient increases.
In neurodegenerative dementias neuronal death results in disintegration of the cellular
membrane of neurons (see video on the compact disc provided in the cover of this book).
Subsequently protein biomarkers leak from the cytoplasm into the extracellular fluid (ECF,
Figure 1C) from where they equilibrate with the CSF.
126
Axel Petzold
Figure 2. Schematic view of the CSF spaces (blue) and their main flow direction (red arrows) in relation
to the brain (yellow) (A) shows the coronal plane and (B) the saggital plane; (c) a 3D MRI
reconstruction overlaying the coronal view, showing the lateral ventricles in red and the fine mesh of
the CSF through the brain parenchyma in blue (the 3D reconstruction is by courtesy of Nick Fox and
Richard Boyes).
The majority of the CSF flows from the choroid plexi2 through the lateral, 3rd and 4th
ventricles down into the lumbar sac from where it can be sampled by a lumbar puncture as
described below. Importantly, not all the CSF reaches the lumbar sac. This may be important
for CSF analysis in dementia because most of the CSF passing the gyri of the hemispheres
where degenerating neurons are located is absorbed by the arachnoid villi. In contrast the
lumbar CSF reflects proteins released by the following brain structures:
2
The choroid plexi are located posterior in the lateral ventricles, the 3rd and 4th ventricles.
127
Most right handed physicians prefer the left lateral recumbent position.
If it is difficult to feel the spinal processes, e.g. in an adipose patient than a horizontal line between the posterior
fossae iliacae helps approximately identifying the L5/L5 level. I do this by placing the tip of my index finger on
the top of the ilium and reaching with the thumb to the midline.
if it is not with water resistant ink then this is best done outside the area which will be cleaned for the procedure.
Axel Petzold
128
insertion sometimes more painful. Additionally the injection of local anesthetic initially
stretches the skin where all the cutaneous pain receptors are located which again is painful
until the anesthetic takes effect. And then there are of course the rare but potentially serious
side effects of local anesthetics from wound infection to allergic reactions. If it looks like an
easy procedure and the patient has no objections I will use the recommended atraumatic 22
gauge Sprotte needle (this is a pencilpoint needle) [17] straight away without local
anesthesia. Being a right handed person I now place my left thumb firmly over the superior
aspect of the L5 spinous process with the back of the thumb so that it is in continuation with
the angle of the spinous process (dependent on the patient in the range of about 30-60).
With the right hand I than take the Sprotte needle and place it exactly in midline over the
skin, leaning against my left thumb. Because one generally looks from above to the insertion
point there is a risk of diverging from the strict horizontal (saggital) plane, I therefore lower
my head so that my eyes are at the same height as the needle. The needle is then quickly
pushed through the stretched skin6 and firmly guided by the angle formed with the thumb
towards the lumbar CSF space. Usually the needle advances quite smoothly7 until it reaches
the tough structure of the ligamentum flavum8 and dura mater. This requires careful and slow
stronger pushing forward and will shortly be followed by a give where the needle advances
almost without resistance.
Stop here; you are now in the subarachnoid space. Advance very slowly and remove the
stylet approximately every 2 mm until the CSF flows freely through the now hollow needle.
If the CSF only dribbles, the Sprotte needle may be advanced a bit further or the patient could
be asked to give a cough or increase his abdominal pressure without otherwise moving. The
CSF flow is usually good using a 22 gauge or larger needle and very slow if a smaller needle9
is used. If required the opening pressure should be measured now. The normal range of the
CSF opening pressure in the lateral recumbent position is 100-180 mm H2O which equals 814 mm Hg. A H2O pressure greater than 200 mm is pathological.
The CSF samples are collected into three consecutive polypropylene tubes. The last tube
should used for analysis of protein biomarkers. They should be spun down at 2000 g, for 10
minutes at room temperature. The CSF should then be aliquotted into several 1-2 mL
polypropylene tubes and stored within 12 hours at -80C until further analysis at a later time
or to be sent to laboratories specialised in the analysis of dementia biomarkers.
The main complications are:
8
9
In patients with very thick or hard skin which is difficult to pierce with the atraumatic Sprotte needle I tend to
use a larger caliber needle used for venepuncture for piercing the skin and then advance the Sprotte needle
through the other needle.
The anatomical structures past by the needle are: the skin, subcutaneous tissue, supraspinous ligament,
interspinous ligament, ligamentum flavum, epidural space where the internal vetrebral venous plexus that so
often gives rise to a traumatic tap is located, the dura mater and finally the subarachnoid space. If the needle hits
the periosteum of the bone, this hurts the patient and this cannot be prevented by local anesthetic. Move the
needle back and change the angle at which you re-advance.
The ligamentum flavum is a strong yellow elastic ligament which can be up to 1 cm thick in the lumbar region.
For needles <22G it may take >6 minutes to collect 2 mL of CSF.
129
traumatic or large caliber needle, forgetting to reinsert the stylet before drawing the
needle back and repeated attempts to perform the procedure. If the needle size is
between 16 and 19 G the headache frequency is up to 70%, decreasing to 12% for a
needle size between 20-22 G [19]. The typically bilateral headaches start between 1
7 days following the LP and last between one day to two weeks. A common
characteristic of the headaches is that they worsen within 15 minutes in the upright
position and improve within 30 minutes after laying down. Recovery usually occurs
on itself over a few days if the patients lie down. Only very rarely will an epidural
blood patch be needed for treatment and surgical closure is the last resort [19]. A
immediate onset headache is most unusual and a warning sign because it may be
caused by an increase of the intracranial pressure.
A traumatic tap is a frequent and mostly unavoidable event. The first documented
traumatic tap occurred on the 23rd of July 1891 whilst performing the fourth
consecutive lumbar puncture (LP) in a 7 year old girl with hydrocephalus [14]. A
traumatic tap is a minor complication, possibly by puncture of the venous plexus
within the spinal sac or vessels adjacent to the cauda equina [20]. A traumatic tap
can be expected in about 1420% of all standard LPs [20-23]. There is no consensus
about the precise definition of a traumatic tap. Most laboratories accept a cutoff
around 400 x 106 erythrocytes/L [20,23]. If this limit is lowered to 100 cells (per L,
or x 106/L) in the sample then about 72% of all LPs would be classified as traumatic
[21]. Following a traumatic tap the CSF sample is contaminated with erythrocytes.
No CSF or a dry tap is most frequently due to wrong placement of the needle, e.g.
close on to bony structures. Only very rarely is there no CSF in the region either
because of a previous injury, surgery or arachnoiditis. No CSF, but another fluid can
be collected if there was a cyst in the lumbar region which had been accidentally
punctured. Imaging of the lumbar spine will be informative.
Any herniation of any brain structure is a rare but serious complication with an
associated high mortality. A LP is contraindicated in patients with clinical signs for
preexisting tentorial herniation. If in doubt brain imaging should be arranged prior
to performing the LP.
An intraspinal epidermoid tumor is a rare complication following the accidental
implantation of skin tissue into the subarachnoid space [24]. The risk is negligible if
the needle is used with the stylet being inserted whilst advancing.
A retroperitoneal abscess is exceedingly rare if a proper aseptic technique is used
and leakage of infected CSF into the retroperitoneal space is avoided.
Extension of a syrinx is to the best of my knowledge a possible but not reported
compilation. I know of one case where presumably the pressure gradient between a
large syrinx in the lumbar region and the subarachnoid space caused extension of the
syrinx during the LP. The patient lost his ability to walk.
Axel Petzold
130
2.5. Occipital Tap
This procedure is not recommended anymore and only performed under exceptional
circumstances. Similar to the lumbar puncture the occipital tap is contraindicated if there is
a risk for coning (in these situations an extraventricular drain is required).
Firstly the hair in the neck is shaved and the area cleaned. The procedure is strictly
sterile. The patient can either lie down or sit, which makes the procedure easier to perform.
An assistant holds the patients head in flexion. The needle is inserted in midline above the 1st
spinous process. The needle is then directed towards the glabella. Some recommend directing
the needle slightly higher towards the occipital bone which can easily be palpated. After
touching the bone (which is painful) the needle is minimally retracted and the angle lowered
by about 15 and again advanced. There is a small degree of resistance as the ligamentum
nuchae is passed, but in contrast to the lumbar puncture this is less and much smoother. The
depth at which this occurs varies greatly between patients and averages about 5 cm.
Frequently it is necessary to aspirate the CSF. Figure 3 illustrated the location of the
cerebellomedular cisterne in relation to the skull and cervical vertebrae.
Figure 3. The position of the needle during the occipital tap is shown in this radiograph from 1960. The
needle is locate in the cerebellomedullary cisterne which was filled with a contrast agent (highlighted in
red). Modified from Figure 87 in reference [25].
Complications after an occipital tap are considerably more serious than after LP, but
headaches are rare.
Bleeding following puncture of the inferior cerebellar artery, of which there are
many anatomical variants, is associated with a high mortality due to tamponade of
131
the cisterne. This is different from a venous puncture of the epidural plexus which is
the same as a traumatic lumbar tap.
The medulla oblongata should not be reached under normal conditions. In patients
with ArnoldChiari malformation there is an increased risk of puncturing the
medulla oblongata.
The posterior columns can be irritated either by a pressure wave through the CSF or
by direct contact with the needle. The patient feels this similar to an electric shock.
The needle should be retracted. If the needle is moved accidentally sideways there is
a risk of performing a tractomy.
Headaches have been reported to be less frequent than after lumbar punctures. This
is one reason why at the beginning of the 20th century the occipital tap was favored
by some and even used as an outpatient procedure with the patient being allowed to
return home straight after the tap.
3. BIOMARKER OVERVIEW
Loss of cortical neurons is a key pathological feature of the degenerative dementias.
Following neuronal death and axonal degeneration, proteins present in the neuroaxonal
compartment will be released into the interstitial fluid and diffuse into the cerebrospinal fluid
(CSF). At present the most promising CSF biomarker thought to be related to axonal
degeneration in dementia is tau protein.
Clinicians like using surrogates because they are easier, earlier to obtain, cheaper and
more ethical to obtain than clinical endpoints. A biomarker can be a surrogate. A CSF protein
biomarker can be a surrogate for brain damage. Principally it is assumed that there is a
clinical-biomarker relationship where the biomarker reflects on the disease process.
Biomarkers should be superior (sensitivity/specificity) to clinical endpoints in monitoring the
disease process to become attractive to the clinician.
Axel Petzold
132
cholesterol and 72.1% increase of the good highdensity lipoprotein cholesterol) from
baseline, there was an increased risk of cardiovascular events and death [30].
I mention the results of the CAST and ILLUMINATE trial at the beginning of this
chapter because they show that the use of a surrogate outcome can cause a patient harm. They
should remind us that we are in the words of Donald Mainland playing a substitution game
[31]. All protein biomarkers discussed below are essentially surrogates in a substitution
game. The hypotheses underlying this substitution game may well be wrong and on all levels
patient safety should be our primary concern.
In the choice of a biomarker there are also important analytical points that need careful
consideration. These are discussed by Vanderstichele et al. in the chapter on biomarker
selection, qualification, and validation for use in early & differential diagnosis or therapy
follow-up.
133
Clinical endpoint: defines a meaningful measure which captures how a patient feels,
functions or survives. [35] Clinical endpoints may be subclassified into:
o Intermediate endpoint: represents a clinical endpoint that is not the ultimate
outcome but is nonetheless of real clinical usefulness. [35] (e.g. the mini
mental state examination, MMSE)
o Ultimate clinical outcome: represents a clinical endpoint reflective of
accumulation of irreversible morbidity and survival. [35]
o Timetoevent outcome: The time until a predefined event occurs, e.g. the time
to reaching a certain score on the Alzheimers Disease Assessment Scalecognitive scale.
3.3. Hypothesis
The biomarker hypothesis is that the cytoplasmatic content from injured cells leaks
through the disintegrating membrane into the surrounding ECF. From the ECF these
substances equilibrate with the CSF from where they can be easily sampled and measured.
Some proteins are only expressed by certain cell types. The quantity in which these cell
typespecific proteins are released is related to the amount of damaged cells. Thus the
measurement of celltype specific proteins indirectly allows us to estimate the degree of e.g.
neuronal loss. For example tau and neurofilaments (Nf) are specifically expressed in neurons
and their adjacent axons. Figure 4 illustrates how neurofilaments are released following
injury to the neuron. Thus the measurement of CSF Nf levels provides a tool to estimate the
amount of neuronal loss, a key pathological feature in neurodegenerative dementias.
Figure 4. Axonal biomarkers such as tau or neurofilaments are released into the extracellular fluid
(ECF) following neuronal death and axonal disintegration. From the ECF the biomarkers equilibrate
with the cerebrospinal fluid (CSF). The degree of neuroaxonal degeneration is related to the amount of
the biomarkers measured in the CSF.
The video clip supplied with this book illustrates how the neuronal cytoplasmatic content
is released as the lipid membrane disintegrates. All substances released into the surrounding
fluid compartment are potentially biomarkers, but only those specific for the neuronal and
axonal compartment can potentially be used as a celltype specific biomarker allowing to
indirectly estimating the amount of neuronal death and axonal damage.
134
Axel Petzold
4. PROTEIN BIOMARKER
4.1. Tau
The Protein
Tau is a protein of the cytosol which is predominantly present in axons. Therefore tau is
currently used as a biomarker for neuronalaxonal degeneration. The function of tau is to
promote microtubule stability and tau is also involved in axonal transport.
Tau was first isolated alongside the microtubule-associated proteins (MAP) with which it
co-purifies. Tau is encoded on chromosome 17 and due to alternative splicing of the mRNA,
six isoforms with a molecular weight of 48 to 68 kDa [36] exist in the human brain (Figure
5). There are three 3-repeat and three 4-repeat isoforms. All six isoforms are expressed in the
adult human brain, but only the 3repeat isoform with no N-terminal inserts is expressed in
the fetal brain. All tau isoforms can be phosphorylated at different sites. Tau
hyperphosphorylation occurs in a number of conditions. Hyperphosphorylated tau is present
in inclusion bodies. The inclusion bodies in AD are neurofibrillary tangles (NFTs), paired
helical filament-tau (PHF-tau) and contain all six isoforms [37].
Figure 5. There are six brain tau isoforms which are generated by alternative splicing. The 3- or 4tandem repeat regions are marked by dark blue bars. The N-terminal inserts produced by the alternative
splicing of exons 2 and 3 are shown in yellow (exon 2) and green (exon 3). The area marked in light
blue is the region produced by alternative splicing of exon 10. The number of amino acids is shown.
The arrows indicate the microtubule binding domains (MBD). Modified from reference [38].
135
Clinical Studies
At present the most promising CSF biomarker thought to be related to axonal
degeneration in dementia is tau protein [3,40-44]. For quantification of total tau most
laboratories now use the hTau ELISA from Innogenetics (Ghent, Belgium).
A number of studies investigated sensitivity and specificity levels of CSF tau in the
laboratory supported differential diagnosis of AD [45]. Typically CSF hTau is increased
about 3fold in AD compared to normal controls [45]. Sensitivity limits for the Innogenetics
ELISA for hTau ranged from 30100%. The measurement of tau phosphoforms may allow a
further increase in the levels of specificity and sensitivity (Table 2). It is interesting that some
of these phosphoforms are involved in promoting pathology (see above). There is emerging
evidence that measuring CSF tau is of predictive value for identifying MCI patients at risk of
Axel Petzold
136
developing AD [46]. This exciting research will be discussed in more detail in the chapter by
Venturelli et al. on Predicting Alzheimers disease in mild cognitive impairment: the role of
CSF markers.
A pooled sensitivity (36 studies) of 81% and specificity of 90% of distinguishing AD
patients (n=2500) from controls (n=1400) has been estimated [45].
Table 2. Sensitivity and specificity levels of CSF tau phosphoforms in the laboratory
supported differential diagnosis of AD. Because of its high specificity, the quantification
of CSF tau phosphorylated at Thr-231 is of particular interest [Adapted from [42]]
Phosphoform
Thr-181
Ser-199
Thr-231
Thr-181 & Ser235
Thr-231 & Ser235
Ser-396 & Ser404
Specificity
Spec 80100%
Spec 8082%
Spec 9197%
Spec 97%
Sensitivity
Sens 44-89%
Sens 88%
Spec 100%
Sens 53%
Spec 91%
Sens 94%
Sens 85-94%
Sens 85-100%
137
Clinical Studies
The CSF levels of CSF-A42 in AD are about half those in normal controls [45].
Typically the decrease of CSF ABP 1-42 levels is more marked than the accompanying
decrease of CSF ABP 1-40 levels. Therefore decreased levels of CSF ABP 1-42 are
particularly informative in the differential diagnosis of neurodegenerative dementias [4].
However, a decrease of CSF ABP 1-42 has also been observed in other neurodegenerative
dementias such as Lewy body dementia (LBD) [48,49], vascular dementia [48] and CJD [50].
In longitudinal studies on patients with subarachnoid haemorrhage (SAH) and traumatic brain
injury (TBI) a decrease of CSF ABP 1-40 and ABP 1-42 was also observed [51-53]. This
raises interesting future research questions because of the histological observation by Nicoll
et al. that there may be a link between ABP deposition in the brain of patients with head
injury and presence of the APOE epsilon4 allele [54]. More information on APOE is given in
the chapter by Mariani, Lovati and Fenoglio on ApoE and genetic markers.
A pooled sensitivity (13 studies) of 76% and specificity of 90% of distinguishing AD
patients (n=600) from controls (n=450) has been estimated [45].
4.3. 14-3-3
The Protein
Boston et al. first described the presence of 14-3-3 in the CSF [55]. Typically the 14-3-3
isoform, a monomere of 30 kDa molecular weight, is measured from the CSF [56]. In total,
there are seven human 14-3-3 isoforms (, , , , , , ) [57]. The five isoforms of the CNS
are labeled to . The many roles of 14-3-3 proteins include the shaping of the cytoskeleton,
regulation of the cellcycle, intracellular trafficking and cell signaling [58-60]. The 14-3-3
protein amounts to about 1% of the total soluble protein of the neuronal cytosol.
Clinical Studies
CSF 14-3-3 is most frequently used as a biomarker in the differential diagnosis of
sporadic CreuzfeldJakob disease [61,62] but, similarly to many of the other CSF protein
biomarkers, 14-3-3 is essentially released following cellular damage (Figure 4). CSF 14-33 has been reported in patients with GBS [63], Hashimotos encephalopathy [64,65],
meningitis and encephalitis [66,67], strokelike episodes [67] and transverse myelitis [68].
The analysis of CSF 14-3-3 has sensitivity between 9097% and specificity between 87
100% for the diagnosis of sporadic CJD (reviewed in [69]). In variant CJD the sensitivity is
somewhat lower at about 50%.
4.4. Neurofilaments
The Protein
Neurofilaments (Nf) are the key building blocks of the axonal cytoskeleton. The Nf
protein is a heteropolymer composed of four subunits: a light (NfL), a medium (NfM), and a
heavy (NfH) chain [70], and internexin [71-73]. Nf are almost exclusively expressed in
138
Axel Petzold
neurons and axons [74,75]. Following damage to the neuron and/or axon, the cytoplasmatic
contents are released into the extracellular fluid (ECF) (Figure 4 and video). From the ECF
Nf diffuse into other body fluid compartments including the cerebrospinal fluid (CSF)
(Figure 1C).
Highthroughput analysis of Nfs is possible using enzymelinked immune assays
(ELISA). In-house ELISAs have been developed for NfL and NfH [74,76-78]. These assays
are robust and have been crossvalidated [79,80]. A commercial ELISA kit for quantification
of the phosphorylated Nf heavy chain (pNfH) has recently become available (Millipore).
Historically it is interesting to note that neurofilaments were originally thought to be a
fundamental part of the paired helical filaments observed in AD [81,82]. The elegant studies
by Michel Goedert and colleagues demonstrated that, in fact, tau was the core component
[83]. It was not until Gerry Shaw developed a new antibody directed against internexin of
which Duda and colleagues made use [84] that neurofilaments re-entered the scenario [85]
and a new proteinopathy [86] called neurofilament inclusion body disease (NIBD) [87]
emerged.
Clinical Studies
We recently performed a systematic review and metaanalysis of the value of CSF NfL
and NfH level for the differential diagnosis in AD based on 11 studies [88] (Table 3). Whilst
CSF NfL and NfH levels were elevated in patients with AD and FTLD compared to control
subjects the difference is probably too small to justify routine testing [88]. CSF NfL levels
were slightly higher in patients with FTLD compared to AD [88,89]. Retrospective review of
our cases with pathological CSF NfH levels (unpublished data) suggests the test may be
helpful in selected cases with FTLD-MND, small vessel disease (SVD) and AD. CSF NfH
levels were also found to be elevated in patients with diffuse Lewy body disease (DLB) [89].
It will also be interesting to see whether those FTLD patients with particular high CSF Nf
levels will turn out on postmortem examination to suffer from NIBD. It will interesting to
see whether future quantification of the internexin protein can help in this situation.
The degree of NfH phorphorylation has found to be highest in patients with FTLD.
Further investigations on CSF NfH phosphoform levels in dementia are needed in order to
examine whether the immunohistochemical findings in patients with AD of increased
staining for phosphorylated NfH in intraneuronal tangles (NfHSMI310 ) [90,91], of pyramidal
neurons with neurofibrillary tangles (NfHSMI35 ) [92], of dystrophic neurons (NfHSMI32 ) [93],
and of neurons in the hippocampus [94] (NfHBF10 [95]) translates to relevant information for
the CSF analysis in dementia.
Whether or not high CSF NfH or NfL levels in dementia are of prognostic relevance is
not yet known because outcome studies have not been performed. The importance of
outcome studies for investigating the predictive value of CSF biomarkers in patients with a
suspected diagnosis of minimal cognitive deficit is discussed in the chapter by Venturelli et
al.
139
ALS
CBD
FTLD
DLB
MSA
PD
PSP
Findings
CSF NfL levels are elevated in patients with AIDS
dementia complex and there is a suggestion that they
decreased following treatment
CSF NfL and NfH levels are elevated in AD. The
difference from controls was marginally for CSF NfH
levels and more impressive for NfL levels, which also
correlated with CSF tau levels.
CSF NfL and NfH levels are considerably increased in
patients with ALS. Rapidly progressing ALS patients had
the highest CSF NfH levels.
CSF NfL and NfH levels are elevated in patients with
CBD.
CSF NfL is elevated and CSF NfH marginally elevated in
patients with FLTD. The degree of NfH phosphorylation
is increased in FTLD compared to AD and controls.
CSF NfH but not NfL levels are elevated in DLB
compared to AD and controls.
CSF NfL and NfH levels are markedly elevated in MSA
compared to controls and patients with PD. This may be
related to the greater degree and more rapid disease
progression in MSA. The highest levels are found in
patients with the cerebellar variant of MSA, which may
be of help in the differential diagnosis of patients with
cerebellar syndromes.
CSF NfH and NfL levels are increased in PD compared
to controls.
CSF NfL and NfH levels are elevated in PSP compared
to controls and patients with PD. As with MSA this may
be related to the greater degree of axonal loss and more
rapid disease progression in PSP patients, who are also
very treatment resistant.
References
[96]
[76, 106]
[107]
[97, 98,
101,103-105]
[89]
[Bre2006\s\do5
(0)0, 108, 109]
[107, 108]
[107, 108]
Axel Petzold
140
Clinical Studies
Most studies on CSF NSE levels were in patients with CJD [113]. Parnetti and
colleagues found CSF NSE levels to be related to the degree of cognitive deficit, but the
overlap between the control group and the AD patients (either early or late onset) was too
large for CSF NSE levels to be useful as a routine test in the laboratory-supported differential
diagnosis of AD [114]. Similarly Blennow and colleagues found CSF NSE levels to be rather
a nondisease specific biomarker for neuronal degeneration in dementia disorders [115], as
did Sulkava and colleagues [116].
4.6. Miscellaneous Biomarkers
This chapter was focused on four established CSF protein biomarkers for neuronal death
and axonal degeneration, tau, ABP 1-42, Nf, 14-3-3 and NSE. There are a number of other
important CSF protein biomarkers for macro- and microglial pathology such as S100B, glial
fibrillary acidic protein (GFAP), ferritin, clusterin, etc. New biomarkers are emerging with
largescale proteomic screening tools. Table 4 gives an overview of established and
potentially interesting CSF biomarkers and their predominant cellular source.
Table 4. The CSF analysis in patients with suspected dementia
10
11
Disease
AD
CJD
High TP
Demyelinating
disease
FTLD
Normal
HIV dementia
Mild elevation of TP
Hydrocephalus
NIBD
Paraneoplastic
disease
Spirochete
disease
Vasculitis
Whipples
Essentially normal
141
4.7. Pitfalls
There are numerous preanalytical and analytical pitfalls which can influence CSF
protein biomarker levels and thus compromise the interpretation of the result. Some important
pitfalls are are:
1. CSF sampling technique: (1) a traumatic tap leading to contamination of the CSF
with blood artificially increases the amount blood derived substances (e.g. albumin);
(2) the concentration of protein biomarker varies between different lumbar segments
and between the first and last of 3 sequentially taken tubes [117]; (3) samples not
collected in a polypropylene tube may lead to artificially low CSF protein biomarker
levels caused by binding of negatively charged proteins to the positively charged
surface of glass or polystyrene containers.
2. CSF transport: long transport times, high ambient temperature and vigorous shaking
of the sample all can cause lysis of cells and proteolytic degeneration of proteins thus
seriously impairing cytology and levels of some CSF protein biomarkers.
3. Sample handling and time to storage; ideally samples should be spun down and
stored within 1 to 2 hours of receipt. Contamination of the CSF with substances
released from lysed cells, proteolysis and in vivo post-translational modifications all
impair CSF protein biomarker levels and proteomic analysis.
4. Storage conditions: for CSF protein biomarker analysis samples should be stored at 70C to prevent enzymatic protein modification such as proteolysis, which is known
to occur even at -20C. Repeated freezethaw cycles can lead to protein-aggregate
formation, proteolytic breakdown and posttranslational modifications.
5. The accuracy of the results depends on the intraassay coefficient of variation (CV).
The CV is a measure of the degree of variation in the results obtained by the same
assay on the same sample at different timepoints. The benchmark is a CV of less
than 10%. However, new assays do not always reach this target. It is worthwhile
remembering that an assay with a CV of 20% cannot reliably be used to detect a
group or sample difference of less than 20%.
6. Another potential, but not yet studied error could be introduced by the presence of
autoantibodies against the target biomarker (e.g. tau or neurofilament proteins).
Theoretically the presence of autoantibodies, which have been reported, could impair
the measurement of CSF biomarker levels by masking the bindingepitopes essential
for the laboratory assay [75]. This could lead to artificially low protein biomarker
levels in the presence of masking antibodies.
142
Axel Petzold
143
degenerative dementia is suspected the CSF analysis may be helpful. Because the basic CSF
analysis is normal in AD any change in the CSF opening pressure, cytology, glucose, lactate
or total protein content is suspicious. The routine CSF analysis can thus guide the clinician to
investigate further for conditions listed above. In selected cases an extended CSF analysis
may be required. The presence of oligoclonal bands (OCB) is always a sign of pathology and
suggests the presence of an autoimmune or infectious process.
The combination of CSF tau and ABP 1-42 levels were found to be useful to distinguish
AD from Parkinsons and depression. They were less useful in separating AD from other
neurodegenerative dementias such as FTLD or Lewy body dementia [45]. There was one
report showing that the measurement of P-tau allowed one to distinguish AD from other
dementias with a specificity of over 80% [122]. A profile of CSF biomarkers allowed early
detection of AD in MCI cases with a sensitivity of 95% and a specificity of 83-87% [123].
The combined use of CSF tau and ABP 1-42 levels gives an estimated sensitivity of 85-94%
and specificity of 83100% of distinguishing AD patients from controls [45].
Iqbal and GrundkeIqbal recently proposed the existence of 5 AD subtypes based on a
profile of CSF protein biomarkers combined with the pattern of onset [124] (Table 5). The
authors also speculate that more AD subtypes may emerge with the systematical
quantification of CSF tau phosphoforms [125].
Table 5. The Iqbal classification of AD subtypes based on CSF biomarker profiling
AD
subtype
Type of
onset
AELO
ATEO
ATURO
HARO
LEBALO
late
early
recent
recent
late
hTau
high
high
ubiquitin
high
Other
features
Frequency
APOE4
50%
22%
1%
5%
19%
Lewy bodies
Because of the wide spectrum of diseases causing impaired cognition and the many ways
biomarker levels can be influenced in vivo and in vivo, my personal inclination is to be
guided rather by clinical judgment than purely by biomarker levels, but it will be interesting
to see whether such biomarker based classification schemes will have an impact on future
research and patient management.
12
A proof of principal study showing that the protein biomarker levels from the external CSF spaces adjacent to
the cortex correlate with what is measured from the lumbar CSF has yet to be performed.
144
Axel Petzold
and elevated CSF hTau or pTau levels have an increased chance of developing AD. A more
detailed discussion of these studies is given in the chapter by Scheltens and Schooneboom.
In some patients with FTLD-MND high CSF Nf levels were found (Petzold, unpublished
data). Based on prospective studies in MND one would expect high CSF Nf levels in FLTDMND to be a poor prognostic sign.
There is yet no CSF data on postmortem-confirmed cases of NFIB dementia. The
question to be answered is whether high CSF Nf levels in some patients presenting as FTLD
may in fact indicate NFIB, which has a poor prognosis.
13
The observed increase of 2 to 14% between basline and follow up (after 219 month) was less then the intraassay CV for tau, Ptau-181 and ABP 1-42.
145
CSF Nf levels should normalise. An increase of initially normal CSF Nf levels may
indicate a neurotoxic effect. The role of CSF Nf levels as a safety biomarker should
be investigated.
CSF NSE levels should normalise. In analogy to CSF Nf, CSF NSE levels may be
used as a safety biomarker.
CSF ABP 1-42 levels should increase (normalise).
CSF cytology should remain normal. An increase of CSF WCC may indicate an
inflammatory process, e.g. as observed the recent active anti-A beta vaccination
(AN1792) trial in AD patients which was stopped because 6% of the inoculated
patients developed aseptic meningoencephalitis [142]. Serial CSF cytology may be
useful in future treatment trials.
CSF OCB should not occur as a result of a treatment trial. Occurrence of OCB may
indicate that an immune-reaction within the CNS has been triggered. CSF OCB may
be useful for future treatment trials using vaccination strategies or monoclonal
antibodies.
Figure 6. Sample size estimation based on the analytical accuracy for a biomarker detecting a 50%
difference (closed lines) and for a biomarker detecting only a 25% difference (dotted lines) between
equally weighted groups. If the analytical error (SD+CV) amounts to 10% (open circles), then a
considerably smaller sample size is required compared to an error of 30% (crosses). This is illustrated
by the red vertical arrows (an increase of the sample size from n=8 to n=48 is caused by the decreased
analytical accuracy). The horizontal line indicates the commonly accepted power of 80% at alpha=0.05.
Figure 6 illustrates the importance of the analytical accuracy of any biomarker (outlined
in the section about pitfalls) for sample size calculations needed for treatment trials.
Simplified, the higher the analytical accuracy (low CV and low standard deviation) and the
146
Axel Petzold
bigger the difference a biomarker detects between groups, the smaller will be the sample size
required for a treatment trial. The commonly accepted target for planning a treatment trial is
to reach a power of 80% at a level of significance of p = 0.05 ( = 0.05). Because of the
implicated costs per patient recruited, a biomarker used as a secondary outcome measure (see
section on substitution game) that will allow to show a treatment effect with n=8 per group
because of its high accuracy will be much favored over a biomarker that could show the same
effect but, because of its low accuracy, only with n=48 per group. For comparison for future
trials in prodromal AD, sample sizes of 750 to 1000 with follow-up times for 3-4 years have
been called for [2]. This has serious financial implications which may by the appropriate use
of accurate CSF protein biomarkers reduced.
REFERENCES
[1]
147
[12] H. Reiber. The discrimination between different blood-CSF barrier dysfunctions and
inflammatory reactions of the CNS by a recent evaluation graph for the protein profile
of cerebrospinal fluid. J Neurol, 224:8999, 1980.
[13] H Reiber. Dynamics of brain-derived proteins in cerebrospinal fluid. Clin Chim Acta,
310:17386, 2001.
[14] H Quincke. Die Lumbalpunktion des Hydrocephalus. Berliner Klinische
Wochenschrift, 28:929932, 1891.
[15] W Essex Wynter. Four cases of tubercular meningitis in which paracentesis of the theca
vertebralis wsa performed for the relief of fluid pressure. The Lancet, pages 981982,
May 2 1891.
[16] J.M. Boon, P.H. Abrahams, J.H. Meiring, and T. Welch. Lumbar puncture: anatomical
review of a clinical skill. Clin Anat, 17:544553, 2004.
[17] D Carson and M Serpell. Choosing the best needle for diagnostic lumbar puncture. J
Emerg Med, 15:126126, 1997.
[18] K. M. Kuntz, E. Kokmen, J. C. Stevens, P. Miller, K. P. Offord, and M. M. Ho. Postlumbar puncture headaches: experience in 501 consecutive procedures. Neurology,
42:18847, 1992.
[19] S. V. Ahmed, C. Jayawarna, and E. Jude. Post lumbar puncture headache: diagnosis
and management. Postgrad Med J, 82(973):7136, 2006.
[20] K.H. Shah and J.A. Edlow. Distinguishing traumatic lumbar puncture from true
subarachnoid hemorrhage. J Emerg Med, 23:6774, 2002.
[21] C.J. Eskey and C.S. Ogilvy. Fluoroscopy-guided lumbar puncture: decreased frequency
of traumatic tap and implications for the assessment of CT-negative acute subarachnoid
hemorrhage. AJNR Am J Neuroradiol, 22:571506, 2001.
[22] KI Marton and AD Gean. The spinal tap: a new look at an old test. Ann Intern Med,
104:840848, 1986.
[23] M.J. Wood, G. Dimeski, and A.M. Nowitzke. CSF spectrophotometry in the diagnosis
and exclusion of spontaneous subarachnoid haemorrhage. J Clin Neurosci, 12:142106,
2005.
[24] J. V. McDonald and T. E. Klump. Intraspinal epidermoid tumors caused by lumbar
puncture. Arch Neurol, 43(9):9369, 1986.
[25] A Benninghoff and K Goerttler. Lehrbuch der Anatomie des Menschen. Urban and
Schwarzenberg, Munich-Berlin, 7th edition, 1960.
[26] S. Freud. The origin and development of psychoanalysis. American Journal of
Psychology, 21:181218, 1910.
[27] PH Wood. Where are we now with radiographic assessment of rheumatoid arthritis? Br
J Rheumatol, 22((3 Suppl)):2433, 1983.
[28] J. T. Bigger, Jr. Long-term continuous electrocardiographic recordings and
electrophysiologic testing to select patients with ventricular arrhythmias for drug trials
and to determine antiarrhythmic drug efficacy. Am J Cardiol, 58:58C65C, 1986.
[29] Preliminary report: effect of encainide and flecainide on mortality in a randomized trial
of arrhythmia suppression after myocardial infarction. The Cardiac Arrhythmia
Suppression Trial (CAST) Investigators. N Engl J Med, 321:40612, 1989.
148
Axel Petzold
149
[45] K. Blennow and H. Hampel. CSF markers for incipient Alzheimers disease. Lancet
Neurol, 2:60513, 2003.
[46] M. S. Chong and S. Sahadevan. Preclinical Alzheimers disease: diagnosis and
prediction of progression. Lancet Neurol, 4(9):5769, 2005.
[47] D. W. Dickson. The pathogenesis of senile plaques. J Neuropathol Exp Neurol,
56:32139, 1997.
[48] N. Andreasen, L. Minthon, E. Vanmechelen, H. Vanderstichele, P. Davidsson, B.
Winblad, and K. Blennow. Cerebrospinal fluid tau and Abeta42 as predictors of
development of Alzheimers disease in patients with mild cognitive impairment.
Neurosci Lett, 273:58, 1999.
[49] K. Kanemaru, N. Kameda, and H. Yamanouchi. Decreased CSF amyloid beta42 and
normal tau levels in dementia with Lewy bodies. Neurology, 54:18756, 2000.
[50] M. Otto, H. Esselmann, W. Schulz-Shaeffer, M. Neumann, A. Schroter, P. Ratzka, L.
Cepek, I. Zerr, P. Steinacker, O. Windl, J. Kornhuber, H. A. Kretzschmar, S. Poser, and
J. Wiltfang. Decreased beta-amyloid1-42 in cerebrospinal fluid of patients with
Creutzfeldt-Jakob disease. Neurology, 54:1099102, 2000.
[51] A Kay, A Petzold, M Kerr, G Keir, E Thompson, and J Nicoll. Temporal alterations in
cerebrospinal fluid amyloid beta-protein and apolipoprotein E after subarachnoid
hemorrhage. Stroke, 34:e240243, 2003.
[52] A Kay, A Petzold, M Kerr, G Keir, E Thompson, and J Nicoll. Decreased cerebrospinal
fluid apolipoprotein E after subarachnoid hemorrhage: correlation with injury severity
and clinical outcome. Stroke, 34:637642, 2003.
[53] AD Kay, A Petzold, M Kerr, G Keir, E Thompson, and JA Nicoll. Alterations in
cerebrospinal fluid apolipoprotein E and amyloid. J Neurotrauma, 20:943952, 2003.
[54] JA Nicoll, GW Roberts, and DI Graham. Apolipoprotein E epsilon 4 allele is associated
with deposition of amyloid beta-protein following head injury. Nat Med, 1:135137,
1995.
[55] P.F. Boston, P. Jackson, and R.J. Thompson. Human 14-3-3 protein:
radioimmunoassay, tissue distribution, and cerebrospinal fluid levels in patients with
neurological disorders. J Neurochem, 38:14751482, 1982.
[56] A.J. Green, S. Ramljak, W.E. Muller, R.S. Knight, and H.C. Schroder. 14-3-3 in the
cerebrospinal fluid of patients with variant and sporadic Creutzfeldt-Jakob disease
measured using capture assay able to detect low levels of 14-3-3 protein. Neurosci Lett,
324:5760, 2002.
[57] G.P. van Heusden. 14-3-3 proteins: regulators of numerous eukaryotic proteins. IUBMB
Life, 57:623609, 2005.
[58] A. Aitken. 14-3-3 proteins: a historic overview. Semin Cancer Biol, 16:16272, 2006.
[59] D. Bridges and G.B. Moorhead. 14-3-3 proteins: a number of functions for a numbered
protein. Sci STKE, 2005:re10, 2005.
[60] P. Mhawech. 14-3-3 proteinsan update. Cell Res, 15:228236, 2005.
[61] AJ Green, EJ Thompson, GE Stewart, M Zeidler, JM McKenzie, MA MacLeod, JW
Ironside, RG Will, and RS Knight. Use of 14-3-3 and other brain-specific proteins in
CSF in the diagnosis of variant Creutzfeldt-Jakob disease. J Neurol Neurosurg
Psychiatry, 70:744748, 2001.
150
Axel Petzold
151
152
Axel Petzold
153
154
Axel Petzold
[121] A Petzold, P Downie, and M Smith. Critical illness brain syndrome (CIBS) - an
underestimated entity? Crit Care Med, in press.
[122] H. Hampel, K. Buerger, R. Zinkowski, S. J. Teipel, A. Goernitz, N. Andreasen, M.
Sjoegren, J. DeBernardis, D. Kerkman, K. Ishiguro, H. Ohno, E. Vanmechelen, H.
Vanderstichele, C. McCulloch, H. J. Moller, P. Davies, and K. Blennow. Measurement
of phosphorylated tau epitopes in the differential diagnosis of Alzheimer disease: a
comparative cerebrospinal fluid study. Arch Gen Psychiatry, 61:95102, 2004.
[123] O. Hansson, H. Zetterberg, P. Buchhave, E. Londos, K. Blennow, and L. Minthon.
Association between CSF biomarkers and incipient Alzheimers disease in patients
with mild cognitive impairment: a follow-up study. Lancet Neurol, 5:22834, 2006.
[124] K. Iqbal, M. Flory, S. Khatoon, H. Soininen, T. Pirttila, M. Lehtovirta, I. Alafuzoff, K.
Blennow, N. Andreasen, E. Vanmechelen, and I. Grundke-Iqbal. Subgroups of
Alzheimers disease based on cerebrospinal fluid molecular markers. Ann Neurol,
58:74857, 2005.
[125] K. Iqbal and I. Grundke-Iqbal. Developing pharmacological therapies for Alzheimer
disease. Cell Mol Life Sci, 64:223444, 2007.
[126] C. Mulder, S.N. Schoonenboom, L.O. Wahlund, P. Scheltens, G.J. van Kamp, R.
Veerhuis, C.E. Hack, M. Blomberg, R.B. Schutgens, and P. Eikelenboom. CSF markers
related to pathogenetic mechanisms in Alzheimers disease. J Neural Transm,
109:14911408, 2002.
[127] P.J. Kahle, M. Jakowec, S.J. Teipel, H. Hampel, G.M. Petzinger, D.A. Di Monte, G.D.
Silverberg, H.J. Moller, J.A. Yesavage, J.R. Tinklenberg, E.M. Shooter, and J.r.
Murphy GM. Combined assessment of tau and neuronal thread protein in Alzheimers
disease CSF. Neurology, 54:14981904, 2000.
[128] D. Galasko, C. Clark, L. Chang, B. Miller, R.C. Green, R. Motter, and P. Seubert.
Assessment of CSF levels of tau protein in mildly demented patients with Alzheimers
disease. Neurology, 48:632605, 1997.
[129] M. Riemenschneider, K. Buch, M. Schmolke, A. Kurz, and W.G. Guder. Cerebrospinal
protein tau is elevated in early Alzheimers disease. Neurosci Lett, 212:209211, 1996.
[130] R. Motter, C. Vigo-Pelfrey, D. Kholodenko, R. Barbour, K. Johnson-Wood, D.
Galasko, L. Chang, B. Miller, C. Clark, R. Green, and al. et. Reduction of beta-amyloid
peptide42 in the cerebrospinal fluid of patients with Alzheimers disease. Ann Neurol,
38:643608, 1995.
[131] T. Sunderland, B. Wolozin, D. Galasko, J. Levy, R. Dukoff, M. Bahro, R. Lasser, R.
Motter, T. Lehtimaki, and P. Seubert. Longitudinal stability of CSF tau levels in
Alzheimer patients. Biol Psychiatry, 46:750705, 1999.
[132] H. Arai, M. Terajima, M. Miura, S. Higuchi, T. Muramatsu, S. Matsushita, N. Machida,
T. Nakagawa, V.M. Lee, J.Q. Trojanowski, and H. Sasaki. Effect of genetic risk factors
and disease progression on the cerebrospinal fluid tau levels in Alzheimers disease. J
Am Geriatr Soc, 45:12281231, 1997.
[133] S. Ganzer, S. Arlt, V. Schoder, C. Buhmann, E.M. Mandelkow, U. Finckh, U.
Beisiegel, D. Naber, and T. Muller-Thomsen. CSF-tau, CSF-Abeta1-42, ApoEgenotype and clinical parameters in the diagnosis of Alzheimers disease: combination
155
of CSF-tau and MMSE yields highest sensitivity and specificity. J Neural Transm,
110:11491160, 2003.
[134] T. Sunderland, G. Linker, N. Mirza, K.T. Putnam, D.L. Friedman, L.H. Kimmel, J.
Bergeson, G.J. Manetti, M. Zimmermann, B. Tang, J.J. Bartko, and R.M. Cohen.
Decreased beta-amyloid1-42 and increased tau levels in cerebrospinal fluid of patients
with Alzheimer disease. JAMA, 289:20942103, 2003.
[135] R.E. Tato, A. Frank, and A. Hernanz. Tau protein concentrations in cerebrospinal fluid
of patients with dementia of the Alzheimer type. J Neurol Neurosurg Psychiatry,
59:280203, 1995.
[136] C. Hock, S. Golombowski, W. Naser, and F. Muller-Spahn. Increased levels of tau
protein in cerebrospinal fluid of patients with Alzheimers diseasecorrelation with
degree of cognitive impairment. Ann Neurol, 37:414405, 1995.
[137] I. Skoog, E. Vanmechelen, L.A. Andreasson, B. Palmertz, P. Davidsson, C. Hesse, and
K. Blennow. A population-based study of tau protein and ubiquitin in cerebrospinal
fluid in 85-year-olds: relation to severity of dementia and cerebral atrophy, but not to
the apolipoprotein E4 allele. Neurodegeneration, 4:433442, 1995.
[138] F. H. Bouwman, W. M. van der Flier, N. S. Schoonenboom, E. J. van Elk, A. Kok, F.
Rijmen, M. A. Blankenstein, and P. Scheltens. Longitudinal changes of CSF
biomarkers in memory clinic patients. Neurology, 69(10):100611, 2007.
[139] K. Buerger, M. Ewers, T. Pirttila, R. Zinkowski, I. Alafuzoff, S.J. Teipel, J.
DeBernardis, D. Kerkman, C. McCulloch, H. Soininen, and H. Hampel. CSF
phosphorylated tau protein correlates with neocortical neurofibrillary pathology in
Alzheimers disease. Brain, 129:30353041, 2006.
[140] A Petzold, R Jenkins, HC Watt, AJ Green, EJ Thompson, G Keir, NC Fox, and MN
Rossor. Cerebrospinal fluid S100B correlates with brain atrophy in Alzheimers
disease. Neurosci Lett, 336:167170, 2003.
[141] P. J. Visser, P. Scheltens, and F. R. Verhey. Do MCI criteria in drug trials accurately
identify subjects with predementia Alzheimers disease? J Neurol Neurosurg
Psychiatry, 76(10):134854, 2005.
[142] C. A. Hawkes and J. McLaurin. Immunotherapy as treatment for Alzheimers disease.
Expert Rev Neurother, 7(11):153548, 2007.
Chapter VII
ABSTRACT
In Alzheimers disease (AD) brain tissue, the accumulation of amyloid associated
factors and clustering of activated microglia in amyloid- (A) plaques precede the taurelated neurodegenerative changes. Amyloid associated factors are a heterogeneous
group of proteins (including complement factors, acute-phase proteins, pro-inflammatory
cytokines). A number of these, mostly inflammation related, factors co-localize with A
deposits, even in early stages of A plaque development. Most amyloid associated
factors normally are produced at low levels in the brain, but their synthesis rate increases
in AD brain. Microarray studies also confirm that the local chronic inflammatory
processes seen in post mortem brain specimens are early signs of the disease process, as
local expression of inflammation related molecules significantly increases in
mild/moderate dementia cases compared to controls.
Some amyloid associated factors may bind to A and promote its aggregation,
whereas others prevent A aggregation and possibly are involved in A transport. Thus,
Correspondence concerning this article should be addressed to: R. Veerhuis E-mail: [email protected].
158
1. INTRODUCTION
Alzheimers disease (AD) is a chronic neurodegenerative disease neuropathologically
characterized by extracellular accumulation of the amyloid (A) peptide in the form of
amyloid deposition in brain tissue (plaques) and as vascular amyloid deposits (amyloid
angiopathy), as well as by intraneuronal accumulation of paired helical filaments (PHF),
consisting of the microtubulus associated tau protein. In addition, synaptic and dendritic loss,
and premature neuronal death are seen. Deposition of the A results from the propensity of
A to aggregate and form fibrils. Different types of A plaques can be distinguished
morphologically and based on composition of the A plaques. Roughly a division between
plaques consisting of non- (or low-) fibrillar A, comprising the diffuse plaques, and of
fibrillar A can be made. The prominent neuritic plaques consist of highly fibrillar A, often
have a dense amyloid core (classical plaques) and are associated with clusters of activated
microglia as well as dystrophic neuronal processes.
The cerebral A deposits in the brain parenchyma and in vessel walls seen in AD are the
consequence of impaired balance between the production and the removal of the A peptide.
Synthesis of A is the result of the combined actions of - and -secretases leading to
proteolytic cleavage of the amyloid- precursor protein (APP). Increases in A production
can explain the small percentage of early onset cases of familial AD bearing inherited
mutations in APP or the presenilin 1 or 2 genes. However, despite the elevated levels of A
observed in the brain of late onset, sporadic AD, no clear increase in A production was
found. The accumulation of A in the form of plaques in late onset or sporadic AD cases was
therefore proposed to be caused by inefficient elimination of A from the brain [316].
Breakdown of A in the brain can occur through the actions of proteolytic enzymes that
degrade A, such as neprisylin, the insulin-degrading enzyme (IDE) and plasmin
[127,179,217]. Removal of A from the brain can also be through uptake and subsequent
159
intracellular degradation by glial cells, astrocytes and microglia, or through drainage of the
A from the brain by a carrier-mediated transport system into the cerebrospinal fluid and
blood as well as by passive diffusion or transport of the interstitial fluid via the VirchowRobin space [21,315]. Like in other types of protein misfolding protein diseases, including
Creutzfeldt Jakobs disease, Parkinsons disease, Huntington, the accumulation of misfolded
A results in initiation of glial cell activation and local (neuro) inflammatory responses. This
inflammatory response occurs relatively early in the disease process and may lead to removal
of the initiating agent (A in AD) by activated glial cells, but may eventually lead to
neurodegeneration.
A definite diagnosis AD can only be made upon /still requires post mortem examination
of the brain. Nevertheless, AD can be clinically diagnosed with a relatively high sensitivity.
However, in more advanced stages of AD only. For research purposes, the clinical diagnosis
of AD is based on a two step diagnostic procedure, first identifying the dementia syndrome
and subsequently clinical AD features, according to DSM-IV-TR and NINCDS-ADRDA
criteria. Accuracy of AD diagnosis is 80 to 90% with diagnostic methods including brain
imaging, the use of patient history, neuropsychological testing, EEG and laboratory tests (i.e.
to exclude vitamin deficiencies) at expert academic research centers, and probably lower in a
normal clinical setting. This accuracy can be reached when the disease has progressed to the
dementia stage, and even then patients are classified as possible or probable AD [178].
It still remains very difficult, to clinically diagnose AD in earlier stages of the disease,
when patients are not demented and, especially in young patients, no atrophy can be detected
with magnetic resonance imaging (MRI) [241].
The number of Alzheimers disease patients is expected to rapidly increase as the
population ages. Therefore, there is an urgent need for techniques that detect or see brain
changes in the earliest stages of cognitive decline, so that people at risk can be identified and
effects of drugs to stop or slow the progression of Alzheimers can be monitored. Difficulty is
that most of the elderly people have brain pathology. In a large longitudinal communitybased study, at autopsy cerebral microinfarcts, AD and neocortical Lewy bodies were found
to be predominant pathological correlates of dementia in an US suburban and urban elderly
population [256]. Furthermore, elderly demented people most often have multiple brain
pathologies [240]. Therefore, for specific treatment strategies, it is necessary to well
characterize the patients, and assess the underlying pathologies.
A number of techniques have been developed to recognize clinical phenotypic markers.
These include MRI with which medial temporal lobe atrophy can be seen, positron emission
tomography (PET) imaging to visualize molecular changes as a result from hypometabolism
and /or hypoperfusion in temperoparietal areas, as well as measurements of changes in
biomarker (levels) in cerebrospinal fluid (CSF). Studies are ongoing, to seek for imaging
techniques and other biomarkers that, over time, can measure biological changes in the
progression from mild cognitive impairment to Alzheimers disease. Candidates are PET,
using the radiotracers [11C]- labelled Pittsburgh compound B (PIB)[139], or [18F]radiofluorinated FDDNP [252] for the detection of A deposits, or the [11C]-radiolabelled
isoquinoline PK11195, [11C](R)- PK11195, that binds to peripheral benzodiazepine binding
sites, that in the brain are specifically expressed by activated microglia [45].
160
The search for biomarkers can be divided in two approaches 1) the array approach with
which differences in expression patterns (DNA or protein level) between control and AD
affected individuals are investigated, and possible candidate biomarkers selected, or 2) an
hypothesis driven approach with which (protein) levels of factors known (from
immunohistochemical data or model studies) to be part of certain pathways involved in AD
pathogenesis, are tested for their discriminative power for use as biomarker.
Activated microglia and various inflammation-related proteins, including cytokines,
proteases and protease inhibitors, as well as enzymes involved in arachidonic acid
metabolism (cyclooxygenases / lipoxygenases), can be observed in AD affected brain
regions, which suggests the involvement of a local neuroinflammatory process in AD
pathogenesis [8]. This neuroinflammatory process is an early stage in the progression of
neuropathological changes of AD, since different inflammation-related proteins are not only
present in fibrillar or neuritic A plaques, but also in low-fibrillar, diffuse A plaque types in
which no microglia clustering and neuritic changes are apparent [278] (Figure 1). A large
number of these inflammation related factors can be detected in CSF and in serum. Therefore,
in this chapter the possibilities to use levels of inflammation related factors, or of
splice/activation products of these in CSF or blood as biomarker will be discussed.
2. NEUROINFLAMMATION IN AD
2.1. Amyloid associated Factors and Microglia: Immunohistochemistry
In virtually all A plaque types, ranging from loosely organized, diffuse A plaques
made up of non- to low fibrillar A, to neuritic A plaques consisiting of highly fibrillar
A, also proteins other than A can be found [312]. These include a number of acute phase
proteins as well as sulphated glycosaminoglycans and proteoglycans, and are collectively
referred to as amyloid associated factors, that may determine the degree of A fibril
formation or protect the A against proteolysis [278]. More than 20 years ago, senile plaques
were found to contain complement activation products [66,68,176] and other inflammation
related factors in immunohistochemical studies [8].
The chronic inflammatory response in AD brains is seen in fibrillar A plaques, but not
in the diffuse plaque with the non-congophilic low-fibrillar A deposits. Whereas in classical
and neuritic plaques, consisting of congophilic fibrillar A, activated microglia and altered
neurites accumulate, the diffuse plaques are not associated with activated microglia and
altered neuritis [125,231]. In addition, whereas strong immunostaining for complement
activation products is seen in highly fibrillar, classical A plaques, no or weak
immunoreactivity for early complement components was observed in diffuse plaques
composed of non- or low-grade fibrillar A peptide [70].
Complement activation products and also other amyloid associated factors including
clusterin, apolipoprotein E, serum amyloid P component (SAP) and heparan sulfate
proteoglycans can also be found in congophilic angiopathy (CAA). However, a number of
inflammatory proteins, known to be present in senile plaques, such as 1-antichymotrypsin
(ACT), alpha2-macroglobulin (A2M) and ICAM-1, were absent or detectable only in small
161
amounts. Furthermore, the number of cells of the monocyte/macrophage lineage in CAA was
not increased compared to unaffected vessels, which suggests that an incomplete
inflammatory response occurs in CAA, as compared to senile plaques and that different
pathogenesis mechanisms lead to CAA and senile plaques [283].
1-Antichymotrypsin (ACT)
In contrast to other amyloid associated factors, ACT specifically accumulates in A
containing amyloid, not in other types of amyloid deposits. Abraham and coworkers first
described ACT as an A-associated protein [6]. Using monoclonal antibodies specific for
neo-epitopes exposed on ACT complexed to cathepsin G, we could demonstrate that ACT in
A plaques of AD patients expose neo-epitopes similar to those exposed on complexed ACT
[229]. This suggests that ACT in A plaques may be complexed to a target protease that
possibly is specific for AD or APP metabolism.
Microglia
Resting, ramified microglia can be found more or less evenly distributed throughout the
gray matter of normal brain. In contrast to microglia in the white matter that seem
continuously activated, these unreactive microglia lack expression of major
histocompatibility complex (MHC) class II molecules. In AD brain gray matter, clusters of
activated MHC class II positive cells of the monocyte-macrophage cell lineage, microglia, are
seen associated with fibrillar A plaques [177,214,225,230,234,281]. These activated
microglia in addition express complement receptors 3 and 4 (iC3b receptors), Fc receptors,
chemokine receptors (CCR2, CCR3 and CCR5) and CD45 [8,124,260]. Clinicopathological
[13,234] and neuroradiological [45] studies have indicated that this clustering of activated
microglia is a relatively early event that precedes the process of neuropil destruction in AD.
The Complement System
In addition to the complement activation products C1q, C4b, C3b that co-localize with
A plaques and may enhance A removal by microglia, the complement activation products
include the lytic C5b-9 complex and the chemotactic C3a and C5a. Reactive astrocytes
express C5a- [237] and C3a [123] specific receptors. Also C5L2 (complement 5a-like
receptor), that in contrast to C5aR is not G-proten coupled and possibly acts as a decoy
receptor for C5a, is expressed by astrocytes and neurons throughout brain [96]. Combined
these findings suggest that complement activation products could play an important role in
the local recruitment and activation of glial cells.
The observation that accumulation of amyloid associated factors and clustering of
activated, cytokine secreting microglia in A deposits precedes the neurodegenerative
changes in AD, together with the finding that especially polymorphisms of certain cytokines
(IL-1, IL-6, TNF-) and acute-phase proteins (1-antichymotrypsin) are genetic risk factors
for AD [135,175,191], has led to the concept that pro-inflammatory cytokines released by
activated microglia are the driving force in AD pathology [8,101]. The subsequently evolved
neuroinflammation hypothesis posits that initial A deposits and damaged neurons or
neurites may elicit a localized and chronic inflammatory reaction, which, in turn, may
exacerbate the pathogenetic process [8].
162
163
164
A dicarboxylic acid, pyrrolidone ring containing compound was shown to inhibit SAP
binding to amyloid fibrils, but also to cross-link pairs of SAP pentamers that subsequently are
cleared from the circulation. As a result, the compound was found to remove SAP from
human amyloid deposits in tissues and may provide a new therapeutic approach to
amyloidosis, and possibly to AD [210].
In addition to its effects on amyloid, SAP binds to PE exposed on apoptotic cells, thereby
opsonizing them for removal by the immune system [79] and can also directly induce
neuronal apoptosis in primary cultures of rat cerebral cortex [272] and in vivo in rats
intrahippocampally injected with SAP [273], which suggests that SAP may contribute to the
development of neurodegenerative diseases through direct neurotoxic effects. SAP-induced
neurotoxicity is independent from caspase and calpain activation. Interestingly, C1q protects
neurons in culture from A and SAP induced neurotoxicity, but has no effect on A-activated
caspase and calpain pathways [213]. Combined with the data on microglia activation by SAP
complexed to A, these data highlight the direct and indirect neurotoxic potential of SAP and
a protective role for complement.
Oligomeric A is currently believed to be the major neurotoxic form of A and not the
highly aggregated, fibrillar form of A [138]. Since binding of amyloid associated proteins
such as complement factor C1q and SAP enhance the fibril formation of A peptides
[281,290], this may lead to sequestration and consequent reduction of levels of the soluble
neurotoxic A. On the other hand, the formation of large aggregates consisting of high
fibrillar A complexed with C1q and SAP leads to increased production of pro-inflammatory
cytokines by micoglia [278].
In addition, A-associated proteins, such as complement protein C1q [291], or the
combination of C1q and SAP [78] and also proteoglycans [244], can hamper A
phagocytosis by microglia.
2-Macroglobulin
Alpha2-macroglobulin (A2M) is immunohistochemically detected in a subgroup of
cortical and hippocampal A plaques, as well as in large hippocampal neurons in AD
[22,258], however, not in diffuse plaques in AD or in amyloid plaques in non-demented
controls [275,312]. Human A2M, like the other -macroglobulins complement factors C3 and
C4, can bind various ligands. Although considered a protease inhibitor, A2M can entrap, but
not inactivate, various proteases. Interaction between protease and bait region within A2M
results in formation of covalent bonds with the protease. Inactivation of the protease occurs in
the lysosome of cells after uptake of the A2M-protease complex. The major A2M receptor in
the brain is the low density lipoprotein receptor-related protein, LRP-1 [142].
Although A2M can complex with A, and A2M is a ligand for LRP-1, A2M blocks
rather than enhances the transport of A from brain to blood. A can also bind to LRP
directly. In APP transgenic mice that are receptor-associated protein (RAP)-deficient, the
expression level of LRP-1 is reduced and the extracellular A deposition increased [277].
The LRP mediated transport of A is responsible for the major part of A clearance from
brain to blood at brain capillaries [23,57].
Transport across the BBB is approximately 2-fold faster for A40 than for A1-42 [23].
When complexed to A2M the elimination of A -activated A2M complexes was reduced by
165
84.0% compared with that of A140 alone [126]. Although conflicting reports have
appeared, polymorphisms in the 2-macroglobulin gene A2M were found to be associated
with increased A deposition and suggested to constitute a risk factor for late onset AD
[142,236]. Genetic variation in both A2M and its receptor LRP have been linked with
Alzheimer's disease, although these associations could not be confirmed in a meta-analysis
[26].
Expression of LRP-1 and also LDL-receptor on human brain pericytes (HBP) and
smooth muscle cells (SMC) increases in the presence of A in vitro [293]. Cultured HBP and
SMC internalize A and the uptake can be inhibited by RAP (receptor associated protein)
indicating that A uptake is LRP or LDLR mediated. Higher concentrations of A result in
degeneration of the perivascular cells, suggesting that accumulation at the cell surface as
result from a saturated clearance system may lead to degeneration of the cells. Such a
mechanism can explain the accumulaton of A in vessel walls and the subsequent
development of cerebral amyloid angiopathy (CAA) [293].
Apolipoprotein E
Apolipoprotein E (apoE), is a 34-kDa cholesterol transport glycoprotein. There are three
human apoE isoforms, termed E2, E3, and E4. The epsilon4 allele of apolipoprotein E is the
strongest genetic risk factor for sporadic AD and CAA [261]. Like A2M, apoE is a ligand for
LRP-1. In the brain, apoE is associated with cholesterol-rich lipoproteins and is involved in
the transport of cholesterol to neurons. ApoE is synthesized and secreted by astrocytes and
microglia and possibly also by neurons. ApoE can immunohistochemically be detected in all
types of A deposits in AD, as well as non-demented control neocortex [311].
Clusterin
Clusterin (apoJ) is a multifunctional disulfide linked heterodimeric glycoprotein, which
is widely distributed. In AD brain, clusterin is found associated with A plaques [311] and
clusterin levels are increased in both cortex and hippocampus, but not cerebellum [159].
Astrocytes and hippocampal neurons express clusterin mRNA, and clusterin mRNA
expression is increased in a variety of injury models, as well as in AD and CJD brain [207].
Increased clusterin expression has been found in some post-mortem Downs syndrome (DS)
cases less than 30 years of age, and all specimens from older DS [257], suggesting a disease
stage dependent expression.
Clusterin can alter the aggregation of A1-42. Possibly, interaction of clusterin with
oligomeric A inhibits the nucleation stage of A. This results in the formation of slowly
sedimenting, non-fibrillar, diffusible and SDS-resistent complexes of A that are toxic to
mature neurons at nanomolar concentrations in vitro [202] and in vivo [61]. These Aderived diffusable ligands (ADDLs) inhibit hippocampal long-term potentiation in
experiments on rat hippocampal slices, indicating an immediate impact on signal transduction
[144]. Thus, clusterin may by keeping the A non-fibrillar and diffusable, enhance Ainduced neurotoxicity. However, clusterin may also exert beneficial effects on neurons,
because clusterin is rapidly transported across the BBB via LRP2, and A1-42 clearance
from the brain is significantly enhanced when the A1-42 is complexed with clusterin [23].
166
Thus, clusterins ability to efficiently transport A1-42 from brain to blood across the
BBB, suggests that the enhanced expression of clusterin in affected brain regions probably
serves a protective role.
Protease Inhibitors
Several proteases and protease inhibitors have also been demonstrated in the amyloid
lesions of AD. These include the serine protease inhibitor and acute-phase reactant -1antichymotrypsin (ACT) and the cysteine proteinase inhibitor cystatin C.
1-Antichymotrypsin
1-antichymotrypsin (ACT) is a serine proteinase inhibitor (serpin) that forms complexes
with and inactivates neutrophil-derived cathepsin G, thereby limiting tissue damage during
inflammatory reactions. The complexed ACT found in A plaques [229,278] probably
originates from local production by astrocytes [3,208]. The ACT in plaques that expresses
neoepitopes specific for complexed ACT, may be bound to a serine proteinase presumably
involved in the APP metabolism. Indeed, a serine proteinase, involved in the degradation of
the A-peptide, was found complexed to ACT, but still remains to be identified [4,5,301].
ACT can also directly interact with A-peptides, and ACT dose dependently enhances A
fibril formation in vitro (Nielsen et al, in prep). Binding of ACT to A can transform the
ACT from an inhibitor into a substrate [128].
Involvement of ACT in APP metabolism was further indicated by studies in double
transgenic mice expressing human APP and ACT, that develop amyloid depositions more
rapidly than the single APP transgenic mice [188,195].
Cystatin C
Another protease inhibitor found associated with A deposits, in plaques as well as
CAA, in AD brain is cystatin C, a cysteine protease inhibitor [151]. In vitro cystatin C colocalizes with APP intracellularly and on the cell surface and cystatin C was found to inhibit
A fibril formation [235]. A role for Cystatin C in amyloid deposition was implicated when a
mutated form was found to be linked with hereditary cerebral haemorrhage with amyloidosis,
Icelandic type [99,150], and overexpression of cystatin C lead to reduced levels of A
deposition in APP transgenic mice [134]. Cystatin C gene polymorphisms resulting in
reduced cystatin C secretion were found to increase the risk to develop AD in meta-analyses
[25].
Chemokines
Chemokines are a family of small molecular weight proteins that function in leukocyte
recruitment and cellular activation and are subdivided into four classes, C, CC, CXC and
CX3C. Members of the CXC family include SDF-1 (CXCL12), interleukin-8 (CXCL8),
interferon-c-inducible protein-10 (IP-10, CXCL10) and macrophage inflammatory protein-2
(MIP-2, CXCL2). The CC family includes monocyte chemoattractant protein-1 (MCP-1,
CCL2), macrophage inflammatory protein-1 and (MIP-1 and , CCL3 and CCL4,
respectively), and regulated upon activation normal T cell expressed and secreted (RANTES,
CCL5) (for a review see: [17]). Studies in APP transgenic mice that are deficient for CCR2,
167
the receptor for MCP-1, indicate that CCR2 is important for microglial migration and
accumulation at sites of A deposits, as CCR2 deficiency impaired microglial accumulation,
resulted in earlier A deposition, and accelerated early disease progression in this transgenic
mouse model for AD[74]. CCR1, the receptor for CCL3/MIP-1, can be found in dystrophic,
neurofilament-positive, synaptophysin-negative neurites that are associated with senile A142 plaques, not in diffuse deposits of A1-42 in a small sample of AD cases. Astrocytes and
microglia are negative for CCR1[105], whereas microglia express other chemokine receptors
CCR3 and CCR5 [297].
The number of CCR1-positive plaque-like structures in the hippocampus and entorhinal
cortex highly correlated with the clinical dementia state. CCR1 is rarely seen in nondemented
control brain, and not in other types of dementia, unless A42-positive plaques are also
present. Therefore, neuronal CCR1 seems to be part of the neuroimmune response to A in
A42-positive neuritic plaques, and CCR1 may be a specific marker for this process instead
of being a generalized marker of neurodegeneration. [105].
Microglia
Clusters of activated microglia are observed in fibrillar A plaques that are associated
with neuritic changes [8,70,101,165,230]. In more recent studies in post mortem brain tissue
of clinically well evaluated patients the increase in fibrillar amyloid deposits and associated
micoglia in the neocortex was shown to be already prominent in cases with early stages of
AD that have no extensive tau-related neurofibrillary pathology [13,282]. These findings are
in agreement with a positron emission tomograpy study using the peripheral benzodiazepine
ligand PK11195 as marker for activated microglia [45], in which activation of microglia was
found to precede brain atrophy, as detected by MRI, in AD patients. Similarly, in scrapieaffected mice the microglial activation occurs many weeks before neuronal loss and
subsequent clinical signs become apparent [294].
The activated microglia seen clustered in fibrilar A plaques have an amoeboid
phenotype and express MHC class II, and express receptors specific for C4 and C3 activation
products (complement receptors CR3 and CR4) [230], specific for C1q [291], as well as
chemokine receptors CCR3 and CCR5 [297]. Besides, activated microglia express the proinflammatory cytokine interleukin-1 [101] and the chemokine monocyte chemoattractant
protein-1 (MCP-1, CCL2) [124].
A wealth of data indicates now the extracellular deposition of A in AD brains as one of
the triggers of inflammation. In vitro A was found to stimulate chemokine production by
cultured microglia [260]. A can activate microglia by binding to the receptor for advanced
glycation end products (RAGE) [166,302] and to other scavenger receptors [73,204].
Furthermore, the LPS receptor, CD14, interacts with fibrillar A [80] and microglia kill A142 damaged neurons by a CD14 dependent process [20]. Also the Toll-like-receptor 4
(TLR4), that is expressed on microglia, may be relevant in chronic neuroinflammation in AD.
A functional tri-molecular receptor complex consisting of CD14, TLR4 and MD-2 appears to
be needed for microglial activation by A, and the subsequent release of neurotoxic
mediators [288]. The involvement of CD14 and TLR4 in A induced microglia activation
strongly suggests that innate immunity is linked with AD pathology.
168
169
do not act as a carrier proteins for A140 elimination from the brain. In recent rat studies all
three isoforms of apoE were found to reduce the elimination rate of radiolabelled A140
from the brain [126], suggesting that apo E is not involved in the efflux of A from the brain
but acts as a promotor of cerebral A accumulation. These findings are in line with the
conclusion from an earlier study with transgenic mice expressing human APP that were
crossed with either apoE expressing or apoE knock-out mice. APPV717F+/- apoE+/- and
apoE+/+ mice had abundant amyloid deposits, whereas APPV717F+/- apoE-/- mice had no
amyloid deposits up to 22 months of age [18]. In hAPP transgenic mice without apoE(-/-) and
clusterin(-/-), apoE and clusterin had additive effects on A deposition and apoE was found
to play an important role in regulating extracellular CNS A metabolism independent of A
synthesis [60]. These mouse studies indicate that certain amyloid associated factors are
involved in regulation of the A amyloidogenic process through effects on A aggregation or
A transport.
Clusterin
In transgenic hAPP mice crossed with clusterin (-/-) mice the levels of A deposits are
similar to these in hAPP mice expressing clusterin, but there are significantly fewer fibrillar
A deposits. In the absence of clusterin, neuritic dystrophy associated with the deposits
amyloid is markedly reduced. This suggests that clusterin binding to A may, in addition to
its solubilizing effects and role in A transport from brain to blood, enhance the A mediated
neuritic dystrophy [61].
Clusterin was found to play a more prominent role in A transport than ApoE, when the
effect of both on A accumulation in the brains of APP transgenic mice either knockout for
apoE or clusterin, or for both was studied. Less A fibrils and A plaques were seen when
clusterin was present, compared to apoE [60,113]. These observations in transgenic mouse
models support the idea that A-associated proteins play an important role in the dynamic
balance between A deposition and removal and may determine the neurotoxic potential of
A.
170
receptor VLA-6 [72]. In the cerebral cortex of non-demented cases, neurites associated with
congophilic amyloid plaques immunostain for the growth-associated proteins, but are
negative for tau [311].
The major players involved in the inflammatory process in AD are thought to be the
microglia and the astrocytes. The process of the activation of glia is characteristized by
upregulation or de novo expression of a variety of molecules involved in the inflammatory
response including cytokines, various components of the complement cascade, acute phase
reactants, proteases and protease inhibitors, and neurotoxic products including reactive
oxygen species. The importance of inflammation in the pathogenesis of AD was indirectly
confirmed by epidemiological investigations that revealed a decreased incidence of AD in
subjects using anti-inflammatory drugs, especially the non-steroidal anti-inflammatory drugs
(NSAIDs). However clinical trials designed to inhibit inflammation have failed in the
treatment of AD patients suggesting that anti-inflammatory agents have more protective than
therapeutic effects.
Astrocytes can produce the neurite growth promoting cytokine S100B, which during
normal aging may serve a protective role, as it promotes neuronal survival and neuritic
growth [187]. However, in AD the fibrillar A plaques are also characterized by activated
complement factors and clustering of microglia [70] that express IL-1, which in turn induces
astrocytes to produce S100B. Astrocytic overexpression of S100B in neuritic plaques
correlates with the degree of neuritic pathology, which suggests that S100B acts as a
promoter in the evolution of benign, non-neuritic to neuritic A plaques in AD [187].
A role for protease nexin 1 (PN-1) as regulator of neurite initiation and continued
outgrowth has been proposed. Trombin-PN-1 complexes accumulate in AD brain and a shift
in balance between proteases and protease inhibitors has been impicated in AD. PN-1 is a
potent physiologic inhibitor of thrombin and urokinase (uPA) in the basement membrane,
when bound to collagen type IV and other matrixcomponents. Complexation of thrombin
with PN1 enables the binding to cell-surface heparins, and subsequent internalization by
astrocytes. Internalisation is via LRP, and can be inhibited by RAP (receptor associated
protein) in vitro [180]. When bound to collagen type IV PN1 may play a key regulatory role
in the uPA receptor-mediated activation of signaling pathways that control cell migration
during tissue repair/remodeling [53]. Taken together, these findings indicate that the fibrillar
A deposition is associated with both an aberrant regenerative response of sprouting neurons
[14,52] and a microglia mediated neuroinflammatory response.
Using postmortem brain specimens, characterized according to the Braak score for
pathological staging of AD [36], we have studied the sequence of different pathogenic
mechanisms in the isocortex, including neuronal cell cycle changes, activation of the
unfolded protein response, oxidative stress and inflammation (Figure 2). Although the Braak
score does not represent a temporal scale, the Braak score for neurofibrillary changes
correlates well with the clinical course of AD determined by the cognitive status [222], which
suggests that the pathological changes indeed reflect the temporal sequence of events in the
pathogenic cascade. Increased neuronal cyclo-oxygenase-2 (COX-2) and cell cycle protein
expression and activation of the unfolded response were seen in a relatively early stage of
pathology (Braak stage III -IV), associated with diffuse (low-fibrillar) A plaques. The
maximal expression of COX-2 and cell cycle proteins, including phosphorylated
171
172
findings from four different prospective case-cohort studies show that non-demented subjects
with increased serum levels of certain acute-phase proteins are at risk of developing AD
[63,77,239,298,299]. These epidemiological data support the idea that inflammation-related
mechanisms could contribute to the multifactorial etiology of the sporadic late-onset form of
AD.
4. EARLY DIAGNOSIS OF AD
The diagnosis AD is made by exclusion and based on clinical criteria, combined
neuropsychological testing, the use of patient history, brain imaging and extended follow up.
Techniques that are now used to recognize clinical phenotypic markers include magnetic
resonance imaging (MRI) with which hippocampal and medial temporal lobe atrophy (MTA)
can be seen, positron emission tomography (PET) imaging to visualize molecular changes as
a result from hypometabolism and /or hypoperfusion in temperoparietal areas and to visualize
amyloid deposits and activated microglia, as well as measurements of biomarker levels in
cerebrospinal fluid (CSF).
Although AD can be diagnosed with a relatively high sensitivity at expert academic
research centers, a definite diagnosis can only be made upon post mortem examination of the
brain.
One of the problems encountered is, that pure AD is relatively uncommon, as was
concluded from community based as well as clinico-neuropathological studies in which the
diagnostic accuracy was neuropathologically confirmed [129,131,141,211]. In a retrospective
clinico/pathological study including 1050 elderly demented, 62.9% of the cases was
clinically diagnosed as probable-possible AD, whereas at autopsy, 86% of the cases had AD
related pathology, of which 42.8 % were pure AD, 22.6 % AD and vascular lesions and 10.8
% AD with Lewy body pathology [129]. In a large longitudinal community-based study, at
autopsy cerebral microinfarcts, followed by AD and neocortical Lewy bodies were found to
be predominant pathological correlates of dementia in an US suburban and urban elderly
population [256].
Similar findings were obtained in a community based study in which 34 amnestic MCI
cases, that progressed to clinical dementia were followed up prospectively. At autopsy the
majority appeared to have progressed both clinically and pathologically to AD. However, 28
of the 34 cases had complex neuropathologic findings including 2 or more distinct pathologic
entities contributing to dementia. Argyrophilic grain disease was present in 53% of 34
amnestic MCI cases, microvascular disease in 35%, and Lewy body disease in 26% of the
cases [132]. However, the majority of community-dwelling older persons have brain
pathology, and argyrophilic grain disease also occurs in 30% of aged controls. Therefore, it
can be expected that also most AD and MCI cases at advanced age have secondary
contributing pathologic abnormalities [132].
In contrast to advanced stages of the disease, that can be diagnosed with high certainty,
reliable techniques that detect brain changes in the earliest stages of cognitive decline, so that
people at risk can be identified and effects of drugs to stop or slow the progression of
Alzheimers can be monitored, are still not available. The challenge is to distinguish
173
preclinical AD from changes of normal ageing or established AD. Mild cognitive impairment
(MCI) is a clinical entity, describing patients with subjective and/or objective cognitive
complaints and mild functional disabilities, but no dementia. MCI is considered to be a
transitional state between normal ageing and dementia, but it is an aetiologically
heterogeneous syndrome. Therefore, a correct prediction of MCI conversion to Alzheimer's
disease (AD) represents a primary goal in the diagnosis of dementia.
MRI
The degree of hippocampal and medial temporal lobe atrophy (MTA) as seen on MRI is
an early and sensitive marker for AD that presumably reflects neuronal loss in hippocampus
and the temporal lobe and correlates with disease progression [232,285].
Positron Emission Tomography (PET)
Decreased glucose metabolism as detected with 2-fluoro-2-deoxy-d-glucose ([18F]-FDG)
PET was shown to be sensitive and specific in detecting early stages of AD [247].
PET, using radiotracers with high affinity for A in plaques, such as the positron emitter
C-11 labelled Pittsburgh compound B (PIB) [139], or the [F18]- radiofluorinated FDDNP
[252], seem promising. In addition, the 11C-radiolabeled isoquinoline PK11195, that binds to
peripheral benzodiazepine binding sites, is used to visualize microglial activation and
clustering. Follow-up investigations of AD patients after one year demonstrated that the
regional increase in PK11195 binding in the temporal lobe and hippocampus seen on PET
scans preceded atrophy, as determined by MRI, in AD [45], which is in line with what can be
observed immunohistochemically in post mortem brain slices [13,234,279,281].
CSF
Diagnostic markers for AD can be divided into two groups: state markers, reflecting the
disease process, and stage markers, reflecting the severity of disease [29]. The biomarkers
A42, t-tau and p-tau are state markers, their levels are expected to be altered well in advance
with respect to clinical symptoms and change little over time [35]. The imaging techniques
can be used for differential diagnosis as well as for stageing disease progression.
In summary, brain atrophy as determined by MRI and decreased glucose metabolism as
seen with PET are not specific for AD (for review see [65]), neither are A accumulation and
microglial activation seen with PET and the CSF biomarkers A and tau. For stage markers it
is not problematic if they are not specific for the disease as long as their values correlate with
disease advancement, and as long as the clinical diagnosis is firm. This implies that a
combination of neuropsychological testing, imaging techniques, as well as selected
biomarker profiles may improve early and specific diagnosis of AD and can be used for
monitoring the course of AD and thus may be relevant to evaluating clinical trials.
174
175
was first investigated and specific tests detecting A1-42, total tau (t-tau) and
hyperphosphorylated tau (p-tau) in CSF were developed. CSF levels of A and p-tau were
shown to reflect the central pathogenic process of A accumulation in plaques and of tau
related neurodegenerative changes. However, the use of such determinations suffers from a
lack of specificity. Whereas A1-42 concentration in CSF of AD cases is low compared to
controls, also decreased levels of A1-42 are seen in DLB, FTLD and vascular dementia
cases. Raised t-tau levels are also not specific for AD. Tau levels can also be increased in
DLB and FTLD, and are very high in CJD.
When A1-42 and p-tau measurements are combined, AD can be discriminated from
non-demented [120,241]. Moreover, MCI cases that will develop AD can be distinguished
from those that will not progress with high sensitivity (>90%) and specificity (>85%) in
follow-up studies [108,205], indicating the usefulness of CSF markers as diagnostic tool.
Nevertheless, an optimal biomarker for AD, that has sufficient specificity and sensitivity as
biomarker for individual subjects, still does not exist. This may partly be due to co-morbidity
that cannot accurately be assessed upon clinical investigation, as was shown in combined
clinicopathological (post mortem verification with immunohistochemistry) studies [129].
The biomarkers A42, h-tau and p-tau are state markers that reflect the disease process.
Therefore there is a search for new biomarkers, next to A, tau and p-tau, not only for the
diagnosis at the individual level, but especially for markers that reflect the disease stage and
can be used for monitoring effects of therapeutics.
5.2. Search for new Biomarkers for AD
1. At DNA /RNA Level
Mutations in the APP gene and in the presenilin 1 and 2 genes (APP, PSEN1, PSEN2),
that are directly associated with the amyloid cascade, explain major part of the early onset
AD families. Rare autosomal dominant mutations that are causative for early onset AD, are
present in less than 5% of the Alzheimer's disease population.
Late onset AD (LOAD) has a multifactor etiology, with more than 200 genes that are
potentially associated with AD pathogenesis and neurodegeneration.
Genotype-phenotype correlation studies and functional genomics studies have revealed
the association of specific mutations in primary loci and/or APOE-related polymorphic
variants with the age of onset, brain atrophy, cerebrovascular haemodynamics, brain
bioelectrical activity, cognitive decline, apoptosis, immune function, lipid metabolism
dyshomeostasis, and amyloid deposition in AD [42].
Polymorphism in Apolipoprotein E encoding gene (APOE) is up to now the only
polymorphism that is highly replicably associated with the risk to develop LOAD. The
epsilon4 allele of APOE represents a major risk factor for more than 40% of patients with
dementia.
Approaches to find new genes or polymorphisms in genes associated with AD are
linkage studies and the search for polymorphisms in factors already known to be associated in
various processes in the pathogenesis. Polymorphisms in IL1A, IL1B, IDE (insulin-degrading
enzyme), SORL1 (a member of the LDL receptor family) and ACT genes, for example, have
been reported to influence risk for AD, age of onset and modification of disease progression.
176
Another approach is the genome wide analysis to find factors that increase the hazard of
developing AD, or to perfom DNA microarrays to identify changes in the brain of MCI cases,
compared to controls and AD at the RNA level [206]. Gene expression profiling in AD
hippocampus by DNA microarray showed overexpression of genes associated with
inflammation (NF-B, IL-1, CCL20,complement factors C4A and C4B) as well as of APP
and COX-2, whereas a number of neurotrophic and transcription factors were downregulated
[50].
Because the human genome comprises only a limited number of genes, and those
associated with the disease can only to some extent explain the susceptability for AD,
modifications at the transcriptional, translational and post translational level probably are the
major determinants. Therefore, comparison of gene and protein expression profiles may be
the approach of choice.
2. At Protein Level
Protein biomarkers and patterns of protein biomarkers may provide potential for
diagnostics, intelligent drug design and intervention monitoring.
One approach is to identify disease biomarkers upon quantification of a global pattern of
proteins and peptides in serum or CSF of AD and controls. The most used techniques for
protein profiling and identification of potential markers are 2-D gel electrophoresis and the
protein chip arrays on which bound proteins are detected by a mass spectrometer and
identified (surface enhanced laser desorption ionization (SELDI)- time of flight (TOF) mass
spectrometry (MS) system). SELDI-TOF MS allows rapid protein profiling as well as
identification and characterization of novel protein biomarkers [206].
Although these techniques are powerful protein profiling tools, they do not allow
profiling of the whole proteome for potential biomarkers, and thus a combination of
(complementary) techniques is necessary. However, when a specific question is if a specific
isoform pattern is involved, there is no need to cover the whole proteome, and focussed or
targetted proteomics may be used.
Difficulties encountered with the identification of protein biomarkers for a disease in
biological fluids are, that newly translated proteins are extensively modified (glycosylation,
phosphorylation, proteolytic processing) which determines their functional activity, and that
detection of many low abundant proteins in CSF and serum is hampered by the presence of
highly anbundant proteins (albumin, immnoglobulins, beta-trace protein etc). Especially
searching for plasma biomarkers for AD is hampered, because levels of proteins of interest
are much lower in plasma than in CSF (blood brain barier), whereas the levels of high
abundant proteins are much higher in plasma than CSF.
To improve the detection of low-abundant proteins, methods (organic solvent
precipitation, affinity dye based depletion, ultrafiltration, size-exclusion chromatography) are
used to remove these proteins or only the high molecular weight proteins from the sample.
Another approach is to enrich for the low-abundance proteins / peptides of interest in CSF or
serum by immunoprecipitation (IP) or affinity chromatography. The selective capturing of a
specific protein/peptide with antibodies in combination with mass spectrometry (IP-MS) is
most used, however also a class of proteins, such as phospho-proteins can be captured. An
advantage of this technique over depletion of high abundant proteins is, that with depletion,
177
the peptides/proteins of interest may be lost, when these are associated with the high
abundant carrier proteins. Even, in a recent study the binding of various factors to albumin
was used to analyze the albumin enriched low molecular weight proteome in serum, which
resulted in the identification of three peptides/proteins as potential biomarkers [98].
Most proteomic studies to identify biomarkers for AD have used an unbiased approach
using 2D- gels and MALDI TOF (matrix-assisted laser desorption/ionisation- time of flight),
or searched for specific markers with SELDI-TOF MS. Stable isotope labeling is now also
applied to detect and identify proteins that are expressed differently in AD and controls
[2,313].
By now (see the elegant and comprehensive overview on biomarker discovery in
neurodegenerative diseases by Zetterberg et al [309]) in a large number of studies, a number
of factors that are either up- or downregulated or of which certain isoforms or splice products
are detectable, have been reported. These include different N-truncated A forms, as well as
different isoforms of apoE and apoA and complement factors (see Tabel 1).
Of interest is that with use of a combination of techniques (separation of serum proteins
with LC and 2D-gels and identification with MALDI TOF and ion-trap MS) several
inflammation related proteins, including protein factors C4 and C3 and factor H, a cofactor
for inactivation of activated C3, are found upregulated in serum of AD compared to controls
[121,314]. Polymorphism (Y402H) in Factor H has been associated with age-related macular
degeneration, and recently also with AD [310], the pathologies of which are both associated
with A deposition [133] and APOE polymorphism [16].
Using the SELDI TOF approach 15 biomarkers could be selected from CSF that could
distinguish between patients with stable MCI and patients with MCI who progressed to AD.
Regression analysis was used to determine the best combination of markers for distinguishing
AD from CTL. The resulting multi marker model consisted of Cystatin C, N-terminally
truncated cystatin C, A1-40, C3a anaphylatoxin des-Arg) and an unidentified 4,0 kD peak,
combined with ELISA data for A1-42 and Tau [248]. Interestingly, this set contains some
factors (cystatin C and complement activation products) already known from
immunohistochemical and animal model studies to be of interest.
The approach chosen, at least in part, seems to determine the kind of biomarkers
evolving from the search. For example, the combination of 2-D gels and MS in one study
yielded five proteins differentially-expressed in AD and controls. Apo A-1, cathepsin D and
transthyretin (TTR), were significantly reduced in AD, whereas hemopexin (HPX) and two
pigment epithelium-derived factor (PEDF) isoforms were increased in AD CSF [47].
In another study, 2-D difference gel electrophoresis (2-D DIGE) was used to identify
candidate markers differentially-expressed in individual CSF samples from subjects with very
mild dementia (believed to be clinically due to AD) and controls after depletion of highabundant proteins, yielded 11 spots. Upon identification by MS/MS Cystatin C,
Prostaglandin D2 synthase, 2-microglobulin, GP-39 cartilage protein and thioredoxin were
found to be increased, and 1-glycoprotein decreased in the very mild demented group [119].
Differences between the latter studies may be due to the different stage of the disease process
(mild demented versus advanced AD stage), or to the technical approach. Removal of
abundant proteins may also lead to loss of factors of interest that may co-precipitate or copurify with these proteins.
178
Limitations of 2-D gels are, that only a limited number of spots can be matched across a
large number of gels / images, due to inconsistency of the 2-D gel methods resulting in image
artifacts, such as inadequate resolution, vertical and horizontal streaking, and particularly,
local geometric distortions. Intrinsic to the 2-DE-based methodology is the separation of
multiple isoforms for each protein, which implies that changes in abundance for a protein
spot do not necessarily correlate with the change in total abundance of the corresponding
protein [119]. The application of orthogonal methodologies, such as ICAT and the newly
developed ITRAQ (i.e. an amine-reactive isobaric tagging reagent-based protein
quantification method) [2,313] may prove to be the most powerful discovery approach for
AD biomarkers [119].
179
the Fc part of IgG1, that is used as TNF inhibitor for treatment of rheumatoid arthritis.
Although the study in AD patients was an open-label study, and the findings need to be
replicated in randomized, placebo-controlled clinical studies, these findings suggest that
lowering CSF TNF levels may reverse the cognitive decline to some extent and at least
temporarily.
Table 1. Possible markers for AD: inflammation related and/or amyloid associated
proteins
FAMILY /
PROTEIN
REGULATION
AD VS
CTL
CSF
Detection method
ImmunoProteoassay
mics
Other
Serum
Detection method
ImmunoProteoassay
mics
Other
Complement
C1q
C3 (b/c)
C3a des Arg
C4(b/c)
C4a des Arg
C4bp
Factor H
Pentraxins
Serum
amyloid P
=
+
=
+
=
+
=
+
=
=
+
+
=
C-reactive
protein
[253]
[189]
[37]
[100]
[147,209]
[82]
[248]*
[163]
[82]
[100]
[147,209]
[248]
[271]
[271]
[82]
[121]
[110]
[198]
[136,189,
284]
[64,103,157
,307]
[55,154]
=
Protease
inhibitors
ACT
AAT
Neuroserpin
Cytokines/
Chemokine
s
TNF-
[58,109,156
, 193]
[59,146,212
]
[193]
+
=
[59]
[193]
[265]
[221]
[152,1
74]
[216]
[246]
[140]
[58,87,112,
154,156,15
7,193,289]
[9,12,40,
173,174,
203]
[146,212]
[143,143]
[168]
[306]
[155,156,
193]
[100,292]
[12,173]
[10,32,81,
317]
[218]
[11,43]
180
Table 1. (Continued)
FAMILY /
PROTEIN
REGULATION
AD VS
CTL
=
IL-1
Cytokines/
Chemokine
s
IL-6
TGF-
MCP-1
IP-10
Apo
lipoprotein
s
ApoE
+
=
+
=
[157,317]
[31,130,171]
[300]
[15,76,94,
107,146,172,
221]
[167,249]
[221]
[15,31,32,14
6,317]
+
=
[89,91]
[90]**
[86,161,
181,267]
[111,149]
[246]
[62,148,182,
185,226,286]
[194]
[104]
+
=
[44]
[56,146,212,
265,305]
[28]
Other
Serum
Detection method
ImmunoProteoassay
mics
[56,146,305]
[146,265]
[76,171,212]
+
=
+
=
ApoJ
CSF
Detection method
ImmunoProteoassay
mics
[28,76,94,
146]
[31]
Other
[11,219]
[233]
[24,44,
164]
[170]
[48]
[184]
[223]
[89-91]
[122]
[88]**[89,
91]
[89,91,92]
[54,216]
[263]
[30,14
5,251]
[190]
[85,226,238]
[246]
[216]
[160]
Listed are references describing the detection of various inflammation related factors in either CSF or
serum / plasma of AD cases and non-demented controls. Indicated is, if the levels of respective factors
are increased (+), decreased (-) or equal (=) in AD CSF or serum / plasma compared to that of controls,
in either conventional immunoassays (i.e. ELISA, RIA), proteomics (i.e. 2-DGE; SELDI-TOF-MS), or
other techniques.
* in MCI patients who progressed to AD; ** in severe AD patients, however elevated in patients with
mildly impaired AD.
181
with MCI cases, those that progressed to AD had lower levels of TGF-1 at baseline than
controls or non-progressors, suggesting a propensity to a pro-inflammatory state at the time
of progression from MCI to AD [264] that in later stages is restored by upregulation of TGF1 levels. This would fit with the ideas emerging from the immunohistochemical studies in
post mortem brain, where the inflammatory state associated with microglial activation seems
to subside beyond the Braak IV stage of moderate AD (Figure 2).
6.2. Chemokines
Chemokines and chemokine receptors comprise a large number of molecules implicated
in a wide range of physiological and pathological functions. Because of its induction or
upregulation during CNS pathologies, members of the chemokine system might be useful as
biomarkers. Especially IP-10 (interferon--inducible protein 10), may be a candidate, since
CSF IP-10 is significantly increased in patients with MCI and mild AD, compared to
controls, but not in patients with severe AD (Mini-Mental State Examination score <15). In
contrast, MCP-1 and IL-8 CSF levels are increased in MCI as well as in different stages of
AD, and correlate with age, whereas IP-10 levels do not [90]. CSF levels of MCP-1 increase
with age in all groups, but do not distinguish AD patients from healthy controls in other
studies [28,91]. Combined, these findings indicate that IP-10 may be used as a stage marker
for AD progression [90]. MCP-1 and IL-8 may be of limited use as CSF biomarker.
182
improve the diagnostic classification of AD versus dementia with Lewy bodies. A logistic
regression model based on CSF ACT, neuroserpin, and A1-42 discriminates AD patients
from controls with a sensitivity of 94.7% and a specificity of 77.8% [193], which is
comparable in sensitivity and specificity to the standard markers A42 and tau.
A PLAQUE TYPE
Immuno
staining
NON-FIBRILLAR
FIBRILLAR (neuritic)
A
Irregular
shaped,
diffuse
Circumscript
(welldemarcated)
-/
CCR1
-/
+
-
Tau (AT8)
Clustered
microglia
SAP
C1q
C4d
C3d
C5b-9
C4bp
ApoE
Apo J
ACT
A2M
Neuroserpin
Classic with
dense core
core
corona
++
++
++
++
+
++
+
+
+
+
+
+
+
+
+
++
Primitive
neuritic
plaque
+
+
+
+
+
+
+
+
+neurites
+ neurites
+neurites
+neurites
+ neurites
+neurites
++
183
CSF levels of the amyloid associated factors C1q and SAP have also been investigated
for use as biomarker for AD, because these factors are associated with early stages of A
plaque development (Figure 1) and enhance the A mediated activation of microglia in vitro
[281]. C1q levels in CSF were reported to be reduced in AD patients (N=45), as compared to
a heterogeneous group of controls (N=10) (p=0.02). Moreover there was a strong correlation
between MMSE score and CSF C1q levels in AD patients [253].
O
C
C
U
R
U
N
C
E
I-II
III-IV
V-VI
PATHOLOGY
(Braak score)
Figure 2. Pathological cascade in AD isocortex. In the early stage of pathology (Braak score I-II) high
levels cell cycle proteins in neurons are observed in the temporal cortex of post mortem human brain
tissue. Involvement of extracellular or intracellular oligomeric A in these changes seen in Braak stages
I and II still remains elusive. The increased activation of the UPR in neuronal cells in the next stage
(Braak score III-IV) is likely due to the presence of oligomeric or low fibrillar forms of A. Diffuse A
deposits that are decorated with various factors (amyloid associated factors) are also observed.in this
stage. The next stage (Braak IV-V) is characterized by the increased presence of neuroinflammation and
activated microglial cells associated with fibrillar A deposits. The last stage (Braak V-VI) is
characterised by the presence of neurofibrillary tangles. (adapted from Hoozemans et al., 2006 and
Eikelenboom et al., 2006 [71,118]).
184
6.4. Isoprostanes
Unlike prostaglandines, which derive from enzymatic processing of arachidonic acid,
isoprostanes result from non-enzymatic, free radical mediated peroxidation of arachidonic
acid in membrane phospholipids. Although isoprostanes derived from arachidonic acid
185
(C20:4) are the best characterized, many other polyunsaturated fatty acids can form
isoprostanes. Peroxidation of docosahexaenoic acid (C22:6), which is abundant in brain, can
lead to formation of F4-isoprostanes or neuroprostanes, and of D4- and E4-isoprostanes.
Although other markers of oxidative stress have been studied in AD, most studies have
focused on the the F2-isoprostanes [268].
Isoprostanes are markers of oxidative stress and involved as mediators of oxidant injury
in a number of neurodegenerative disorders including AD. Isoprostanes can be detected in
plasma, CSF and urine, and the CSF levels are increased in MCI and AD [215]. The
combined determination of t-tau, A1-42 and F2-isoprostane CSF levels significantly added
to the correct diagnosis of AD [102]. As diagnostic marker isoprostanes lack specificity.
However, they may be useful as marker for progression to dementia, as was shown in a
longitudinal study. CSF A and (P)-tau levels remained more or less constant, whereas
isoprostane levels (8,12-iso-iPF2-VI) increased in MCI cases that progressed to AD during
the 2-year follow-up [41].
186
Whether systemic markers of inflammation can be used to predict the risk for cognitive
decline in old age was studied in a combined study in two independent population-based
cohort studies with a follow up of approximately 5 years. In the Rotterdam part of the study
with individuals of mean age 72 (N=3874), higher levels of CRP and IL-6 were crosssectionally associated with worse global cognition and executive function. ACT in plasma
was not associated with cognitive function. In the Leiden part of the study with individuals
over 85 years (N= 491), a similar association for CRP was found, and higher IL-6 levels were
related to a steeper annual decline in memory function in the longitudinal analysis.
Combined data from the two studies indicated that plasma levels of CRP, IL-6, and ACT
were only moderately associated with cognitive function and decline and tended to be
stronger in carriers of the APOE epsilon4 allele. It was concluded that systemic markers of
inflammation are not suitable for risk stratification [242].
Remarkably, several groups have found that plasma ACT levels are elevated in AD
patients compared with controls, and correlate with cognitive performances as assessed by
the mini mental state examination in AD patients. Our own prospective studies in elderly
indicate that plasma ACT levels constitute a risk marker for cognitive decline [63]. These
studies not only emphasize the importance of ACT in the pathogenesis of AD, but also
suggest that intracerebral levels correlate with plasma levels of ACT.
187
Initiative will be paid to how to validate the protein identifications from a proteomic
experiment. Possibly this will reduce the number of valse positive reports [309].
188
identified in pattern analysis. These included the cytokines (IL-1, IL-3, IL-11, TNF-),
chemokines (CXCL-8, CCL5, CCL7, CCL15, CCL18), adhesion factors (ICAM-1), growth
factors (ANG-2, IGF-BP6, PDGF-BB, EGF, GDNF, M-CSF, G-CSF), as well apoptosis
related factors (TRAIL-R4). With this set 89% agreement with clinical diagnosis could be
obtained from plasma samples [218]. Since future biomarker tests preferably would be
performed with easily accessable body fluids, these results obtained in plasma may pave the
way for multi-marker tests to be used in future.
9. CONCLUSIONS
The biomarkers that currently are being used in a clinical setting for diagnosis of AD, are
the CSF biomarkers A42, tau and p-tau, that are related to AD pathofysiology.
Limitations are, that variations in CSF biomarker levels are multifactorial, and the data
obtained with different tests and in different centers vary. Because of the overlap between
AD and other dementias, and the high percentage of concomitant pathologies, the accuracy of
the diagnostic markers will remain suboptimal. Despite inter- and intra- individual as well as
inter- and intra-assay variations of these CSF biomarkers, combinations of CSF biomarkers
A42, tau and p-tau, especially when standardized with external controls, are useful for the
clinical diagnosis of AD, in combination with clinical examination and imaging techniques.
Plasma markers are not necessarily related to the pathofysiology. However, measurement
requires extra technology because levels of brain derived proteins are low compared to blood
borne or liver derived proteins.
Gene arrays have yielded over 1600 differentially expressed genes, that may be candidate
markers. Future approaches that may be fruitful, may include comparing genetic profiles with
transcriptomics / proteomics.
Inflammation is involved in various, especially early steps of AD pathogenesis. Since
there is a need for early diagnostic markers for AD and certain amyloid associated factors are
very early expressed and associated with glial activation in early stages of plaque
development, some may be biomarkers for AD, especially to distinguish individuals with
age-related memory deficits from individuals (patients) at the earliest AD stage, that
clinically and with imaging techniques do not yet differ. The majority of inflammation related
factors is not specific for AD pathogenesis. Nevertheless some of these may be suited as
stagemarker to judge the progression of the disease and to evaluate the effect of treatment.
The development of stagemarkers is becoming increasingly important as diagnostic
approaches aimed at different steps in the pathogenic cascade leading to full-blown AD may
become available. These can then also be used for monitoring of therapeutic effects. In
addition to this, it now also becomes apparent that a combination of inflammation related
markers can be used for (early) diagnostics.
This is illustrated by the results of a study by Nielsen et al [193] in which combination of
measuring ACT, neuroserpin and A in CSF was equally sensitive as A and tau
measurement in discriminating AD from control. Moreover, even in plasma measurement of a
combination of 18 inflammation related markers was found to diagnose AD with high
189
sensitivity [218]. This indicates that, especially when tested in combinations, inflammatory
markers reflect early stages AD, and that these changes are even detectable in plasma.
ACKNOWLEDGEMENTS
Recent work discussed in this review was financially supported by Stichting Dioraphte
(R.V.) and by the Internationale Stichting Alzheimer Onderzoek (ISAO; grant 03509 to R.V.
and grant 04503 to J.J.M.H.)
REFERENCES
[1]
Consensus report of the Working Group on: "Molecular and Biochemical Markers of
Alzheimer's Disease". The Ronald and Nancy Reagan Research Institute of the
Alzheimer's Association and the National Institute on Aging Working Group.
Neurobiol Aging 1998; 19:109-116.
[2] Abdi F, Quinn JF, Jankovic J, McIntosh M, Leverenz JB, Peskind E et al. Detection of
biomarkers with a multiplex quantitative proteomic platform in cerebrospinal fluid of
patients with neurodegenerative disorders. J Alzheimers Dis 2006; 9:293-348.
[3] Abraham CR. Reactive astrocytes and alpha1-antichymotrypsin in Alzheimer's disease.
Neurobiol Aging 2001; 22:931-936.
[4] Abraham CR, Driscoll J, Potter H, Van Nostrand WE, Tempst P. A calcium-activated
protease from Alzheimer's disease brain cleaves at the N-terminus of the amyloid betaprotein. Biochem Biophys Res Commun 1991; 174:790-796.
[5] Abraham CR, Razzaboni BL, Sisodia SS, Koo EH, Price DL, Van Nostrand WE et al.
Studies on the proteolytic degradation of the beta-protein precursor by proteases
purified from Alzheimer's disease brain. Ann N Y Acad Sci 1991; 640:161-165.
[6] Abraham CR, Selkoe DJ, Potter H. Immunochemical identification of the serine
protease inhibitor alpha 1-antichymotrypsin in the brain amyloid deposits of
Alzheimer's disease. Cell 1988; 52:487-501.
[7] Afagh A, Cummings BJ, Cribbs DH, Cotman CW, Tenner AJ. Localization and cell
association of C1q in Alzheimer's disease brain. Exp Neurol 1996; 138:22-32.
[8] Akiyama H, Barger S, Barnum S, Bradt B, Bauer J, Cole GM et al. Inflammation and
Alzheimer's disease. Neurobiol Aging 2000; 21:383-421.
[9] Altstiel LD, Lawlor B, Mohs R, Schmeidler J, Dalton A, Mehta P et al. Elevated alpha
1-antichymotrypsin serum levels in a subset of nondemented first-degree relatives of
Alzheimer's disease patients. Dementia 1995; 6:17-20.
[10] Alvarez A, Cacabelos R, Sanpedro C, Garcia-Fantini M, Aleixandre M. Serum TNFalpha levels are increased and correlate negatively with free IGF-I in Alzheimer
disease. Neurobiol Aging 2007; 28:533-536.
[11] Alvarez XA, Franco A, Fernandez-Novoa L, Cacabelos R. Blood levels of histamine,
IL-1 beta, and TNF-alpha in patients with mild to moderate Alzheimer disease. Mol
Chem Neuropathol 1996; 29:237-252.
190
191
[27] Blalock EM, Geddes JW, Chen KC, Porter NM, Markesbery WR, Landfield PW.
Incipient Alzheimer's disease: microarray correlation analyses reveal major
transcriptional and tumor suppressor responses. Proc Natl Acad Sci U S A 2004;
101:2173-8.
[28] Blasko I, Lederer W, Oberbauer H, Walch T, Kemmler G, Hinterhuber H et al.
Measurement of thirteen biological markers in CSF of patients with Alzheimer's
disease and other dementias. Dement Geriatr Cogn Disord 2006; 21:9-15.
[29] Blennow K, Hampel H. CSF markers for incipient Alzheimer's disease. Lancet Neurol
2003; 2:605-613.
[30] Blennow K, Hesse C, Fredman P. Cerebrospinal fluid apolipoprotein E is reduced in
Alzheimer's disease. Neuroreport 1994; 5:2534-2536.
[31] Blum-Degen D, Muller T, Kuhn W, Gerlach M, Przuntek H, Riederer P. Interleukin-1
beta and interleukin-6 are elevated in the cerebrospinal fluid of Alzheimer's and de
novo Parkinson's disease patients. Neurosci Lett 1995; 202:17-20.
[32] Bonotis K, Krikki E, Holeva V, Aggouridaki C, Costa V, Baloyannis S. Systemic
immune aberrations in Alzheimer's disease patients. J Neuroimmunol 2008; 193:183187.
[33] Botto M, Hawkins PN, Bickerstaff MC, Herbert J, Bygrave AE, McBride A et al.
Amyloid deposition is delayed in mice with targeted deletion of the serum amyloid P
component gene. Nat Med 1997; 3:855-859.
[34] Bouman L. Senile plaques. Brain 1934; 57:128-142.
[35] Bouwman FH, van der Flier WM, Schoonenboom NS, van Elk EJ, Kok A, Rijmen F et
al. Longitudinal changes of CSF biomarkers in memory clinic patients. Neurology
2007; 69:1006-1011.
[36] Braak H, Braak E. Staging of Alzheimer's disease-related neurofibrillary changes.
Neurobiol Aging 1995; 16:271-278.
[37] Brachova L, Lue LF, Schultz J, el RT, Rogers J. Association cortex, cerebellum, and
serum concentrations of C1q and factor B in Alzheimer's disease. Brain Res Mol Brain
Res 1993; 18:329-334.
[38] Bradt BM, Kolb WP, Cooper NR. Complement-dependent proinflammatory properties
of the Alzheimer's disease beta-peptide. J Exp Med 1998; 188:431-438.
[39] Brendza RP, Bacskai BJ, Cirrito JR, Simmons KA, Skoch JM, Klunk WE et al. AntiAbeta antibody treatment promotes the rapid recovery of amyloid-associated neuritic
dystrophy in PDAPP transgenic mice. J Clin Invest 2005; 115:428-33.
[40] Brugge K, Katzman R, Hill LR, Hansen LA, Saitoh T. Serological alpha 1antichymotrypsin in Down's syndrome and Alzheimer's disease. Ann Neurol 1992;
32:193-197.
[41] Brys M, Pirraglia E, Rich K, Rolstad S, Mosconi L, Switalski R et al. Prediction and
longitudinal study of CSF biomarkers in mild cognitive impairment. Neurobiol Aging
2007.
[42] Cacabelos R. Pharmacogenetic basis for therapeutic optimization in Alzheimer's
disease. Mol Diagn Ther 2007; 11:385-405.
192
193
[58] DeKosky ST, Ikonomovic MD, Wang X, Farlow M, Wisniewski S, Lopez OL et al.
Plasma and cerebrospinal fluid alpha1-antichymotrypsin levels in Alzheimer's disease:
correlation with cognitive impairment. Ann Neurol 2003; 53:81-90.
[59] Delamarche C, Berger F, Gallard L, Pouplard-Barthelaix A. Aging and Alzheimer's
disease: protease inhibitors in cerebrospinal fluid. Neurobiol Aging 1991; 12:71-74.
[60] DeMattos RB, Cirrito JR, Parsadanian M, May PC, O'Dell MA, Taylor JW et al. ApoE
and clusterin cooperatively suppress Abeta levels and deposition: evidence that ApoE
regulates extracellular Abeta metabolism in vivo. Neuron 2004; 41:193-202.
[61] DeMattos RB, O'Dell M A, Parsadanian M, Taylor JW, Harmony JA, Bales KR et al.
Clusterin promotes amyloid plaque formation and is critical for neuritic toxicity in a
mouse model of Alzheimer's disease. Proc Natl Acad Sci U S A 2002; 99:10843-8.
[62] Demeester N, Castro G, Desrumaux C, De GC, Fruchart JC, Santens P et al.
Characterization and functional studies of lipoproteins, lipid transfer proteins, and
lecithin:cholesterol acyltransferase in CSF of normal individuals and patients with
Alzheimer's disease. J Lipid Res 2000; 41:963-974.
[63] Dik MG, Jonker C, Hack CE, Smit JH, Comijs HC, Eikelenboom P. Serum
inflammatory proteins and cognitive decline in older persons. Neurology 2005;
64:1371-7.
[64] Dimopoulos N, Piperi C, Salonicioti A, Mitropoulos P, Kallai E, Liappas I et al. Indices
of low-grade chronic inflammation correlate with early cognitive deterioration in an
elderly Greek population. Neurosci Lett 2006; 398:118-123.
[65] Dubois B, Feldman HH, Jacova C, DeKosky ST, Barberger-Gateau P, Cummings J et
al. Research criteria for the diagnosis of Alzheimer's disease: revising the NINCDSADRDA criteria. Lancet Neurol 2007; 6:734-746.
[66] Eikelenboom P, Hack CE, Rozemuller JM, Stam FC. Complement activation in
amyloid plaques in Alzheimer's dementia. Virchows Arch B Cell Pathol Incl Mol
Pathol 1989; 56:259-262.
[67] Eikelenboom P, Rozemuller JM, Kraal G, Stam FC, McBride PA, Bruce ME et al.
Cerebral amyloid plaques in Alzheimer's disease but not in scrapie-affected mice are
closely associated with a local inflammatory process. Virchows Arch B Cell Pathol Incl
Mol Pathol 1991; 60:329-336.
[68] Eikelenboom P, Stam FC. Immunoglobulins and complement factors in senile plaques.
An immunoperoxidase study. Acta Neuropathol 1982; 57:239-242.
[69] Eikelenboom P, van Gool WA. Neuroinflammatory perspectives on the two faces of
Alzheimer's disease. J Neural Transm 2004; 111:281-294.
[70] Eikelenboom P, Veerhuis R. The role of complement and activated microglia in the
pathogenesis of Alzheimer's disease. Neurobiol Aging 1996; 17:673-680.
[71] Eikelenboom P, Veerhuis R, Scheper W, Rozemuller AJ, van Gool WA, Hoozemans JJ.
The significance of neuroinflammation in understanding Alzheimer's disease. J Neural
Transm 2006; 113:1685-1695.
[72] Eikelenboom P, Zhan SS, Kamphorst W, van d, V, Rozemuller JM. Cellular and
substrate adhesion molecules (integrins) and their ligands in cerebral amyloid plaques
in Alzheimer's disease. Virchows Arch 1994; 424:421-427.
194
[73] El Khoury J, Hickman SE, Thomas CA, Loike JD, Silverstein SC. Microglia, scavenger
receptors, and the pathogenesis of Alzheimer's disease. Neurobiol Aging 1998; 19:S81S84.
[74] El Khoury J, Toft M, Hickman SE, Means TK, Terada K, Geula C et al. Ccr2
deficiency impairs microglial accumulation and accelerates progression of Alzheimerlike disease. Nat Med 2007; 13:432-438.
[75] Emsley J, White HE, Ohara BP, Oliva G, Srinivasan N, Tickle IJ et al. Structure of
Pentameric Human Serum Amyloid-P Component. Nature 1994; 367:338-345.
[76] Engelborghs S, De BM, De CJ, D'Hooge R, Geerts H, Verhaegen H et al. Unchanged
levels of interleukins, neopterin, interferon-gamma and tumor necrosis factor-alpha in
cerebrospinal fluid of patients with dementia of the Alzheimer type. Neurochem Int
1999; 34:523-530.
[77] Engelhart MJ, Geerlings MI, Meijer J, Kiliaan A, Ruitenberg A, van Swieten JC et al.
Inflammatory proteins in plasma and the risk of dementia: the rotterdam study. Arch
Neurol 2004; 61:668-72.
[78] Familian A, Eikelenboom P, Veerhuis R. Minocycline does not affect amyloid beta
phagocytosis by human microglial cells. Neurosci Lett 2007; 416:87-91.
[79] Familian A, Zwart B, Huisman HG, Rensink I, Roem D, Hordijk PL et al. Chromatinindependent binding of serum amyloid P component to apoptotic cells. J Immunol
2001; 167:647-654.
[80] Fassbender K, Walter S, Kuhl S, Landmann R, Ishii K, Bertsch T et al. The LPS
receptor (CD14) links innate immunity with Alzheimer's disease. FASEB J 2004;
18:203-205.
[81] Fillit H, Ding WH, Buee L, Kalman J, Altstiel L, Lawlor B et al. Elevated circulating
tumor necrosis factor levels in Alzheimer's disease. Neurosci Lett 1991; 129:318-320.
[82] Finehout EJ, Franck Z, Lee KH. Complement protein isoforms in CSF as possible
biomarkers for neurodegenerative disease. Dis Markers 2005; 21:93-101.
[83] Fischer O. Miliare nekrosen mit drusigen Wuchurungen der Neurofibrillen, eine
regelmassige Veranderung der Hirnrinde bei seniler Demenz. Monatsch fur Psychiatrie
und Neurologie 1907; 22:361-372.
[84] Fonseca MI, Zhou J, Botto M, Tenner AJ. Absence of C1q leads to less neuropathology
in transgenic mouse models of Alzheimer's disease. J Neurosci 2004; 24:6457-6465.
[85] Fukumoto H, Ingelsson M, Garevik N, Wahlund LO, Nukina N, Yaguchi Y et al.
APOE epsilon 3/ epsilon 4 heterozygotes have an elevated proportion of apolipoprotein
E4 in cerebrospinal fluid relative to plasma, independent of Alzheimer's disease
diagnosis. Exp Neurol 2003; 183:249-253.
[86] Fukuyama R, Mizuno T, Mori S, Yanagisawa K, Nakajima K, Fushiki S. Agedependent decline in the apolipoprotein E level in cerebrospinal fluid from control
subjects and its increase in cerebrospinal fluid from patients with Alzheimer's disease.
Eur Neurol 2000; 43:161-169.
[87] Gabriel SM, Marin DB, Aisen PS, Lantz M, Altstiel LD, Davis KL et al. Association of
elevated alpha 1-antichymotrypsin with cognitive impairment in a prospective study of
the very old. Am J Psychiatry 1998; 155:698-700.
195
[88] Galimberti D, Fenoglio C, Lovati C, Venturelli E, Guidi I, Corra B et al. Serum MCP-1
levels are increased in mild cognitive impairment and mild Alzheimer's disease.
Neurobiol Aging 2006; 27:1763-1768.
[89] Galimberti D, Schoonenboom N, Scarpini E, Scheltens P. Chemokines in serum and
cerebrospinal fluid of Alzheimer's disease patients. Ann Neurol 2003; 53:547-548.
[90] Galimberti D, Schoonenboom N, Scheltens P, Fenoglio C, Bouwman F, Venturelli E et
al. Intrathecal chemokine synthesis in mild cognitive impairment and Alzheimer
disease. Arch Neurol 2006; 63:538-543.
[91] Galimberti D, Schoonenboom N, Scheltens P, Fenoglio C, Venturelli E, Pijnenburg YA
et al. Intrathecal chemokine levels in Alzheimer disease and frontotemporal lobar
degeneration. Neurology 2006; 66:146-147.
[92] Galimberti D, Venturelli E, Fenoglio C, Lovati C, Guidi I, Scalabrini D et al. IP-10
serum levels are not increased in mild cognitive impairment and Alzheimer's disease.
Eur J Neurol 2007; 14:e3-e4.
[93] Garlanda C, Bottazzi B, Bastone A, Mantovani A. Pentraxins at the crossroads between
innate immunity, inflammation, matrix deposition, and female fertility. Annu Rev
Immunol 2005; 23:337-366.
[94] Garlind A, Brauner A, Hojeberg B, Basun H, Schultzberg M. Soluble interleukin-1
receptor type II levels are elevated in cerebrospinal fluid in Alzheimer's disease
patients. Brain Res 1999; 826:112-116.
[95] Gasque P, Dean YD, McGreal EP, VanBeek J, Morgan BP. Complement components
of the innate immune system in health and disease in the CNS. Immunopharmacology
2000; 49:171-186.
[96] Gavrilyuk V, Kalinin S, Hilbush BS, Middlecamp A, McGuire S, Pelligrino D et al.
Identification of complement 5a-like receptor (C5L2) from astrocytes: characterization
of anti-inflammatory properties. J Neurochem 2005; 92:1140-1149.
[97] Geddes JW, Monaghan DT, Cotman CW, Lott IT, Kim RC, Chui HC. Plasticity of
hippocampal circuitry in Alzheimer's disease. Science 1985; 230:1179-81.
[98] German DC, Gurnani P, Nandi A, Garner HR, Fisher W, az-Arrastia R et al. Serum
biomarkers for Alzheimer's disease: proteomic discovery. Biomed Pharmacother 2007;
61:383-389.
[99] Ghiso J, Jensson O, Frangione B. Amyloid fibrils in hereditary cerebral hemorrhage
with amyloidosis of Icelandic type is a variant of gamma-trace basic protein (cystatin
C). Proc Natl Acad Sci U S A 1986; 83:2974-2978.
[100] Giometto B, Argentiero V, Sanson F, Ongaro G, Tavolato B. Acute-phase proteins in
Alzheimer's disease. Eur Neurol 1988; 28:30-33.
[101] Griffin WS, Sheng JG, Roberts GW, Mrak RE. Interleukin-1 expression in different
plaque types in Alzheimer's disease: significance in plaque evolution. J Neuropathol
Exp Neurol 1995; 54:276-281.
[102] Grossman M, Farmer J, Leight S, Work M, Moore P, Van D, V et al. Cerebrospinal
fluid profile in frontotemporal dementia and Alzheimer's disease. Ann Neurol 2005;
57:721-729.
196
[103] Gupta A, Watkins A, Thomas P, Majer R, Habubi N, Morris G et al. Coagulation and
inflammatory markers in Alzheimer's and vascular dementia. Int J Clin Pract 2005;
59:52-57.
[104] Hahne S, Nordstedt C, Ahlin A, Nyback H. Levels of cerebrospinal fluid
apolipoprotein E in patients with Alzheimer's disease and healthy controls. Neurosci
Lett 1997; 224:99-102.
[105] Halks-Miller M, Schroeder ML, Haroutunian V, Moenning U, Rossi M, Achim C et al.
CCR1 is an early and specific marker of Alzheimer's disease. Ann Neurol 2003;
54:638-646.
[106] Hamazaki H. Amyloid P component promotes aggregation of Alzheimer's beta-amyloid
peptide. Biochem Biophys Res Commun 1995; 211:349-353.
[107] Hampel H, Schoen D, Schwarz MJ, Kotter HU, Schneider C, Sunderland T et al.
Interleukin-6 is not altered in cerebrospinal fluid of first-degree relatives and patients
with Alzheimer's disease. Neurosci Lett 1997; 228:143-146.
[108] Hansson O, Zetterberg H, Buchhave P, Londos E, Blennow K, Minthon L. Association
between CSF biomarkers and incipient Alzheimer's disease in patients with mild
cognitive impairment: a follow-up study. Lancet Neurol 2006; 5:228-234.
[109] Harigaya Y, Shoji M, Nakamura T, Matsubara E, Hosoda K, Hirai S. Alpha 1antichymotrypsin level in cerebrospinal fluid is closely associated with late onset
Alzheimer's disease. Intern Med 1995; 34:481-484.
[110] Hawkins PN, Rossor MN, Gallimore JR, Miller B, Moore EG, Pepys MB.
Concentration of Serum Amyloid-P Component in the Csf As A Possible Marker of
Cerebral Amyloid Deposits in Alzheimers-Disease. Biochemical and Biophysical
Research Communications 1994; 201:722-726.
[111] Hesse C, Larsson H, Fredman P, Minthon L, Andreasen N, Davidsson P et al.
Measurement of apolipoprotein E (apoE) in cerebrospinal fluid. Neurochem Res 2000;
25:511-517.
[112] Hinds TR, Kukull WA, Van Belle G, Schellenberg GD, Villacres EC, Larson EB.
Relationship between serum alpha 1-antichymotrypsin and Alzheimer's disease.
Neurobiol Aging 1994; 15:21-27.
[113] Holtzman DM. In vivo effects of ApoE and clusterin on amyloid-beta metabolism and
neuropathology. J Mol Neurosci 2004; 23:247-254.
[114] Hoozemans JJ, Bruckner MK, Rozemuller AJ, Veerhuis R, Eikelenboom P, Arendt T.
Cyclin D1 and cyclin E are co-localized with cyclo-oxygenase 2 (COX-2) in pyramidal
neurons in Alzheimer disease temporal cortex. J Neuropathol Exp Neurol 2002;
61:678-688.
[115] Hoozemans JJ, Chafekar SM, Baas F, Eikelenboom P, Scheper W. Always around,
never the same: pathways of amyloid beta induced neurodegeneration throughout the
pathogenic cascade of Alzheimer's disease. Curr Med Chem 2006; 13:2599-2605.
[116] Hoozemans JJ, Van Haastert ES, Veerhuis R, Arendt T, Scheper W, Eikelenboom P et
al. Maximal COX-2 and ppRb expression in neurons occurs during early Braak stages
prior to the maximal activation of astrocytes and microglia in Alzheimer's disease. J
Neuroinflammation 2005; 2:27.
197
[117] Hoozemans JJ, Veerhuis R, Rozemuller AJ, Arendt T, Eikelenboom P. Neuronal COX2 expression and phosphorylation of pRb precede p38 MAPK activation and
neurofibrillary changes in AD temporal cortex. Neurobiol Dis 2004; 15:492-499.
[118] Hoozemans JJ, Veerhuis R, Rozemuller JM, Eikelenboom P. Neuroinflammation and
regeneration in the early stages of Alzheimer's disease pathology. Int J Dev Neurosci
2006; 24:157-165.
[119] Hu Y, Malone JP, Fagan AM, Townsend RR, Holtzman DM. Comparative proteomic
analysis of intra- and interindividual variation in human cerebrospinal fluid. Mol Cell
Proteomics 2005; 4:2000-2009.
[120] Hulstaert F, Blennow K, Ivanoiu A, Schoonderwaldt HC, Riemenschneider M, De
Deyn PP et al. Improved discrimination of AD patients using beta-amyloid(1-42) and
tau levels in CSF. Neurology 1999; 52:1555-1562.
[121] Hye A, Lynham S, Thambisetty M, Causevic M, Campbell J, Byers HL et al. Proteomebased plasma biomarkers for Alzheimer's disease. Brain 2006; 129:3042-3050.
[122] Iarlori C, Gambi D, Gambi F, Lucci I, Feliciani C, Salvatore M et al. Expression and
production of two selected beta-chemokines in peripheral blood mononuclear cells
from patients with Alzheimer's disease. Exp Gerontol 2005; 40:605-611.
[123] Ischenko A, Sayah S, Patte C, Andreev S, Gasque P, Schouft MT et al. Expression of a
functional anaphylatoxin C3a receptor by astrocytes. J Neurochem 1998; 71:24872496.
[124] Ishizuka K, Kimura T, Igata-yi R, Katsuragi S, Takamatsu J, Miyakawa T.
Identification of monocyte chemoattractant protein-1 in senile plaques and reactive
microglia of Alzheimer's disease. Psychiatry Clin Neurosci 1997; 51:135-138.
[125] Itagaki S, McGeer PL, Akiyama H, Zhu S, Selkoe D. Relationship of microglia and
astrocytes to amyloid deposits of Alzheimer disease. J Neuroimmunol 1989; 24:173182.
[126] Ito S, Ohtsuki S, Kamiie J, Nezu Y, Terasaki T. Cerebral clearance of human amyloidbeta peptide (1-40) across the blood-brain barrier is reduced by self-aggregation and
formation of low-density lipoprotein receptor-related protein-1 ligand complexes. J
Neurochem 2007; 103:2482-2490.
[127] Iwata N, Higuchi M, Saido TC. Metabolism of amyloid-beta peptide and Alzheimer's
disease. Pharmacol Ther 2005; 108:129-148.
[128] Janciauskiene S, Wright HT. Inflammation, antichymotrypsin, and lipid metabolism:
autogenic etiology of Alzheimer's disease. Bioessays 1998; 20:1039-1046.
[129] Jellinger KA. Clinicopathological analysis of dementia disorders in the elderly--an
update. J Alzheimers Dis 2006; 9:61-70.
[130] Jia JP, Meng R, Sun YX, Sun WJ, Ji XM, Jia LF. Cerebrospinal fluid tau, Abeta1-42
and inflammatory cytokines in patients with Alzheimer's disease and vascular
dementia. Neurosci Lett 2005; 383:12-16.
[131] Jicha GA, Parisi JE, Dickson DW, Johnson K, Cha R, Ivnik RJ et al. Neuropathologic
outcome of mild cognitive impairment following progression to clinical dementia. Arch
Neurol 2006; 63:674-681.
198
[132] Jicha GA, Petersen RC, Knopman DS, Boeve BF, Smith GE, Geda YE et al.
Argyrophilic grain disease in demented subjects presenting initially with amnestic mild
cognitive impairment. J Neuropathol Exp Neurol 2006; 65:602-609.
[133] Johnson LV, Leitner WP, Rivest AJ, Staples MK, Radeke MJ, Anderson DH. The
Alzheimer's A beta -peptide is deposited at sites of complement activation in pathologic
deposits associated with aging and age-related macular degeneration. Proc Natl Acad
Sci U S A 2002; 99:11830-11835.
[134] Kaeser SA, Herzig MC, Coomaraswamy J, Kilger E, Selenica ML, Winkler DT et al.
Cystatin C modulates cerebral beta-amyloidosis. Nat Genet 2007; 39:1437-1439.
[135] Kamboh MI, Sanghera DK, Ferrell RE, DeKosky ST. APOE*4-associated Alzheimer's
disease risk is modified by alpha 1-antichymotrypsin polymorphism. Nat Genet 1995;
10:486-488.
[136] Kimura M, Asada T, Uno M, Machida N, Kasuya K, Taniguchi Y et al. Assessment of
cerebrospinal fluid levels of serum amyloid P component in patients with Alzheimer's
disease. Neurosci Lett 1999; 273:137-139.
[137] Kinghorn KJ, Crowther DC, Sharp LK, Nerelius C, Davis RL, Chang HT et al.
Neuroserpin binds Abeta and is a neuroprotective component of amyloid plaques in
Alzheimer disease. J Biol Chem 2006; 281:29268-29277.
[138] Klein WL, Krafft GA, Finch CE. Targeting small Abeta oligomers: the solution to an
Alzheimer's disease conundrum? Trends Neurosci 2001; 24:219-224.
[139] Klunk WE, Engler H, Nordberg A, Wang Y, Blomqvist G, Holt DP et al. Imaging brain
amyloid in Alzheimer's disease with Pittsburgh Compound-B. Ann Neurol 2004;
55:306-319.
[140] Korolainen MA, Nyman TA, Nyyssonen P, Hartikainen ES, Pirttila T. Multiplexed
proteomic analysis of oxidation and concentrations of cerebrospinal fluid proteins in
Alzheimer disease. Clin Chem 2007; 53:657-665.
[141] Kosunen O, Soininen H, Paljarvi L, Heinonen O, Talasniemi S, Riekkinen PJ, Sr.
Diagnostic accuracy of Alzheimer's disease: a neuropathological study. Acta
Neuropathol 1996; 91:185-193.
[142] Kovacs DM. alpha2-Macroglobulin in late-onset Alzheimer's disease. Exp Gerontol
2000; 35:473-479.
[143] Kuiper MA, van Kamp GJ, Bergmans PL, Scheltens P, Wolters EC. Serum alpha 1antichymotrypsin is not a useful marker for Alzheimer's disease or dementia in
Parkinson's disease. J Neural Transm Park Dis Dement Sect 1993; 6:145-149.
[144] Lacor PN, Buniel MC, Chang L, Fernandez SJ, Gong Y, Viola KL et al. Synaptic
targeting by Alzheimer's-related amyloid beta oligomers. J Neurosci 2004; 24:1019110200.
[145] Landen M, Hesse C, Fredman P, Regland B, Wallin A, Blennow K. Apolipoprotein E
in cerebrospinal fluid from patients with Alzheimer's disease and other forms of
dementia is reduced but without any correlation to the apoE4 isoform. Dementia 1996;
7:273-278.
[146] Lanzrein AS, Johnston CM, Perry VH, Jobst KA, King EM, Smith AD. Longitudinal
study of inflammatoray factors in serum, cerebrospinal fluid, and brain tissue in
Alzheimer disease: interleukin-1beta, interleukin-6, interleukin-1 receptor antagonist,
199
tumor necrosis factor-alpha, the soluble tumor necrosis factor receptors I and II, and
alpha1-antichymotrypsin. Alzheimer Dis Assoc Disord 1998; 12:215-227.
[147] Leblhuber F, Walli J, Tilz GP, Wachter H, Fuchs D. [Systemic changes of the immune
system in patients with Alzheimer's dementia]. Dtsch Med Wochenschr 1998; 123:787791.
[148] Lefranc D, Vermersch P, Dallongeville J, Daems-Monpeurt C, Petit H, Delacourte A.
Relevance of the quantification of apolipoprotein E in the cerebrospinal fluid in
Alzheimer's disease. Neurosci Lett 1996; 212:91-94.
[149] Lehtimaki T, Pirttila T, Mehta PD, Wisniewski HM, Frey H, Nikkari T. Apolipoprotein
E (apoE) polymorphism and its influence on ApoE concentrations in the cerebrospinal
fluid in Finnish patients with Alzheimer's disease. Hum Genet 1995; 95:39-42.
[150] Levy E, Lopez-Otin C, Ghiso J, Geltner D, Frangione B. Stroke in Icelandic patients
with hereditary amyloid angiopathy is related to a mutation in the cystatin C gene, an
inhibitor of cysteine proteases. J Exp Med 1989; 169:1771-1778.
[151] Levy E, Sastre M, Kumar A, Gallo G, Piccardo P, Ghetti B et al. Codeposition of
cystatin C with amyloid-beta protein in the brain of Alzheimer disease patients. J
Neuropathol Exp Neurol 2001; 60:94-104.
[152] Licastro F, Davis LJ, Morini MC, Cucinotta D, Savorani G. Cerebrospinal fluid of
patients with senile dementia of Alzheimer's type shows an increased inhibition of
alpha-chymotrypsin. Alzheimer Dis Assoc Disord 1994; 8:241-249.
[153] Licastro F, Grimaldi LM, Bonafe M, Martina C, Olivieri F, Cavallone L et al.
Interleukin-6 gene alleles affect the risk of Alzheimer's disease and levels of the
cytokine in blood and brain. Neurobiol Aging 2003; 24:921-926.
[154] Licastro F, Masliah E, Pedrini S, Thal LJ. Blood levels of alpha-1-antichymotrypsin
and risk factors for Alzheimer's disease: effects of gender and apolipoprotein E
genotype. Dement Geriatr Cogn Disord 2000; 11:25-28.
[155] Licastro F, Morini MC, Polazzi E, Davis LJ. Increased serum alpha 1-antichymotrypsin
in patients with probable Alzheimer's disease: an acute phase reactant without the
peripheral acute phase response. J Neuroimmunol 1995; 57:71-75.
[156] Licastro F, Parnetti L, Morini MC, Davis LJ, Cucinotta D, Gaiti A et al. Acute phase
reactant alpha 1-antichymotrypsin is increased in cerebrospinal fluid and serum of
patients with probable Alzheimer disease. Alzheimer Dis Assoc Disord 1995; 9:112118.
[157] Licastro F, Pedrini S, Caputo L, Annoni G, Davis LJ, Ferri C et al. Increased plasma
levels of interleukin-1, interleukin-6 and alpha-1-antichymotrypsin in patients with
Alzheimer's disease: peripheral inflammation or signals from the brain? J
Neuroimmunol 2000; 103:97-102.
[158] Licastro F, Pedrini S, Davis LJ, Caputo L, Tagliabue J, Savorani G et al. Alpha-1antichymotrypsin and oxidative stress in the peripheral blood from patients with
probable Alzheimer disease: a short-term longitudinal study. Alzheimer Dis Assoc
Disord 2001; 15:51-55.
[159] Lidstrom AM, Bogdanovic N, Hesse C, Volkman I, Davidsson P, Blennow K. Clusterin
(apolipoprotein J) protein levels are increased in hippocampus and in frontal cortex in
Alzheimer's disease. Exp Neurol 1998; 154:511-521.
200
201
[174] Matsubara E, Hirai S, Amari M, Shoji M, Yamaguchi H, Okamoto K et al. Alpha 1antichymotrypsin as a possible biochemical marker for Alzheimer-type dementia. Ann
Neurol 1990; 28:561-567.
[175] McCusker SM, Curran MD, Dynan KB, McCullagh CD, Urquhart DD, Middleton D et
al. Association between polymorphism in regulatory region of gene encoding tumour
necrosis factor alpha and risk of Alzheimer's disease and vascular dementia: a casecontrol study. Lancet 2001; 357:436-439.
[176] McGeer PL, Akiyama H, Itagaki S, McGeer EG. Activation of the classical
complement pathway in brain tissue of Alzheimer patients. Neurosci Lett 1989;
107:341-346.
[177] McGeer PL, Itagaki S, Tago H, McGeer EG. Reactive microglia in patients with senile
dementia of the Alzheimer type are positive for the histocompatibility glycoprotein
HLA-DR. Neurosci Lett 1987; 79:195-200.
[178] Mckhann G, Drachman D, Folstein M, Katzman R, Price D, Stadlan EM. ClinicalDiagnosis of Alzheimers-Disease - Report of the Nincds-Adrda Work Group Under the
Auspices of Department-Of-Health-And-Human-Services Task-Force on AlzheimersDisease. Neurology 1984; 34:939-944.
[179] Melchor JP, Pawlak R, Strickland S. The tissue plasminogen activator-plasminogen
proteolytic cascade accelerates amyloid-beta (Abeta) degradation and inhibits Abetainduced neurodegeneration. J Neurosci 2003; 23:8867-8871.
[180] Mentz S, de LS, Baerga-Ortiz A, Knauer MF, Knauer DJ, Komives EA. Mechanism of
thrombin clearance by human astrocytoma cells. J Neurochem 1999; 72:980-987.
[181] Merched A, Blain H, Visvikis S, Herbeth B, Jeandel C, Siest G. Cerebrospinal fluid
apolipoprotein E level is increased in late-onset Alzheimer's disease. J Neurol Sci 1997;
145:33-39.
[182] Merched A, Serot JM, Visvikis S, Aguillon D, Faure G, Siest G. Apolipoprotein E,
transthyretin and actin in the CSF of Alzheimer's patients: relation with the senile
plaques and cytoskeleton biochemistry. FEBS Lett 1998; 425:225-228.
[183] Mi W, Pawlik M, Sastre M, Jung SS, Radvinsky DS, Klein AM et al. Cystatin C
inhibits amyloid-beta deposition in Alzheimer's disease mouse models. Nat Genet
2007; 39:1440-1442.
[184] Mocali A, Cedrola S, Della MN, Bontempelli M, Mitidieri VA, Bavazzano A et al.
Increased plasma levels of soluble CD40, together with the decrease of TGF beta 1, as
possible differential markers of Alzheimer disease. Exp Gerontol 2004; 39:1555-1561.
[185] Molina L, Touchon J, Herpe M, Lefranc D, Duplan L, Cristol JP et al. Tau and apo E in
CSF: potential aid for discriminating Alzheimer's disease from other dementias.
Neuroreport 1999; 10:3491-3495.
[186] Morgan BP, Gasque P. Expression of complement in the brain: role in health and
disease. Immunol Today 1996; 17:461-466.
[187] Mrak RE, Griffin WS. Glia and their cytokines in progression of neurodegeneration.
Neurobiol Aging 2005; 26:349-354.
[188] Mucke L, Yu GQ, McConlogue L, Rockenstein EM, Abraham CR, Masliah E.
Astroglial expression of human alpha(1)-antichymotrypsin enhances alzheimer-like
202
203
204
205
[231] Rozemuller JM, Eikelenboom P, Stam FC, Beyreuther K, Masters CL. A4 protein in
Alzheimer's disease: primary and secondary cellular events in extracellular amyloid
deposition. J Neuropathol Exp Neurol 1989; 48:674-691.
[232] Rusinek H, Endo Y, De SS, Frid D, Tsui WH, Segal S et al. Atrophy rate in medial
temporal lobe during progression of Alzheimer disease. Neurology 2004; 63:23542359.
[233] Sala G, Galimberti G, Canevari C, Raggi ME, Isella V, Facheris M et al. Peripheral
cytokine release in Alzheimer patients: correlation with disease severity. Neurobiol
Aging 2003; 24:909-914.
[234] Sasaki A, Yamaguchi H, Ogawa A, Sugihara S, Nakazato Y. Microglial activation in
early stages of amyloid beta protein deposition. Acta Neuropathol 1997; 94:316-322.
[235] Sastre M, Calero M, Pawlik M, Mathews PM, Kumar A, Danilov V et al. Binding of
cystatin C to Alzheimer's amyloid beta inhibits in vitro amyloid fibril formation.
Neurobiol Aging 2004; 25:1033-1043.
[236] Saunders AJ, Tanzi RE. Welcome to the complex disease world. Alpha2-macroglobulin
and Alzheimer's disease. Exp Neurol 2003; 184:50-53.
[237] Sayah S, Patte C, Gasque P, Chan P, Ischenko A, Vaudry H et al. Characterization of
rat C5a anaphylatoxin receptor (C5aR): cloning of rat C5aR cDNA and study of C5aR
expression by rat astrocytes. Brain Res Mol Brain Res 1997; 48:215-222.
[238] Scacchi R, Gambina G, Ruggeri M, Martini MC, Ferrari G, Silvestri M et al. Plasma
levels of apolipoprotein E and genetic markers in elderly patients with Alzheimer's
disease. Neurosci Lett 1999; 259:33-36.
[239] Schmidt R, Schmidt H, Curb JD, Masaki K, White LR, Launer LJ. Early inflammation
and dementia: a 25-year follow-up of the Honolulu-Asia Aging Study. Ann Neurol
2002; 52:168-74.
[240] Schneider JA, Arvanitakis Z, Bang W, Bennett DA. Mixed brain pathologies account
for most dementia cases in community-dwelling older persons. Neurology 2007;
69:2197-2204.
[241] Schoonenboom NS, van der Flier WM, Blankenstein MA, Bouwman FH, van Kamp
GJ, Barkhof F et al. CSF and MRI markers independently contribute to the diagnosis of
Alzheimer's disease. Neurobiol Aging 2007.
[242] Schram MT, Euser SM, de Craen AJ, Witteman JC, Frolich M, Hofman A et al.
Systemic markers of inflammation and cognitive decline in old age. J Am Geriatr Soc
2007; 55:708-716.
[243] Schuitemaker A, Dik MG, Veerhuis R, Scheltens P, Schoonenboom NS, Hack CE et al.
Inflammatory makers in AD and MCI patients with different biomarker profiles.
Neurobiol Aging (in press) 2008.
[244] Shaffer LM, Dority MD, Gupta-Bansal R, Frederickson RC, Younkin SG, Brunden
KR. Amyloid beta protein (A beta) removal by neuroglial cells in culture. Neurobiol
Aging 1995; 16:737-745.
[245] Shibata M, Yamada S, Kumar SR, Calero M, Bading J, Frangione B et al. Clearance of
Alzheimer's amyloid-ss(1-40) peptide from brain by LDL receptor-related protein-1 at
the blood-brain barrier. J Clin Invest 2000; 106:1489-1499.
206
[246] Sihlbom C, Davidsson P, Sjogren M, Wahlund LO, Nilsson CL. Structural and
Quantitative Comparison of Cerebrospinal Fluid Glycoproteins in Alzheimer's Disease
Patients and Healthy Individuals. Neurochem Res 2008.
[247] Silverman DH, Gambhir SS, Huang HW, Schwimmer J, Kim S, Small GW et al.
Evaluating early dementia with and without assessment of regional cerebral metabolism
by PET: a comparison of predicted costs and benefits. J Nucl Med 2002; 43:253-266.
[248] Simonsen AH, McGuire J, Hansson O, Zetterberg H, Podust VN, Davies HA et al.
Novel panel of cerebrospinal fluid biomarkers for the prediction of progression to
Alzheimer dementia in patients with mild cognitive impairment. Arch Neurol 2007;
64:366-370.
[249] Singh VK, Guthikonda P. Circulating cytokines in Alzheimer's disease. J Psychiatr Res
1997; 31:657-660.
[250] Sjogren M, Davidsson P, Gottfries J, Vanderstichele H, Edman A, Vanmechelen E et
al. The cerebrospinal fluid levels of tau, growth-associated protein-43 and soluble
amyloid precursor protein correlate in Alzheimer's disease, reflecting a common
pathophysiological process. Dement Geriatr Cogn Disord 2001; 12:257-264.
[251] Skoog I, Hesse C, Fredman P, Andreasson LA, Palmertz B, Blennow K.
Apolipoprotein E in cerebrospinal fluid in 85-year-old subjects. Relation to dementia,
apolipoprotein E polymorphism, cerebral atrophy, and white matter lesions. Arch
Neurol 1997; 54:267-272.
[252] Small GW, Kepe V, Ercoli LM, Siddarth P, Bookheimer SY, Miller KJ et al. PET of
brain amyloid and tau in mild cognitive impairment. N Engl J Med 2006; 355:26522663.
[253] Smyth MD, Cribbs DH, Tenner AJ, Shankle WR, Dick M, Kesslak JP et al. Decreased
levels of C1q in cerebrospinal fluid of living Alzheimer patients correlate with disease
state. Neurobiol Aging 1994; 15:609-614.
[254] Snow AD, Sekiguchi R, Nochlin D, Fraser P, Kimata K, Mizutani A et al. An important
role of heparan sulfate proteoglycan (Perlecan) in a model system for the deposition
and persistence of fibrillar A beta-amyloid in rat brain. Neuron 1994; 12:219-234.
[255] Snyder SW, Wang GT, Barrett L, Ladror US, Casuto D, Lee CM et al. Complement
C1q does not bind monomeric beta-amyloid. Exp Neurol 1994; 128:136-142.
[256] Sonnen JA, Larson EB, Crane PK, Haneuse S, Li G, Schellenberg GD et al.
Pathological correlates of dementia in a longitudinal, population-based sample of
aging. Ann Neurol 2007; 62:406-413.
[257] Stoltzner SE, Grenfell TJ, Mori C, Wisniewski KE, Wisniewski TM, Selkoe DJ et al.
Temporal accrual of complement proteins in amyloid plaques in Down's syndrome with
Alzheimer's disease. Am J Pathol 2000; 156:489-499.
[258] Strauss S, Bauer J, Ganter U, Jonas U, Berger M, Volk B. Detection of interleukin-6
and alpha 2-macroglobulin immunoreactivity in cortex and hippocampus of
Alzheimer's disease patients. Lab Invest 1992; 66:223-230.
[259] Streit WJ. Microglia as neuroprotective, immunocompetent cells of the CNS. Glia
2002; 40:133-9.
[260] Streit WJ, Conde JR, Harrison JK. Chemokines and Alzheimer's disease. Neurobiol
Aging 2001; 22:909-913.
207
208
[276] van Horssen J, de Vos RA, Steur EN, David G, Wesseling P, de Waal RM et al.
Absence of heparan sulfate proteoglycans in Lewy bodies and Lewy neurites in
Parkinson's disease brains. J Alzheimers Dis 2004; 6:469-474.
[277] Van Uden E, Mallory M, Veinbergs I, Alford M, Rockenstein E, Masliah E. Increased
extracellular amyloid deposition and neurodegeneration in human amyloid precursor
protein transgenic mice deficient in receptor-associated protein. J Neurosci 2002;
22:9298-9304.
[278] Veerhuis R, Boshuizen RS, Familian A. Amyloid associated proteins in Alzheimer's
and prion disease. Curr Drug Targets CNS Neurol Disord 2005; 4:235-248.
[279] Veerhuis R, Hoozemans JJ, Cagnin A, Eikelenboom P, Banati RB. The activation of
microglia as an early sign of disease progression in Alzheimer's disease. In: Neuroglia,
H.Kettenmann and B.R.Ransom (eds.), 2nd edition.Chapter 45. [2nd edition], 563-572.
2004. Oxford University Press. Ref Type: Serial (Book,Monograph)
[280] Veerhuis R, Janssen I, Hack CE, Eikelenboom P. Early complement components in
Alzheimer's disease brains. Acta Neuropathol 1996; 91:53-60.
[281] Veerhuis R, Van Breemen MJ, Hoozemans JM, Morbin M, Ouladhadj J, Tagliavini F et
al. Amyloid beta plaque-associated proteins C1q and SAP enhance the Abeta1-42
peptide-induced cytokine secretion by adult human microglia in vitro. Acta
Neuropathol 2003; 105:135-144.
[282] Vehmas AK, Kawas CH, Stewart WF, Troncoso JC. Immune reactive cells in senile
plaques and cognitive decline in Alzheimer's disease. Neurobiol Aging 2003; 24:32131.
[283] Verbeek MM, Otte-Holler I, Veerhuis R, Ruiter DJ, de Waal RM. Distribution of A
beta-associated proteins in cerebrovascular amyloid of Alzheimer's disease. Acta
Neuropathol 1998; 96:628-636.
[284] Verwey N, Schuitemaker A, van der Flier WM, Mulder SD, Mulder C, Hack CE et al.
Serum amyloid P component as biomarker in MCI and AD. submitted. 2008. Ref Type:
Unpublished Work
[285] Wahlund LO, Julin P, Johansson SE, Scheltens P. Visual rating and volumetry of the
medial temporal lobe on magnetic resonance imaging in dementia: a comparative study.
J Neurol Neurosurg Psychiatry 2000; 69:630-635.
[286] Wahrle SE, Shah AR, Fagan AM, Smemo S, Kauwe JS, Grupe A et al. Apolipoprotein
E levels in cerebrospinal fluid and the effects of ABCA1 polymorphisms. Mol
Neurodegener 2007; 2:7.
[287] Walker DG, McGeer PL. Complement gene expression in human brain: comparison
between normal and Alzheimer disease cases. Brain Res Mol Brain Res 1992; 14:109116.
[288] Walter S, Letiembre M, Liu Y, Heine H, Penke B, Hao W et al. Role of the toll-like
receptor 4 in neuroinflammation in Alzheimer's disease. Cell Physiol Biochem 2007;
20:947-956.
[289] Wang X, DeKosky ST, Ikonomovic MD, Kamboh MI. Distribution of plasma alpha 1antichymotrypsin levels in Alzheimer disease patients and controls and their genetic
controls. Neurobiol Aging 2002; 23:377-382.
209
210
Chapter VIII
ABSTRACT
In the last years, leukocytes have been used under different methodological
approaches to increase diagnostic accuracy of Alzheimers disease (AD) and to identify
subjects with a clinical diagnosis of mild cognitive impairment (MCI) who will progress
to clinical AD.
CD36, a scavenger receptor of class B (SR-B), is expressed on microglia and binds
to A fibrils in vitro, playing a key role in the proinflammatory events associated with
AD.
Recently, we have shown that leukocyte expression of CD36 was significantly
reduced vs controls in both AD and MCI patients, while in young and old controls there
were no CD36-age-related changes.
Reportedly, incidence and prevalence of AD are higher in postmenopausal women
than in aged matched men. Since at menopause the endocrine system and other biological
paradigms undergo substantial changes we have evaluated whether (and how) the
balance between some hormonal parameters allegedly neuroprotective (e.g. related to
estrogen and dehydroepiandrosterone) and others considered pro-neurotoxic (e.g. related
Correspondence concerning this article should be addressed to: Antonello E. Rigamonti, E-mail:
[email protected].
212
213
example, there is ongoing research in the development of new disease-modifying or diseasearresting drugs for Alzheimers disease (i.e., -sheet breakers or - and -secretase inhibitors)
(Giacobini and Becker, 2007). Were these drugs effective, evaluation of biomarkers would be
useful for prompting an early therapeutic intervention.
Finally, presence of replicable AD-specific changes in extra-CNS tissues would also be
important for the development of new therapeutic strategies and, ultimately, for determining
the prognosis in a single patient (Schott et al., 2007).
214
215
two of which are located on the intracellular domains (Greenwalt et al., 1992). The function
of these lipid modifications is currently unknown but they likely promote the association of
CD36 with the membrane and possibly lipid rafts, which appear to be important for some
CD36 functions.
Figure 1. Structure of CD36, which has been proposed to have horseshoe-like membrane topologies
with short N - and C - terminal cytoplasmic domains, adjacent to N- and C-terminal transmembrane
domains, and the bulk of the protein in a heavily N-glycosylated, disulfide-containing extracellular
loop. Modified from Krieger, 2001.
216
(Armesilla et al., 1996). The gene is under the transcriptional control of the nuclear receptor
PPAR-RXR (peroxisome proliferator-activated receptor - retinoic-X-receptor) and gene
expression can be up regulated using synthetic and natural ligands for PPAR-RXR,
including the thiazolidinediones (a class of anti-diabetic drugs) and the vitamin A metabolite
9-cis-retinoic acid (Matsumoto et al., 2000; Nicholson and Hajjar, 2004; Nicholson, 2004;
Sato et al., 2002).
CD36 is involved in adherence of platelets, but it also participates in the adherence of
infected erythrocytes to the vascular endothelium. It is well known, in fact, that erythrocytes
containing the mature form of the malaria parasite Plasmodium Falciparum are sequestered
by microvascular endothelial cells and that CD36 plays a major role on this phenomenon.
Several lines of evidence suggest that mutations in CD36 may be protective against malaria:
mutations involving the promoter regions, introns and exon 5, reduce the risk of severe
malaria. Genetic studies have suggested that there has been a positive selection on this gene,
likely due to the malarial selection pressure (Serghides et al., 2003; Sherman et al., 2003).
Besides CD36, the class B scavenger receptor superfamily also includes receptors for
selective cholesteryl ester uptake, scavenger receptor class B type I (SR-BI), and lysosomal
integral membrane protein II (LIMP-II) (Crombie and Silverstein, 1998). On the macrophage
surface CD36 is part of a non opsonic receptor (the scavenger receptor CD36/alphaV beta3
complex) and is involved in phagocytosis. CD36 also participates to the phenomena of
hemostasis and thrombosis, inflammation, lipid metabolism and atherogenesis (Febbraio et
al., 2001) (Table 1).
Table 1. Ligands of the CD36 receptor and the related type of cells in which the binding
has been (directly or indirectly) tested
Ligand
Thrombospondin
Erythrocytes infected with Plasmodium
Falciparum
Collagen
Apoptotic cells
Oxidized LDL (oxLDL)
Long-chain fatty acid
-amyloid
Growth hormone secretagogues (GHS)
Type of cells
Monocytes, platelets, some cancer cells
Monocytes, endothelial cells, some
cancer cells
Platelets
Macrophages
Macrophages, monocytes
Endothelial cells, adipocytes, platelets
Macrophages, monocytes, microglia
Myocardial tissue
The list of cell types is not exhaustive and mentions only the most studied ones.
217
218
Microglia reportedly expresses CD36 (Husemann et al., 2001; Bamberger et al., 2003).
In neonatal microglia CD36 promotes endocytosis of A in suspension, and adhesion of
microglia to fibrillar A-containing surfaces (Alarcn et al., 2005). Microglial CD36
expression is enhanced in AD patients compared to age-matched control individuals (Coraci
et al., 2002) and similar findings are present in the brains of transgenic mice expressing a
mutated form of the human APP (APP23), which develop an AD-like pathology (unpublished
data).
219
Various studies suggest that alterations of the immune profile are associated with AD
progression. In this context, cytokine release from LPS-stimulated leukocytes has been
investigated in AD patients. Reportedly, a significant decrease of IL-1, IL-6, and TNF-
secretion was observed in severely demented patients, but not in patients with mild or
moderate cognitive impairment. Thus, secretion of IL-1, IL-6 and TNF- seems to be
negatively correlated with the severity of dementia (Sala et al., 2003). In accordance with the
inflammatory hypothesis of AD, the activity of nitric oxide synthase (NOS) appears increased
in leukocytes from demented patients (De Servi et al., 2002). Spontaneous production of
cytokines by peripheral blood mononuclear cells was found associated with the risk of
incoming AD also in the cohort population of the Framingham Study (Tan et al., 2007).
Cell-cycle dysregulation might be critically involved in the process of brain
neurodegeneration. In accordance with this hypothesis, peripheral blood lymphocytes from
AD patients stimulated with mitogenic compounds were less able to express CD69 (an early
proliferation marker) than cells obtained from age-matched healthy controls. More
interestingly, the expression of CD69 inversely correlated with the MMSE score, i.e. with the
severity of AD (Stieler et al., 2001). These results suggest that systemic failure of the control
mechanisms of cellular proliferation might be of critical importance for the pathogenesis of
AD and that peripheral leukocytes may represent a useful tool to study this phenomenon.
220
expression in the brain of AD patients might reflect a reactive response aimed at removing
A deposits, delaying the formation of senile plaques, the neurodegenerative process and,
ultimately, development of AD. However, irrespective of the mechanisms underlying the
reduction of leukocyte CD36 expression in AD and MCI patients which would be
propaedeutic to ensuing entrance of monocyte/macrophage CD36 positive cells into the brain
parenchyma (Schlageter et al., 1987) this earlier event may represent an useful, noninvasive biochemical marker for identifying MCI patients prone to develop AD. Obviously,
these preliminary results should be broadened by recruiting a wider cohort of MCI patients in
whom to also measure prospectively CD36 protein levels, and then follow MCI progression
toward AD (Figure 2).
0,6
0,5
*
0,4
*
0,3
0,2
0,1
0,0
YOUNG
OLD
AD
MCI
Figure 2. Leukocyte expression of CD36 in AD and MCI patients and in old and young control
subjects. Vertical bars indicate mean + SEM. *P < 0,05 vs. YOUNG and OLD.
221
data have been reported (Nilsson, 1984; Brayne et al., 1995), most of the studies support a
higher prevalence and incidence of AD in women, even after adjusting for their different
survival (Bachman et al., 1992; 1993; Gao et al., 1998). This has obviously focused the
attention on the role of female hormones, e.g. estrogens (and progestins) whose production
dramatically decreases at menopause.
The role of estrogens in AD has been investigated in a variety of in vivo and in vitro
models. These studies have shown estrogens to be potent neuroprotective agents. In fact, they
(a) augment the cerebral blood flow in the hippocampus and temporal lobe, two brain areas
involved in the early pathological changes of AD (Maki and Resnick, 2000; 2001); (b) exert
neurotrophic actions on different neuronal populations (Gibbs and Aggarwal, 1998; Leranth
et al, 2000; Granholm et al, 2002; 2003; McEwen, 2002); (c) decrease cholesterol levels and
modulate the expression of the gene encoding apolipoprotein E (ApoE) (Brinton et al, 2000;
Lambert et al, 2004); (d) prevent the formation of A fibrils and protect the cells against their
cytotoxic effects (Thomas and Rhodin, 2000; Granholm et al, 2003); (e) inhibit the chronic
inflammatory reaction that has a pathogenetic role in AD (Thomas and Rhodin, 2000), and (f)
induce the synthesis of thioredoxin, a multifunctional protein endowed with antioxidant and
neuroprotective actions (Chiueh et al, 2003). Inferential support to the protective role of
estrogens in AD rests on the observation that cognitive function is improved by hormone
replacement therapy (HRT) in postmenopausal women (Phillips and Sherwin, 1992; Jacobs et
al., 1998).
Despite this large body of evidence, other studies have denied the alleged protective role
of estrogens, leaving the problem unsettled (den Heijer et al, 2003; Shumaker et al, 2003;
2004; Espeland et al, 2004). In this context, the Womens Health Initiative Memory Study
(WHIMS), a wide randomized placebo-controlled clinical trial for HRT in postmenopausal
women, has recently shown that in women with an average age of 63 yr at entry, HRT
increases the risk of probable dementia (Shumaker et al, 2003; 2004), and hypothesized that
the negative effect may be related to the HRT-induced increased risk of stroke, standing the
strong relationship existing between microinfarcts in the brain and susceptibility to AD
(Shumaker et al, 2003; 2004). For a thorough discussion, see Turgeon et al., 2006.
With these disparate findings in mind, different authors have hypothesized the existence
of a critical temporal window, likely coincident with the menopausal transition, within
which the estrogens manifest their positive effects and over which, instead, they become
detrimental (Kesslak, 2002; Zandi et al, 2002; Smith and Levin-Allerhand, 2003). Along this
line, it is noteworthy that in postmenopausal women the reduction of the risk of dementia is
related to the previous and not the current use of estrogens (Zandi et al, 2002).
Among elderly, and particularly in AD patients, a disrupted hypothalamo-pituitaryadrenal function may also play a role in neurodegeneration (Murialdo et al., 2001). Higher
glucocorticoid levels, in fact, may alter the function of hippocampal neurons and glial cells,
rendering these elements more vulnerable to metabolic insults, such as hypoglycaemia and
hypoxia. They also cause synaptic disruption and are involved in neuronal cell death
(Sapolsky et al., 1991; Mller, 2001).
These premises, dictated the study of the leukocyte expression of some biological
parameters in a large group (n=209) of normal non-dementing subjects (aged 19-92 yrs) and
AD patients of either sex (n=85),(aged 65-96 yrs), the aim being that of evaluating how the
222
Cortisol
No
No
DHEAS
R2=0.52
P<0.05
No
No
No
No
No
No
No
No
No
No
No
No
No
No
No
No
---
No
No
No
No
No
No
---
No
No
No
No
No
No
No
No
No
No
--No
No
---
Age
Age
---
ER
No
ER
No
HGR
No
HGR
No
CD36
No
IL-6
No
ER
No
---
No
No
No
ER
No
No
No
No
HGR
No
R2=0.39
P<0.05
No
R2=0.39
P<0.05
--No
---
HGR
No
No
No
CD36
No
No
No
No
E2
R2=0.57
P<0.05
No
R2=0.52
P<0.05
R2=0.36
P<0.05
No
R2=0.50
P<0.05
No
R2=0.52
P<0.05
No
R2=0.84
P<0.01
R2=0.52
P<0.05
---
IL-6
R2=0.40
P<0.05
R2=0.84
P<0.01
No
R2=0.40
P<0.05
---
R2=0.36
P<0.05
R2=0.50
P<0.05
No
No
No
No
No
No
No
No
Cortisol
DHEAS
B. Men
Age
Age
---
ER
No
ER
No
HGR
No
HGR
No
CD36
No
IL-6
No
E2
No
Cortisol
No
ER
No
---
No
No
No
No
No
No
No
No
No
No
No
HGR
No
R2=0.54
P<0.05
No
No
---
No
No
No
No
No
No
No
No
No
CD36
No
No
No
No
No
No
No
---
No
No
No
No
No
R2=0.48
P<0.05
R2=0.59
P<0.05
No
No
No
No
E2
Cortisol
DHEAS
R2=0.54
P<0.05
No
No
No
R2=0.49
P<0.05
No
No
IL-6
R2=0.36
P<0.05
R2=0.76
P<0.01
No
R2=0.76
P<0.01
R2=0.49
P<0.05
---
No
HGR
R2=0.36
P<0.05
---
R2=0.54
P<0.05
R2=0.59
P<0.05
No
No
ER
R2=0.54
P<0.05
---
DHEAS
R2=0.48
P<0.05
No
No
No
No
No
No
No
No
No
No
No
No
No
--No
No
No
--No
No
No
---
223
In this study, none of the biological parameters investigated was related to age, except
for the plasma levels of estrogens in women and DHEAS in either sex (negative correlation)
(Table 2). In addition, most of the potentially neurotoxic alterations found in the
perimenopausal period were absent in the very old healthy individuals. This, inferentially,
would confirm the view that the higher prevalence of AD in the older population (Gao et al.,
1998) is not a direct effect of age per se. More likely, it depends, instead, from the presence
of favoring risk factors whose contribution to the development of the disease occurs only in
the presence of possible age-dependent triggers. This view also is supported by the
recognition that among very old individuals the prevalence of AD seems to level off or even
decline (Ritchie and Kildea, 1995). Possible triggers encompass well-characterized mutations
in either the A precursor protein or presenilins 1 and 2 (Hoenicka, 2006), oxidative stress
(Onyango and Khan, 2006), metal ion dysregulation (Bush, 2003) and inflammation (WyssCoray, 2006). However, the simple perturbation of these elements in cell or animal models
does not result per se in the multiplicity of biochemical and cellular changes found in the
disease. For instance, there is little to no neuronal loss in transgenic rodent models that
overexpress mutant A precursor protein, despite large depositions of A protein
(Sankaranarayanan, 2006).
224
2002). That leukocyte ER expression in AD patients was similar to that found in age- and
sex-matched control subjects would deny a direct relationship between this parameter and the
disease (Figure 3).
1,2
(21-30)
1,0
ER and ER mRNA
(31-40)
(41-50)
(51-60)
ER-
ER-
GAPDH
(61-70)
(71-80)
(> 81)
AD
ER
ER
0,8
0,6
0,4
0,2
0,0
21-30
31-40
41-50
51-60
61-70
71-80
>81
AD
2,5
(21-30)
2,0
ER and ER mRNA
(31-40)
(41-50)
ER-
ER-
GAPDH
(51-60)
(61-70) (71-80)
(> 81)
AD
ER
ER
1,5
1,0
0,5
0,0
21-30
31-40
41-50
51-60
61-70
71-80
>81
AD
Figure 3. Leukocyte expression of ER (white bars) and ER (stripped bars) in male (panel A) and
female (panel B) healthy subjects and AD patients. Healthy subjects were divided according to age
(decades) and gender, whereas AD patients were not separated in age groups. Representative blots for
ER and ER are shown. ER: -estrogen receptor; ER: -estrogen receptor; AD: Alzheimers
Disease; GAPDH: glyceraldehyde-3-phosphate dehydrogenase.
225
60
A
Plasma Estradiol [pg/ml]
50
40
30
20
10
0
21-30
31-40
41-50
51-60
61-70
71-80
>81
AD
140
B
120
Estradiol
Estrone
100
80
60
40
**
20
**
**
61-70
71-80
**
0
21-30
31-40
41-50
51-60
>81
AD
Figure 4. Plasma concentrations of estradiol (white bars) and estrone (stripped bars) in male (panel A)
and female (panel B) healthy subjects and AD patients. See legend of Figure 3 for further details.
6.2. Interleukin 6
The widespread presence of ERs in multiple cell types of the immune system and their
participation to the inflammatory response is remarkable. ER and, in some cases, ER are
present in front line immune and cytokine-producing cells, such as macrophages and
microglia, and activated ERs have been shown in vitro to affect release of proinflammatory
cytokines from these cells and to interfere with the action of cytokines (Mor et al., 1999;
Pfeilschifter et al., 2002; Salem, 2004). For instance, estrogens inhibit the production of IL-6
(Gordon et al., 2001), a multifunctional cytokine involved in flogistic processes in the CNS,
226
which also plays a pathogenetic role in AD (Papassotiropoulos et al., 2001). In our study,
leukocyte IL-6 expression peaked in 51-60 yr-old women, whereas in men it remained
constant over time. In this context, an interesting feature is the direct correlation found in
either sex between ERs and IL-6 gene expression. These findings would confirm that
estrogens are important to maintain under inhibitory control IL-6 production and so to
prevent tissue damage. Hence, during menopausal transition, the abrupt fall of estrogens may
predispose to an excessive CNS inflammatory response induced by triggers, such as A
deposition (Figure 4).
In AD patients, instead, IL-6 expression was lower than in age-matched non-dementing
subjects. It is tempting to speculate that this occurred for the progressive loss of cytokineproducing cells induced by cortisol (see below) and/or by other factors, such as the reduced
expression of CD36, which is essential for the release of many proinflammatory agents,
including cytokines and reactive oxygen species (Coraci et al. 2002).
6.3. Glucocorticoid Receptors
The neuropathological hallmarks of AD are very prominent in the hippocampus, a brain
area pivotal to the regulation of the hypothalamic-pituitary-adrenal (HPA) system. An agerelated dysregulation of the HPA axis is well recognised in animals, in which steroid
detrimental effects on cognition may occur via the hippocampus, a major site of
corticosteroid action, and an important structure involved in learning and memory (Muller,
2001; Miller and O'Callaghan, 2005).
7
*
6
(21-30)
(31-40)
(41-50)
(51-60)
(61-70)
(71-80)
(> 81)
AD
HGR-
W
M
HGR-
GAPDH
MEN
WOMEN
W
M
W
0
21-30
31-40
41-50
51-60
61-70
71-80
>81
AD
Figure 5. Ratio of leukocyte expressions of HGR:HGR in male (white bars) and female (stripped
bars) healthy subjects and AD patients. Representative blots for HGR and HGR are shown.
HGR:HGR: ratio between - and -glucorticoid receptors. See legend of Figure 3 for further details.
227
6.4. CD36
The most interesting data was the observation that in women, starting from the
menopausal transition, the expression of CD36 fell and became similar to that present in AD
patients. Recalling that a direct correlation occurred in either sex between CD36 and HGRs
expression, it is conceivable that an excessive cortisol activity caused a loss of CD36-positive
cells. Were this also occurring in the brain, the most likely consequence would be the
progressive inability of microglial elements to remove the A protein, thus favoring its
accumulation (Figure 6). Interestingly, CD36 was reported to be decreased before evidence of
A accumulation in the cortex of triple transgenic (3TgAD) mice, which recapitulate the
hallmarks of A deposition and tau hyperphosphorylation (Giunta et al., 2007a).
228
DHEA (Herbert, 1998). Our data indicate that cortisol : DHEA ratio increased with
advancing age both in men and women, but this augmentation occurred earlier in the female
population, being yet present in the decade corresponding to menopausal transition (i.e. 5160 yr), whereas in men it took place about 10 yr later (Figure 7).
3,0
(21-30)
CD36
2,5
(31-40)
(41-50)
(51-60) (61-70)
AD
MEN
WOMEN
W
M
GAPDH
CD36 mRNA
2,0
1,5
*
1,0
0,5
0,0
21-30
31-40
41-50
51-60
61-70
71-80
>81
AD
(21-30)
IL-6
(31-40)
IL-6 mRNA
(51-60)
(61-70)
(71-80)
(> 81)
AD
MEN
WOMEN
W
M
GAPDH
(41-50)
**
0
21-30
31-40
41-50
51-60
61-70
71-80
>81
AD
Figure 6. Leukocyte expression of CD36 (panel A) and IL-6 (panel B) in male (white bars) and female
(stripped bars) healthy subjects and AD patients. Representative blots for CD36 and IL-6 are shown.
IL-6: interleukin 6. See legend of Figure 3 for further details.
229
This was particularly evident in women, where the estrogen deprivation occurring in the
transitional period (51-60 yr) towards a more advanced menopause, induced clearcut, specific
changes in some hormonal/biological paradigms (e.g. peak HGR:HGR ratio; peak IL-6
expression). Concerning the leucocyte expression of CD36, AD women, as previously
observed in men, presented lower values than in non-dementing subjects within a wide
interval of their life span (51-80 yr); here, the most interesting finding was the correlation
present in AD patients of either sex between CD36 and HGRs expression, which would
imply a pathogenetic role for the HPA function in AD.
In all, it can be hypothesized that during menopausal transition the occurrence of an
unfavorable biological milieu would predispose to an increased risk of neurodegeneration.
Collectively, the higher prevalence of AD in the female population would depend, at least in
part, from the presence of a cohort of biological risk factors, whose contribution to the
development of the disease occurs only in the presence of possible age-dependent triggers,
such as A deposition.
1,4
1,2
MEN
WOMEN
1,0
0,8
*
0,6
*
*
0,4
*
*
0,2
0,0
21-30
31-40
41-50
51-60
61-70
71-80
>81
AD
Figure 7. Cortisol and DHEA plasma level ratio in male (white bars) and female (stripped bars) healthy
subjects and AD patients. DHEA: dehydroepiandrosterone. See legend of Figure 3 for further details.
7. CONCLUSIONS
Unanimously considered a CNS disease, AD is also characterized by a host of biological
tissue alterations in extra-neuronal areas. This has opened avenues allowing to switch from a
clinical diagnosis of the disease for the inaccessibility of the brain structures to a more
feasible etiologic-pathophysiologic diagnosis on the basis of peripheral markers. In the last
decade search of biochemical and hormonal markers in the tissues of AD patients is
progressively increased, leading to identify potential biological markers. Based on the notion
that inflammation is thought to play a significant role in the pathogenesis of many
230
neurodegenerative disorders, including AD, and that receptors for cytokines, growth factors,
hormones are widely expressed in microglia and monocytic cell lines, the use of these
biologic paradigms has been initially exploited. Interestingly, microglia, e.g. the resident
macrophages, express receptors which bind fibrillar A, among which CD36, a member of
the B family of scavenger receptors, would play a key role since the activation it induces of
A would produce cytokines and chemokines.
In both AD patients and patients with MCI, a form which has the 50% probability to turn
later into AD, there was a similar, age unrelated, decrease in the leukocyte expression of
CD36, which prohibited differentiation of the two forms, but disclosed the potential value of
early recognition of the pathology.
Gender studies have disclosed the higher prevalence and incidence of AD in females than
males, a fact that standing the consistent neuroprotective effects of estrogens calls for
changes occurring abruptly at menopause. In a study dealing with numerous groups of AD
patients and controls of either sex evaluated at different intervals of the reproductive cycle,
dramatic increases in most hormonal/biological parameters investigated (ER, ER,
HGR:HGR ratio, cortisol:DHEA ratio), occurred just at the female menopausal transitional
interval (50-60 yr), while there were no changes in these parameters at the other different
intervals of the reproductive cycle in females, and at no interval in males. Thus, menopausal
transition appears to be a critical phase of womens life where the occurrence of an
unfavorable milieu would predispose to an increased risk of neurodegeneration.
REFERENCES
Abumrad, NA; el-Maghrabi, MR; Amri, EZ; Lopez, E; Grimaldi, PA. Cloning of a rat
adipocyte membrane protein implicated in binding or transport of long-chain fatty acids
that is induced during preadipocyte differentiation: homology with human CD36. J Biol
Chem, 1993 268, 17665-8.
Acton, S; Rigotti, A; Landschulz, KT; Xu, S; Hobbs, HH; Krieger, M. Identification of
scavenger receptor SR-BI as a high density lipoprotein receptor. Science, 1996 271, 51820.
Alarcn, R; Fuenzalida, C; Santibez, M; von Bernhardi, R. Expression of scavenger
receptors in glial cells. Comparing the adhesion of astrocytes and microglia from
neonatal rats to surface-bound beta-amyloid. J Biol Chem, 2005 280, 30406-15.
Allsopp, RC; Vaziri, H; Patterson, C; Goldstein, S; Younglai, EV, Futcher AB, Greider CW,
Harley CB. Telomere length predicts replicative capacity of human fibroblasts. Proc Natl
Acad Sci USA, 1992 89, 10114-8.
American Psychiatric Association. Diagnostic and statistical manual of mental disorders
(IV-TR), 4th edntext revised. Washington, DC: 2000.
Arai, H; Terajima, M; Miura, M; Higuchi, S; Muramatsu, T; Machida, N; Seiki, H; Takase,
S; Clark, CM; Lee, VM; et al. Tau in cerebrospinal fluid: a potential diagnostic marker in
Alzheimer's disease. Ann Neurol, 1995 38, 649-52.
231
Armesilla, AL; Calvo, D; Vega, MA. Structural and functional characterization of the human
CD36 gene promoter: identification of a proximal PEBP2/CBF site. J Biol Chem, 1996
271, 7781-7.
Armesilla, AL; Vega, MA. Structural organization of the gene for human CD36 glycoprotein.
J Biol Chem, 1994 269, 18985-91.
Arriagada, PV; Growdon, JH; Hedley-Whyte, ET; Hyman, BT. Neurofibrillary tangles but
not senile plaques parallel duration and severity of Alzheimers disease. Neurology, 1992
42, 631-9.
Bachman, DL; Wolf, PA; Linn, R; Knoefel, JE; Cobb, J; Belanger, A; White, LR;
D'Agostino, RB. Prevalence of dementia and probable senile dementia of the Alzheimer
type in the Framingham Study. Neurology, 1992 42, 115-9.
Bachman, DL; Wolf, PA; Linn, R; Knoefel, JE; Cobb, J; Belanger, A; White, LR;
D'Agostino, RB. Incidence of dementia and probable Alzheimer's disease in a general
population: the Framingham Study. Neurology, 1993 43, 515-9.
Baillie, AG; Coburn, CT; Abumrad, NA. Reversible binding of long-chain fatty acids to
purified FAT, the adipose CD36 homolog. J Membr Biol, 1996 153, 75-81.
Bamberger, CM; Bamberger, AM; de Castro, M; Chrousos, GP. Glucocorticoid receptor beta,
a potential endogenous inhibitor of glucocorticoid action in humans. J Clin Invest, 1995
95, 2435-41.
Bamberger, ME; Harris, ME; McDonald, DR; Husemann, J; Landreth, GE. A cell surface
receptor complex for fibrillar beta-amyloid mediates microglial activation. J Neurosci,
2003 23, 2665-74.
Baulieu, EE. Neurosteroids: of the nervous system, by the nervous system, for the nervous
system. Recent Prog Horm Res, 1997 52, 1-32.
Behl, C. Oxidative stress in Alzheimer's disease: implications for prevention and therapy.
Subcell Biochem, 2005 38, 65-78.
Ben-Hur, H; Mor, G; Insler, V; Blickstein, I; Amir-Zaltsman, Y; Sharp, A; Globerson, A;
Kohen, F. Menopause is associated with a significant increase in blood monocyte number
and a relative decrease in the expression of estrogen receptors in human peripheral
monocytes. Am J Reprod Immunol, 1995 34, 363-9.
Borroni, B; Premi, E; Di Luca, M; Padovani, A. Combined biomarkers for early Alzheimer
disease diagnosis. Curr Med Chem, 2007 14, 1171-8.
Brayne, C; Gill, C; Huppert, FA; Barkley, C; Gehlhaar, E; Girling, DM; O'Connor, DW;
Paykel, ES. Incidence of clinically diagnosed subtypes of dementia in an elderly
population: Cambridge Project for Later Life. Br J Psychiatry, 1995 167, 255-62.
Brinton, RD; Chen, S; Montoya, M; Hsieh, D; Minaya, J. The estrogen replacement therapy
of the Women's Health Initiative promotes the cellular mechanisms of memory and
neuronal survival in neurons vulnerable to Alzheimer's disease. Maturitas, 2000 34 Suppl
2, S35-52.
Bush, AI. The metallobiology of Alzheimer's disease. Trends Neurosci, 2003 26, 207-14.
Cattabeni, F; Colciaghi, F; Di Luca M. Platelets provide human tissue to unravel pathogenic
mechanisms of Alzheimer disease. Prog Neuropsychopharmacol Biol Psychiatry, 2004
28, 763-70.
232
Chakraborty, TR; Rajendren, G; Gore, AC. Expression of estrogen receptor {alpha} in the
anteroventral periventricular nucleus of hypogonadal mice. Exp Biol Med (Maywood),
2005 230, 49-56.
Chiueh, C; Lee, S; Andoh, T; Murphy, D. Induction of antioxidative and antiapoptotic
thioredoxin supports neuroprotective hypothesis of estrogen. Endocrine, 2003 21, 27-31.
Chong, MS; Lim, WS; Sahadevan, S. Biomarkers in preclinical Alzheimer's disease. Curr
Opin Investig Drugs, 2006 7, 600-7.
Coraci, IS; Husemann, J; Berman, JW; Hulette, C; Dufour, JH; Campanella, GK; Luster, AD;
Silverstein, SC; El-Khoury, JB. CD36, a class B scavenger receptor, is expressed on
microglia in Alzheimer's disease brains and can mediate production of reactive oxygen
species in response to beta-amyloid fibrils. Am J Pathol, 2002 160, 101-12.
Crombie, R; Silverstein, R. Lysosomal integral membrane protein II binds thrombospondin-1.
Structure-function homology with the cell adhesion molecule CD36 defines a conserved
recognition motif. J Biol Chem, 1998 273, 4855-63.
Dawe, B; Procter, A; Philpot, M. Concepts of mild cognitive impairment in the elderly and
their relationship to dementia: a review. Int J Geriatr Psychiatry, 1992 7, 473-9.
De Servi, B; La Porta, CA; Bontempelli, M; Comolli, R. Decrease of TGF-beta1 plasma
levels and increase of nitric oxide synthase activity in leukocytes as potential biomarkers
of Alzheimer's disease. Exp Gerontol, 2002 37, 813-21.
den Heijer, T; Geerlings, MI; Hofman, A; de Jong, FH; Launer, LJ; Pols, HA; Breteler, MM.
Higher estrogen levels are not associated with larger hippocampi and better memory
performance. Arch Neurol, 2003 60, 213-20.
Dubois, B; Feldman, HH; Jacova, C; Dekosky, ST; Barberger-Gateau, P; Cummings, J;
Delacourte, A; Galasko, D; Gauthier, S; Jicha, G; Meguro, K; O'brien, J; Pasquier, F;
Robert, P; Rossor, M; Salloway, S; Stern, Y; Visser, PJ; Scheltens, P. Research criteria
for the diagnosis of Alzheimer's disease: revising the NINCDS-ADRDA criteria. Lancet
Neurol, 2007 6, 734-46.
Eckert, A; Oster, M; Zerfass, R; Hennerici, M; Mller, WE. Elevated levels of fragmented
DNA nucleosomes in native and activated lymphocytes indicate an enhanced sensitivity
to apoptosis in sporadic Alzheimer's disease. Specific differences to vascular dementia.
Dement Geriatr Cogn Disord, 2001a 12, 98-105.
Eckert, A; Schindowski, K; Leutner, S; Luckhaus, C; Touchet, N; Czech, C; Mller, WE.
Alzheimer's disease-like alterations in peripheral cells from presenilin-1 transgenic mice.
Neurobiol Dis, 2001b 8, 331-42.
El Khoury, JB; Moore, KJ; Means, TK; Leung, J; Terada, K; Toft, M; Freeman, MW; Luster,
AD. CD36 mediates the innate host response to beta-amyloid. J Exp Med, 2003 197,
1657-66.
Endemann, G; Stanton, LW; Madden, KS; Bryant, CM; White, RT; Protter, AA. CD36 is a
receptor for oxidized low density lipoprotein. J Biol Chem, 1993 268, 11811-6.
Espeland, MA; Rapp, SR; Shumaker, SA; Brunner, R; Manson, JE; Sherwin, BB; Hsia, J;
Margolis, KL; Hogan, PE; Wallace, R; Dailey, M; Freeman, R; Hays, J; Women's Health
Initiative Memory Study. Conjugated equine estrogens and global cognitive function in
postmenopausal women: Women's Health Initiative Memory Study. JAMA, 2004 291,
2959-68.
233
Febbraio, M; Hajjar, DP; Silverstein RL. CD36: a class B scavenger receptor involved in
angiogenesis, atherosclerosis, inflammation, and lipid metabolism. J Clin Invest, 2001
108, 785-91.
Fernandez-Ruiz, E; Armesilla, AL; Sanchez-Madrid, F; Vega, MA. Gene encoding the
collagen type I and thrombospondin receptor CD36 is located on chromosome 7q11.2.
Genomics, 1993 17, 759-61.
Flicker, C; Ferris, SH; Reisberg, B. Mild cognitive impairment in the elderly: predictors of
dementia. Neurology, 1991 41, 1006-9.
Frautschy, SA; Yang, F; Irrizarry, M; Hyman, B; Saido, TC; Hsiao, K; Cole, GM. Microglial
response to amyloid plaques in APPsw transgenic mice. Am J Pathol, 1998 152, 307-17.
Frieda, S; Pearce, A; Wu, J; Silverstein, RL. Recombinant GST/CD36 fusion proteins define
a thrombospondin binding domain. Evidence for a single calcium-dependent binding site
on CD36. J Biol Chem, 1995 270, 2981-6.
Gao, S; Hendrie, HC; Hall, KS; Hui, S. The relationships between age, sex, and the incidence
of dementia and Alzheimer disease: a meta-analysis. Arch Gen Psychiatry, 1998 55, 80915.
Gasparini, L; Racchi, M; Binetti, G; Trabucchi, M; Solerte, SB; Alkon, D; Etcheberrigaray,
R; Gibson, G; Blass, J; Paoletti, R; Govoni, S. Peripheral markers in testing
pathophysiological hypotheses and diagnosing Alzheimer's disease. FASEB J, 1998 12,
17-34.
Giacobini, E; Becker, RE. One hundred years after the discovery of Alzheimer's disease. A
turning point for therapy? J Alzheimers Dis, 2007 12, 37-52.
Gibbs, RB; Aggarwal, P. Estrogen and basal forebrain cholinergic neurons: implications for
brain aging and Alzheimer's disease-related cognitive decline. Horm Behav, 1998 34, 98111.
Gibson, GE; Huang, HM. Oxidative processes in the brain and non-neuronal tissues as
biomarkers of Alzheimer's disease. Front Biosci, 2002 7, d1007-15.
Giunta, M; Camandola, S; Cella, SG; Mattson, M. Decreased expression of CD36 precedes
amyloid accumulation in the 3xTgAD mouse model of Alzheimers disease.
Abstractbook of Annual Meeting of Society for Neuroscience (San Diego) 2007a.
Giunta, M; Rigamonti, AE; Scarpini, E; Galimberti, D; Bonomo, SM; Venturelli, E; Mller,
EE; Cella, SG. The leukocyte expression of CD36 is low in patients with Alzheimer's
disease and mild cognitive impairment. Neurobiol Aging, 2007b 28, 515-8.
Glazier, AM; Scott, J; Aitman, TJ. Molecular basis of the Cd36 chromosomal deletion
underlying SHR defects in insulin action and fatty acid metabolism. Mamm Genome,
2002 13, 108-13.
Gordon, CM; LeBoff, MS; Glowacki, J. Adrenal and gonadal steroids inhibit IL-6 secretion
by human marrow cells. Cytokine, 2001 16, 178-86.
Granholm, AC; Ford, KA; Hyde, LA; Bimonte, HA; Hunter, CL; Nelson, M; Albeck, D;
Sanders, LA; Mufson, EJ; Crnic, LS. Estrogen restores cognition and cholinergic
phenotype in an animal model of Down syndrome. Physiol Behav, 2002 77, 371-85.
Granholm, AC; Sanders, L; Seo, H; Lin, L; Ford, K; Isacson, O. Estrogen alters amyloid
precursor protein as well as dendritic and cholinergic markers in a mouse model of Down
syndrome. Hippocampus, 2003 13, 905-14.
234
Greenwalt, DE; Lipsky, RH; Ockenhouse, CF; Ikeda, H; Tandon, NN; Jamieson, GA.
Membrane glycoprotein CD36: a review of its roles in adherence, signal transduction,
and transfusion medicine. Blood, 1992 80, 1105-15.
Heneka, MT; O'Banion, MK. Inflammatory processes in Alzheimer's disease. J
Neuroimmunol, 2007 184, 69-91.
Ho, GJ; Drego, R; Hakimian, E; Masliah, E. Mechanisms of cell signaling and inflammation
in Alzheimer's disease. Curr Drug Targets Inflamm Allergy, 2005 4, 247-56.
Hoenicka, J. Genes in Alzheimer's disease. Rev Neurol, 2006 42, 302-5.
Hori, T; Nakashima, T; Take, S; Kaizuka, Y; Mori, T; Katafuchi, T. Immune cytokines and
regulation of body temperature, food intake and cellular immunity. Brain Res Bull, 1991
27, 309-13.
Husemann, J; Loike, JD; Kodama, T; Silverstein, SC. Scavenger receptor class B type I (SRBI) mediates adhesion of neonatal murine microglia to fibrillar beta-amyloid. J
Neuroimmunol, 2001 114, 142-50.
Jacobs, DM; Tang, MX; Stern, Y; Sano, M; Marder, K; Bell, KL, Schofield, P; Dooneief, G;
Gurland, B; Mayeux, R. Cognitive function in nondemented older women who took
estrogen after menopause. Neurology, 1998 50, 368-73.
Kashiwagi, H; Tomiyama, Y; Kosugi, S; Shiraga, M; Lipsky, RH; Nagao, N; Kanakura, Y;
Kurata, Y; Matsuzawa, Y. Family studies of type II CD36 deficient subjects: linkage of a
CD36 allele to a platelet-specific mRNA expression defect(s) causing type II CD36
deficiency. Thromb Haemost, 1995 74, 758-63.
Kesslak, JP. Can estrogen play a significant role in the prevention of Alzheimer's disease? J
Neural Transm Suppl, 2002 62, 227-39.
Khalil, Z; LoGiudice, D; Khodr, B; Maruff, P; Masters, C. Impaired peripheral endothelial
microvascular responsiveness in Alzheimer's disease. J Alzheimers Dis, 2007 11, 25-32.
Kim, SU; de Vellis, J. Microglia in health and disease. J Neurosci Res, 2005 81, 302-13.
Krieger, M. Scavenger receptor class B type I is a multiligand HDL receptor that influences
diverse physiologic systems. J Clin Invest, 2001 108, 793-7.
Lambert, JC; Coyle, N; Lendon, C. The allelic modulation of apolipoprotein E expression by
oestrogen: potential relevance for Alzheimer's disease. J Med Genet, 2004 41, 104-12.
Lanni, C; Uberti, D; Racchi, M; Govoni, S; Memo, M. Unfolded p53: a potential biomarker
for Alzheimer's disease. J Alzheimers Dis, 2007 12, 93-9.
Laugerette, F; Passilly-Degrace, P; Patris, B; Niot, I; Febbraio, M; Montmayeur, JP; Besnard,
P. CD36 involvement in orosensory detection of dietary lipids, spontaneous fat
preference, and digestive secretions. J Clin Invest, 2005 115, 3177-84.
Leranth, C; Roth, RH; Elsworth, JD; Naftolin, F; Horvath, TL; Redmond, DE Jr. Estrogen is
essential for maintaining nigrostriatal dopamine neurons in primates: implications for
Parkinson's disease and memory. J Neurosci, 2000 20, 8604-9.
Leuner, K; Pantel, J; Frey, C; Schindowski, K; Schulz, K; Wegat, T; Maurer, K; Eckert, A;
Mller, WE. Enhanced apoptosis, oxidative stress and mitochondrial dysfunction in
lymphocytes as potential biomarkers for Alzheimer's disease. J Neural Transm Suppl,
2007 72, 207-15.
Maki, PM; Resnick, SM. Effects of estrogen on patterns of brain activity at rest and during
cognitive activity: a review of neuroimaging studies. Neuroimage, 2001 14, 789-801.
235
Maki, PM; Resnick, SM. Longitudinal effects of estrogen replacement therapy on PET
cerebral blood flow and cognition. Neurobiol Aging, 2000 21, 373-83.
Matsumoto, K; Hirano, K; Nozaki, S; Takamoto, A; Nishida, M; Nakagawa-Toyama, Y;
Janabi, MY; Ohya, T; Yamashita, S; Matsuzawa, Y. Expression of macrophage (Mphi)
scavenger receptor, CD36, in cultured human aortic smooth muscle cells in association
with expression of peroxisome proliferator activated receptor-gamma, which regulates
gain of Mphi-like phenotype in vitro, and its implication in atherogenesis. Arterioscler
Thromb Vasc Biol, 2000 20, 1027-32.
McEwen, B. Estrogen actions throughout the brain. Recent Prog Horm Res, 2002 57, 357-84.
McKhann, G; Drachman, D; Folstein, M; Katzman, R; Price, D; Stadlan, EM. Clinical
diagnosis of Alzheimer's disease: report of the NINCDS-ADRDA Work Group under the
auspices of Department of Health and Human Services Task Force on Alzheimer's
Disease. Neurology, 1984 34, 939-44.
Mecocci, P; Cherubini, A; Senin, U. Increased oxidative damage in lymphocytes of
Alzheimer's disease patients. J Am Geriatr Soc, 1997 45, 1536-7.
Metha, RR; Valcourt, L; Graves, J; Green, R; Das Gupta, TK. Subcellular concentrations of
estrone, estradiol, androstenedione and 17 beta-hydroxysteroid dehydrogenase (17-betaOH-SDH) activity in malignant and non-malignant human breast tissues. Int J Cancer,
1987 40, 305-8.
Meza-Munoz, DE; Fajardo, ME; Perez-Luque, EL; Malacara, JM. Factors associated with
estrogen receptors-alpha (ER-alpha) and -beta (ER-beta) and progesterone receptor
abundance in obese and non obese pre- and post-menopausal women. Steroids, 2006 71,
498-503.
Miller, DB; O'Callaghan, JP. Aging, stress and the hippocampus. Ageing Res Rev, 2005 4,
123-40.
Modrego, PJ. Predictors of conversion to dementia of probable Alzheimer type in patients
with mild cognitive impairment. Curr Alzheimer Res, 2006 3, 161-70.
Moore, KJ; El Khoury, J; Medeiros, LA; Terada, K; Geula, C; Luster, AD; Freeman, MW. A
CD36-initiated signaling cascade mediates inflammatory effects of beta-amyloid. J Biol
Chem, 2002 277, 47373-9.
Mor, G; Nilsen, J; Horvath, T; Bechmann, I; Brown, S; Garcia-Segura, LM; Naftolin, F.
Estrogen and microglia: A regulatory system that affects the brain. J Neurobiol, 1999 40,
484-96.
Morris, JC; Storandt, M; Miller, JP; McKeel, DW; Price, JL; Rubin, EH; Berg, L. Mild
cognitive impairment represents early-stage Alzheimers disease. Arch Neurol, 2001 58,
397-405.
Muccioli, G; Baragli, A; Granata, R; Papotti, M; Ghigo, E. Heterogeneity of ghrelin/growth
hormone secretagogue receptors. Toward the understanding of the molecular identity of
novel ghrelin/GHS receptors. Neuroendocrinology, 2007 86, 147-64.
Muller, EE. Steroids, cognitive processes and aging. Recenti Prog Med, 2001 92, 362-72.
Murialdo, G; Barreca, A; Nobili, F; Rollero, A; Rimossi, G; Granelli, MV; Copello, F;
Rodriguez, G; Polleri, A. Relationships between cortisol, dehydroepiandrosterone
sulphate and insulin-like growth factor-I system in dementia. J Endocrinol Invest, 2001
24, 139-46.
236
Nelson, LR; Bulun, SE. Estrogen production and action. J Am Acad Dermatol, 2001 45 (3
Suppl), S116-24.
Nicholson, AC. Expression of CD36 in macrophages and atherosclerosis: the role of lipid
regulation of PPARgamma signaling. Trends Cardiovasc Med, 2004 14, 8-12.
Nicholson, AC; Hajjar, DP. CD36, oxidized LDL and PPAR gamma: pathological
interactions in macrophages and atherosclerosis. Vascul Pharmacol, 2004 41, 139-46.
Nicholson, AC; Hajjar, DP. Herpesvirus in atherosclerosis and thrombosis: etiologic agents
or ubiquitous bystanders? Arterioscler Thromb Vasc Biol, 1998 18, 339-48.
Nilsson, LV. Incidence of severe dementia in an urban sample followed from 70 to 79 years
of age. Acta Psychiatr Scand, 1984 70, 478-86.
Nozaki, S; Kashiwagi, H; Yamashita, S; Nakagawa, T; Kostner, B; Tomiyama, Y; Nakata, A;
Ishigami, M; Miyagawa, J; Kameda-Takemura, K; et al.. Reduced uptake of oxidized low
density lipoproteins in monocyte-derived macrophages from CD36-deficient subjects. J
Clin Invest, 1995 96, 1859-65.
Onyango, IG; Khan, SM. Oxidative stress, mitochondrial dysfunction, and stress signaling in
Alzheimer's disease. Curr Alzheimer Res, 2006 3, 339-49.
Oquendo, P; Hundt, E; Lawler, J; Seed B. CD36 directly mediates cytoadherence of
Plasmodium falciparum parasitized erythrocytes. Cell, 1989 58, 95-101.
Packan, DR; Sapolsky, RM. Glucocorticoid endangerment of the hippocampus: tissue,
steroid and receptor specificity. Neuroendocrinology, 1990 51, 613-8.
Panossian, LA; Porter, VR; Valenzuela, HF; Zhu, X; Reback, E; Masterman, D; Cummings,
JL; Effros, RB. Telomere shortening in T cells correlates with Alzheimer's disease status.
Neurobiol Aging, 2003 24, 77-84.
Papassotiropoulos, A; Hock, C; Nitsch, RM. Genetics of interleukin 6: implications for
Alzheimer's disease. Neurobiol Aging, 2001 22, 863-71.
Petersen, RC. Normal aging, mild cognitive impairment, and early Alzheimers disease.
Neurologist, 1995 1, 326-44.
Pfeilschifter, J; Koditz, R; Pfohl, M; Schatz, H. Changes in proinflammatory cytokine
activity after menopause. Endocr Rev, 2002 23, 90-119.
Phillips, SM; Sherwin, BB. Effects of estrogen on memory function in surgically menopausal
women. Psychoneuroendocrinology, 1992 17, 485-95.
Pratic, D. Peripheral biomarkers of oxidative damage in Alzheimer's disease: the road
ahead. Neurobiol Aging, 2005 26, 581-3.
Puente-Navazo, MD; Daviet, L; Ninio, E; McGregor, JL. Identification on human CD36 of a
domain (155-183) implicated in binding oxidized low-density lipoproteins (Ox-LDL).
Arterioscler Thromb Vasc Biol, 1996 16, 1033-9.
Rac, ME; Safranow, K; Poncyljusz, W. Molecular basis of human CD36 gene mutations. Mol
Med, 2007 13, 288-96.
Rasmussen, JT; Berglund, L; Rasmussen, MS; Petersen, TE. Assignment of disulfide bridges
in bovine CD36. Eur J Biochem, 1998 257, 488-94.
Ren, Y; Silverstein, RL; Allen, J; Savill, J. CD36 gene transfer confers capacity for
phagocytosis of cells undergoing apoptosis. J Exp Med, 1995 181, 1857-62.
Ritchie, K; Kildea, D. Is senile dementia "age-related" or "ageing-related"?--evidence from
meta-analysis of dementia prevalence in the oldest old. Lancet, 1995 346, 931-4.
237
Rosenberg, PB. Clinical aspects of inflammation in Alzheimer's disease. Int Rev Psychiatry,
2005 17, 503-14.
Sala, G; Galimberti, G; Canevari, C; Raggi, ME; Isella, V; Facheris, M; Appollonio, I;
Ferrarese, C. Peripheral cytokine release in Alzheimer patients: correlation with disease
severity. Neurobiol Aging, 2003 24, 909-14.
Salem, ML. Estrogen, a double-edged sword: modulation of TH1- and TH2-mediated
inflammations by differential regulation of TH1/TH2 cytokine production. Curr Drug
Targets Inflamm Allergy, 2004 3, 97-104.
Sankaranarayanan, S. Genetically modified mice models for Alzheimer's disease. Curr Top
Med Chem, 2006 6, 609-27.
Santner, SJ; Ohlsson-Wilhelm, B; Santen, RJ. Estrone sulfate promotes human breast cancer
cell replication and nuclear uptake of estradiol in MCF-7 cell cultures. Int J Cancer,
1993 54, 119-24.
Sapolsky, RM; Stein-Behrens BA; Armanini, MP. Long-term adrenalectomy causes loss of
dentate gyrus and pyramidal neurons in the adult hippocampus. Exp Neurol, 1991 114,
246-9.
Sato, O; Kuriki, C; Fukui, Y; Motojima, K. Dual promoter structure of mouse and human
fatty acid translocase/CD36 genes and unique transcriptional activation by peroxisome
proliferator-activated receptor alpha and gamma ligands. J Biol Chem, 2002 277, 1570311.
Savill, J; Hogg, N; Ren, Y; Haslett, C. Thrombospondin cooperates with CD36 and the
vitronectin receptor in macrophage recognition of neutrophils undergoing apoptosis. J
Clin Invest, 1992 90, 1513-22.
Schindowski, K; Leutner, S; Mller, WE; Eckert, A. Age-related changes of apoptotic cell
death in human lymphocytes. Neurobiol Aging, 2000 21, 661-70.
Schlageter, NL; Carson, RE; Rapoport, SI. Examination of blood-brain barrier permeability
in dementia of Alzheimer type with (68Ga)EDTA and positron emission tomography. J
Cerebr Blood Flow Metab, 1987 7, 1-8.
Schott, JM; Kennedy, J; Fox, NC. New developments in mild cognitive impairment and
Alzheimer's disease. Curr Opin Neurol, 2006 19, 552-8.
Schreihofer, DA; Stoler, MH; Shupnik, MA. Differential expression and regulation of
estrogen receptors (ERs) in rat pituitary and cell lines: estrogen decreases ERalpha
protein and estrogen responsiveness. Endocrinology, 2000 141, 2174-84.
Sclafani, A; Ackroff, K; Abumrad, NA. CD36 gene deletion reduces fat preference and
intake but not post-oral fat conditioning in mice. Am J Physiol Regul Integr Comp
Physiol, 2007 293, R1823-32.
Serghides, L; Smith, TG; Patel, SN; Kain, KC. CD36 and malaria: friends or foes? Trends
Parasitol, 2003 19, 461-9.
Serretti, A; Olgiati, P; De Ronchi, D. Genetics of Alzheimer's disease. A rapidly evolving
field. J Alzheimers Dis, 2007 12, 73-92.
Shah, Y; Tangalos, EG; Petersen, RC. Mild cognitive impairment: when is it a precursor to
Alzheimers disease? Geriatrics, 2000 58; 272-76.
Sherman, IW; Eda, S; Winograd, E. Cytoadherence and sequestration in Plasmodium
falciparum: defining the ties that bind. Microbes Infect, 2003 5, 897-909.
238
Shumaker, SA; Legault, C; Kuller, L; Rapp, SR; Thal, L; Lane, DS; Fillit, H; Stefanick, ML;
Hendrix, SL; Lewis, CE; Masaki, K; Coker, LH; Women's Health Initiative Memory
Study. Conjugated equine estrogens and incidence of probable dementia and mild
cognitive impairment in postmenopausal women: Women's Health Initiative Memory
Study. JAMA, 2004 291, 2947-58.
Shumaker, SA; Legault, C; Rapp, SR; Thal, L; Wallace, RB; Ockene, JK; Hendrix, SL;
Jones, BN 3rd; Assaf, AR; Jackson, RD; Kotchen, JM; Wassertheil-Smoller, S;
Wactawski-Wende, J; WHIMS Investigators. Estrogen plus progestin and the incidence
of dementia and mild cognitive impairment in postmenopausal women: the Women's
Health Initiative Memory Study: a randomized controlled trial. JAMA, 2003 289, 265162.
Silverstein, RL; Asch, AS; Nachman, RL. Glycoprotein IV mediates thrombospondindependent platelet-monocyte and platelet-U937 cell adhesion. J Clin Invest, 1989 84,
546-52.
Simpson, ER. Sources of estrogen and their importance. J Steroid Biochem Mol Biol, 2003
86, 225-30.
Smith, JD; Levin-Allerhand, JA. Potential use of estrogen-like drugs for the prevention of
Alzheimer's disease. J Mol Neurosci, 2003 20, 277-81.
Srivastava, RA; Jain, JC. Scavenger receptor class B type I expression and elemental analysis
in cerebellum and parietal cortex regions of the Alzheimer's disease brain. J Neurol Sci,
2002 196, 45-52.
Steinerman, JR; Honig, LS. Laboratory biomarkers in Alzheimer's disease. Curr Neurol
Neurosci Rep, 2007 7, 381-7.
Stieler, JT; Lederer, C; Brckner, MK; Wolf, H; Holzer, M; Gertz, HJ; Arendt, T.
Impairment of mitogenic activation of peripheral blood lymphocytes in Alzheimer's
disease. Neuroreport, 2001 12, 3969-72.
Strittmatter, WJ. Apolipoprotein E and Alzheimers disease: signal transduction mechanisms.
Biochem Soc Symp, 2001 67, 101-9.
Sunderland, T; Linker, G; Mirza, N; Putnam, KT; Friedman, DL; Kimmel, LH; Bergeson, J;
Manetti, GJ; Zimmermann, M; Tang, B; Bartko, JJ; Cohen, RM. Decreased betaamyloid1-42 and increased tau levels in cerebrospinal fluid of patients with Alzheimer
disease. JAMA, 2003 89, 2094-103.
Tan, ZS; Beiser, AS; Vasan, RS; Roubenoff, R; Dinarello, CA; Harris, TB; Benjamin, EJ;
Au, R; Kiel, DP; Wolf, PA; Seshadri, S. Inflammatory markers and the risk of Alzheimer
disease: the Framingham Study. Neurology, 2007 68, 1902-8.
Tandon, NN; Kralisz, U; Jamieson, GA. Identification of glycoprotein IV (CD36) as a
primary receptor for platelet-collagen adhesion. J Biol Chem, 1989 264, 7576-83.
Tang, Y; Taylor, KT; Sobieski, DA; Medved, ES; Lipsky, RH. Identification of a human
CD36 isoform produced by exon skipping. Conservation of exon organization and premRNA splicing patterns with a CD36 gene family member, CLA-1. J Biol Chem, 1994
269, 6011-5.
Tanji, K; Mori, F; Imaizumi, T; Yoshida, H; Satoh, K; Wakabayashi, K. Interleukin-1
induces tau phosphorylation and morphological changes in cultured human astrocytes.
Neuroreport, 2003 14, 413-7.
239
Thomas, T; Rhodin, J. Vascular actions of estrogen and Alzheimer's disease. Ann N Y Acad
Sci, 2000 903, 501-9.
Trigatti, B; Covey, S; Rizvi, A. Scavenger receptor class B type I in high-density lipoprotein
metabolism, atherosclerosis and heart disease: lessons from gene-targeted mice. Biochem
Soc Trans, 2004 32, 116-20.
Turgeon, JL; Carr, MC; Maki, PM; Mendelsohn, ME; Wise, PM. Complex actions of sex
steroids in adipose tissue, the cardiovascular system, and brain: Insights from basic
science and clinical studies. Endocr Rev, 2006 27, 575-605.
Vallee, M; Mayo, W; Le Moal, M. Role of pregnenolone, dehydroepiandrosterone and their
sulfate esters on learning and memory in cognitive aging. Brain Res Brain Res Rev, 2001
37, 301-12.
Verdier, Y; Penke, B. Binding sites of amyloid beta-peptide in cell plasma membrane and
implication for Alzheimers disease. Curr Protein Pept Sci, 2004 5, 19-31.
Vermeulen, A; Kaufman, JM; Goemaere, S; van Pottelberg, I. Estradiol in elderly men. Aging
Male, 2002 5, 98-102.
Ward, M. Biomarkers for Alzheimer's disease. Expert Rev Mol Diagn, 2007 7, 635-46.
Wyss-Coray, T. Inflammation in Alzheimer disease: driving force, bystander or beneficial
response? Nat Med, 2006 12, 1005-15.
Yamamoto, N; Akamatsu, N; Sakuraba, H; Yamazaki, H; Tanoue, K. Platelet glycoprotein IV
(CD36) deficiency is associated with the absence (type I) or the presence (type II) of
glycoprotein IV on monocytes. Blood, 1994 83, 392-7.
Yen, SS; Morales, AJ; Khorram, O. Replacement of DHEA in aging men and women.
Potential remedial effects. Ann N Y Acad Sci, 1995 774, 128-42.
Yudt, MR; Cidlowski, JA. The glucocorticoid receptor: coding a diversity of proteins and
responses through a single gene. Mol Endocrinol, 2002 16, 1719-26.
Zandi, PP; Carlson, MC; Plassman, BL; Welsh-Bohmer, KA; Mayer, LS; Steffens, DC;
Breitner, JC; Cache County Memory Study Investigators. Hormone replacement therapy
and incidence of Alzheimer disease in older women: the Cache County Study. JAMA,
2002 288, 2123-9.
Zhu, X; Lee, HG; Raina, AK; Perry, G; Smith, MA. The role of mitogen-activated protein
kinase pathways in Alzheimer's disease. Neurosignals, 2002 11, 270-81.
Chapter IX
ABSTRACT
Correspondence concerning this article should be addressed to: Dr. Gjumrakch Aliev, M.D., Ph.D.,
Department of Biology & Electron Microscopy Research Center, College of Sciences, The University of
Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249-1664. Phone: 210.458.4518; Fax:
210.458.4506; E-mail: [email protected], [email protected]
242
1. INTRODUCTION
The finding of amyloid (A) deposition in Alzheimers disease (AD) brains after death
led to the so-called amyloid hypothesis. For over a decade, the amyloid hypothesis has so
influenced and guided research in the field of Alzheimers dementia that many workers
regard it as the gold standard of scientific investigation. Indeed, most of the literature claims
that AD is caused by A deposition within structures called senile plaques. The formation of
these plaques are purported to lead to further abnormalities within the surrounding nerve
cells, eventually killing them. However, there is little evidence to support this claim and
ample evidence to question it. For example, the amyloid hypothesis has been criticized
because research findings up to now have not generated any benefits in the clinical
243
management and treatment of AD patients nor have they advanced an understanding of how
the elderly are preferentially affected. The three main flaws of the hypothesis appear to be
that: (1) A deposition has not been found to be toxic or to cause the damage and death of
cerebrally located nerve cells in humans or animals; (2) the brains of many aged, but
cognitively normal individuals show abundant A-containing senile plaques but no clinical
signs of Alzheimers disease; and (3) since there is general agreement that A-containing
senile plaques are the products of degenerating neurons, they can not be the cause, since it is
axiomatic that a product is the result, not the cause of some activity.
By contrast, and as presented throughout this chapter, there is now considerable evidence
indicating that non-genetic AD is a vascular disorder whose underlying cause is impaired
blood flow to the brain during advanced aging. This evidence can be summarized as follows:
(1) numerous epidemiological studies link AD risk factors such as stroke, heart disease,
hypertension, and atherosclerosis to reduced cerebral blood flow; (2) evidence that AD and
vascular dementia (VaD), an acknowledged vascular disorder, share practically all the same
risk factors and may benefit from the same treatments; (3) drug therapies reported to improve
AD symptoms (including prescriptive drugs now available for AD) all increase blood flow to
the brain; (4) people who are likely to develop AD but do not yet show dementia symptoms
can be identified by using brain blood flow measurements and brain PET scans; (5) the
clinical symptoms are very similar in most AD and VaD patients; (6) parallel abnormalities
such as A-laden plaques found in AD and VaD patients occur in both brain vessels and
brain tissue; (7) low levels of brain blood flow in aged humans and animal models can lead to
abnormal cell metabolism, tissue damage, and memory problems independent of A; (8) mild
cognitive impairment (a term used to describe a preliminary stage leading to AD) can convert
equally to AD or VaD; and (9) small vessel damage is present in the majority of AD brains
after death.
For these reasons, it is suggested that AD be reclassified as a vascular disorder and
described as a vasocognopathy. The term aptly describes the origin of the disease (vaso:
vessel blood flow), its primary effect on a system (-cogno: relating to mental ability), and its
clinical course (-pathy: disorder). Reclassification of AD from a neurodegenerative to a
vascular disorder would speed the development of truly beneficial treatments or a cure,
improve patient management, provide earlier diagnoses, and reduce the number of AD cases
in the future by aggressively treating the risk factors that can promote this dementia.
In conclusion, a bare-bones examination of the literature reveals no compelling evidence
that A deposition causes AD or that it results in significant damage to brain cells. By
contrast, the findings that support AD as a primary vascular disorder are substantially more
compelling. Determining the mechanisms behind these imbalances in experimental animals
will provide crucial information in the development of new, more effective therapies for the
treatment of atherosclerosis, including cerebrovascular athero- and arteriosclerosis. Because
the cerebrovascular pathology found in mild cognitive impairment (MCI) and AD leads to
mental deterioration and progressive neurodegeneration, the mechanism of its formation
deserves special attention. Therefore, pharmacological intervention aimed at correcting
chronic brain hypoperfusion will also be useful for treating and preventing dementing
neurodegeneration (see scheme below).
244
Scheme: Possible Pathogenetic Mechanisms of the Effect of Vascular Hypoperfusion During Aging and
During the Development of Stroke and AD (Copyright permission from Aliev G. et al., Neurotox
Res. 2003; 5(7):491-504).
245
246
(NFTs) and senile plaques (SPs) in AD [10,14,18,19,28-30] and in post-ischemic tissues [3135].
Vascular aging is associated with both structural and functional changes that can take
place at the level of the endothelium, the vascular smooth muscle cells (vSMCs), and the
extracellular matrix of blood vessels. In the endothelium, reduced vasodilatation in response
to agonists occurs in large conduit arteries and in resistance arteries as a result of aging [36].
Furthermore, enhanced oxidative stress by hypoperfusion contributes significantly to the
deleterious effects of aging on the endothelium by means of NO breakdown due to ROS. The
relative contribution of the above phenomenon to age-related endothelial dysfunction is
highly dependent on the species and the type of vascular bed involved [3,36-38].
A deposits, one of the hallmark features of AD, are present in cortical and subcortical
gray matter and in meningeal and gray matter blood vessels (congophilic angiopathy) [39,40].
In vitro experimental evidence indicates that these A deposits induce cerebrovascular
dysfunction in the rat brain [41] and that the A peptide produces endothelial dysfunction in
cerebral microvessels via ROS. The ROS prevent endothelium-dependent vasodilation by
interacting with NO to form products that are no longer able to trigger vessel smooth muscle
relaxation; ROS-scavenging enzymes should prevent this inhibition [41]. Accumulating
evidence also supports the idea that the A peptide is responsible for the cerebrovascular
effects of amyloid protein precursor (APP) overexpression [42,43]. A study by Iadecola
and coworkers demonstrated that transgenic mice overexpressing APP have a profound and
selective impairment in endothelium-dependent regulation of the neocortical
microcirculation. This indicates that peptides derived from APP processing may contribute
to alterations in cerebral blood flow (CBF) and neuronal dysfunction during AD [42].
Although amyloid 1-40 (A1-40) did not influence the increasing CBF produced by
endothelium-independent vasodilators and hypercapnia, it did contribute to the attenuation of
the resting CBF as well as the increasing CBF produced by endothelium-dependent
vasodilators. In contrast, A1-42 had the exact opposite effect; although it did not lessen the
resting CBF or the increasing CBF produced by endothelium-dependent vasodilators, it could
influence the increasing CBF produced by endothelium-independent vasodilators and
hypercapnia. The superoxide scavengers SOD and MnTBAP (superoxide dismutase and
Manganese (III) tetrakis (4-benzoic acid) porphyrin) reversed the cerebrovascular effects of
A1-40. This data strongly suggests that A1-40, but not A1-42, produces the
cerebrovascular alterations seen in APP transgenic mice, and that A1-40 could therefore
play a role in the cerebrovascular alterations observed in Alzheimer's dementia [40,43].
Moreover, this study supports the recent evidence demonstrating that brain microvessels
isolated from cases of AD have the ability to kill neurons in vitro [44]. However, despite all
of the research focused on A (which, in the later stages of AD progression eventually
becomes a source of ROS in vivo [4]), the relationship of its effects to hypoperfusion is still
not completely understood.
247
4. NEUROPATHOLOGICAL FEATURES OF
CEREBROVASCULAR LESIONS AND AD
Several morphometric features of BBB dysfunction in patients with pathologically
confirmed AD have been reported [45]. Accumulation of A deposits around vessels in AD
brain biopsy samples may be an indication of a breach in the BBB during AD progression
[45-47]. Recent findings [47] strongly support the hypothesis that structural or physiological
abnormalities of the BBB itself may represent a seminal pathogenic event during the
development of AD, thereby leading to vascular amyloid deposition in the brain [15,45,48].
The heterogeneous pathology of AD is due to variability in the nature and severity of
vascular lesions as well as to its co-existence with cerebrovascular diseases such as
cerebrovascular arteriosclerosis (CVA) [49]. For example, significantly higher densities of
A immunoreactive plaques are present in AD with CVA as compared to AD alone [49]. The
A deposits in SPs and cerebrovascular angiopathy are derived from APP expressed in
neurons and in a variety of non-neuronal cells (some outside of the central nervous system)
[50-54]. Perivascular A deposition may be a risk factor for reduced regional CBF (rCBF)
[55]. The age-related losses of mechanisms/cells that are capable of removing A deposits
involve subtle molecular alterations in components of the basement membrane that allow it to
then bind A and protect it from cellular degradation [56]. These alterations, along with the
activation of non-neuronal cells such as microglia, further contribute to neuronal damage
[57].
Several factors that may ameliorate AD have either been associated with improved CBF
or have prevented CBF decline [55]. The direct relationship between vascular changes in the
brain and the pathology of AD is based on ultrastructural studies that reveal widespread
penetration of A deposits by degenerating microvessels [39,40]. However, numerous
morphometric studies have demonstrated that endothelial cell (EC) contact with the vast
majority of SPs are by chance, and while it is not unusual to show a close proximity in the
highly vascular brain [58], there is an actual exclusion of vessels from most SPs. It is also
clear that a certain subpopulation of SPs shows a real and intimate relationship with the
vasculature [58,59]. It is likely that SPs have more than one origin [60,61], and that vessels
are probably integrally involved in the formation of one or more subpopulations. In over 90%
of AD cases, A can be detected in at least some vessels [62], and the sources of this A are
likely vascular ECs and SMCs rather than neurons, since ECs and SMCs show an abundant
APP immunoreactivity [47,58,63,64]. Ultrastructural studies on blood vessels containing A
deposits have shown their intermittent associations with membrane abnormalities of SMCs
[60,61]. Indeed, in AD cases with a clinical history of cerebral bleeding, the muscle layer is
sometimes completely replaced by A deposits [58,63,64]. This finding suggests that
vascular wall cell alterations such as EC damage and muscle cell atrophy may occur in AD,
even in the absence of visible A depositions, and implies that the vascular system is a
primary target for the development of this disease.
248
249
[3,38,79] as well as AD [80], may be linked to AD via its effects on the vasculature
[1,2,49,81].
Thomas and coworkers determined the percentage of cerebral microvessels in the
temporal cortex and parahippocampal gyrus that were associated with the predominant A142 form of the A peptide in clinically and pathologically confirmed cases of AD [75].
Surprisingly, double immunostaining methods found that at least 40% of the microvessels in
the two brain regions contained A1-42 deposits [75]. However, there was no correlation of
such localization with the ApoE genotype, although E4 homozygotes revealed a greater A140 burden. Observations suggest that a high proportion of cortical microvessels are associated
with A1-42, which may affect microvascular function [75]. Moreover, higher levels of low
density lipoproteins (LDL) and ApoB in total serum are associated with increased deposition
of A in demented individuals with neuropathologically confirmed AD [82]. These findings
indicate a key role for vascular abnormalities in the pathogenesis of AD. Since chronic
hypoxia/hypoperfusion, A depositions, and AD are all maladies with similarities to
atherosclerosis, one would expect them to share risk factors [1,2,47]. Likewise, one would
also expect that the same preventive interventions would alleviate their symptoms [47,82].
Hyperlipoproteinemia is associated with the impairment of NO-mediated, endotheliumdependent dilation [70]. Galle and coworkers [70] demonstrated that oxidized lipoprotein(a)
impairs endothelium-dependent dilation and is more potent than oxidized LDL in this effect.
Comparisons between ventricular fluid (VF) lipoproteins isolated from AD patients and nondemented age-matched patients show that cerebrospinal fluid (CSF) lipoprotein metabolism
is altered in AD [83]. These data support the hypothesis that there is a direct relationship
between vascular and lipoprotein abnormalities in AD. The positive linear relationship
between AD and fat intake is additionally relevant [11,84]. A recent study [85] showed direct
evidence linking cholesterol metabolism and the development of AD in a transgenic mouse
model. This work also indicated that diet-induced hypercholesterolemia results in
significantly increased levels of formic acid-extractable A peptides in the central nervous
system (CNS) of AD mice. The total level of A was strongly correlated with the level of
cholesterol in both the plasma and CNS. The A level also correlated with the number and
size of amyloid deposits [85]. These data demonstrate that dietary cholesterol increases A
accumulation and accelerates AD-related pathology in animals. In addition, these findings
demonstrate that the ultrastructural features of vascular lesions and mitochondria in brain
vascular wall cells from biopsy, human short postmortem brain tissues, and transgenic mice
overexpressing APP [yeast artificial chromosome (YAC R140) and C57B6/SJL transgenic
positive (Tg+) mice] all have the same pattern [47]. In situ hybridization using probes for
human normal, a 5kb-deleted fragment, and mouse mitochondrial DNA (mtDNA) as well as
immunocytochemistry using antibodies against APP, 8-hydroxy-2-guanosine (8OHG),
cytochrome c oxidase subunit 1 (COX), and lipoic acid revealed similar patterns of
ultrastructural localization [47,86]. There was a higher degree of amyloid deposition in the
vascular walls of human AD and YAC and C57B6/SJL Tg+ mice compared to aged-matched
controls [47]. In addition, vessels with more severe lesions showed immunopositive staining
for APP and possessed large, lipid-laden vacuoles in the cytoplasm of ECs. Significantly
more mitochondrial abnormalities were seen in human AD microvessels as well as YAC and
C57B6/SJL Tg+ mouse microvessels where lesions occurred [47]. In situ hybridization using
250
normal and chimera (5 kb) mtDNA probes revealed positive signals in severely damaged
mitochondria located in the vascular endothelium and in perivascular cells of lesioned
microvessels close to regions of A deposition. These features were absent in undamaged
regions of human AD tissues, YAC and C57B6/SJL Tg+ mouse tissues, and in age-matched
control subjects. In addition, vessels with atherosclerotic lesions revealed endothelium and
perivascular cells possessing clusters of normal and deleted mtDNA [47]. These mtDNA
deletions were accompanied by increased amounts of immunoreactive APP, 8OHG, and
COX in the same cellular compartment [47]. The above correlative observations demonstrate
that vascular wall cells, especially their mitochondria, appear to be central targets for
oxidative stress-induced damage before the development of AD pathology [47]. On the other
hand, the positive correlation between AD and cholesterol levels suggests that antioxidant
therapy and cholesterol lowering drugs could delay the occurrence of AD [87,88]. However,
despite their frequencies, the pathophysiological and morphological changes in brain
microcirculation that accompany AD remain poorly understood, and the specific factor
controlling vascular tone in AD is unknown.
251
Figures 1-11.
252
Recent observations by Cormier and coworkers have shown the effect of nicotine on rat
brain mitochondria [104]. The polarographic studies determined the effects on the respiratory
chain, whereas enzymatic assays and [3H]-nicotine binding allowed them to precisely
identify its target and site of action. Measurement of oxygen consumption showed a
significant concentration-dependent inhibition by nicotine. Nicotine bound to complex I of
the respiratory chain and inhibited the NADH-Ubiquinone reductase activity [104]. This
study also showed that nicotine and NADH compete for complex I [104]. Effects of cotinine,
the main nicotine metabolite, and nornicotine were also studied. Nornicotine inhibited
mitochondrial respiration whereas cotinine did not. Complex I generates superoxide anion,
and nicotine was able to inhibit ROS generation [104]. This may explain, in part, the
beneficial and protective effects of nicotine in a few neurodegenerative diseases, as suggested
by many epidemiological studies (see the review by Cormier and colleagues for more detail
[104]). However, more studies need to be done to determine the effect of nicotine on
mitochondrial functions as well as on DNA overexpression and/or deletion during the
development of AD and other neurodegenerative disorders. The exact cellular mechanisms
behind vascular lesions and their relation to oxidative stress markers identified by RNA
oxidation, lipid peroxidation, or mtDNA deletion remain unknown. Future studies comparing
AD damage with the spectrum of oxidative stress-induced damage during reperfusion injury
or, more importantly, during hypoxia/hypoperfusion are warranted.
253
mitochondrial-derived lysosomes of neurons, vascular wall cells (Figures 22-23), and glia in
regions closely associated with lipofuscin.
Figures 12-21.
This evidence suggests that, at least within APP YAC mice, proliferation, deletion, and
duplication of mtDNA occurs most numerously in mitochondria that have been fused with
lysosomes [26,47,106] (Figures 22-23). Biopsy samples from human AD brains were
dominated by abnormal mitochondria in comparison to a control group (Figures 11 and 21).
In situ hybridization with a chimeric cDNA probe for the 5kb common deletion indicated that
the 5kb-mtDNA is increased at least threefold in AD neurons as compared to control cases
(Figure 21). In quantitative analysis of the mtDNA deletion and 8OHG in the same cases, we
found a strong positive correlation (r=0.934; Figure 17). Ultrastructural localization of
mtDNA in situ hybridization with colloidal gold showed that deleted mtDNA is mainly found
in abnormal mitochondria (see Figures 20 and 21). Only hippocampal and cortical vulnerable
neurons showed immunopositive staining for 8OHG in AD [47,26,106,113-115] (Figure 21).
In addition, capillary ECs and perivascular pericytes showed a high level of 8OHG
immunostaining [47,26,106,112]. This data strongly indicates that the oxidative stress
markers seen in the AD brain selectively affect the population of vulnerable neurons,
vascular ECs, and perivascular cells, further implying that oxidative stress-induced
hypoperfusion plays a key role in the pathogenesis of AD. Moreover, our recent study of
ApoE4 overexpression on cerebral blood flow (CBF) as a possible initiator of brain
hypoperfusion using ApoE 4 transgenic mice compared to age-matched WT mice
254
demonstrated that any neuronal, glial, and microvascular pathology is associated with
significantly increased cristae and mitochondria-derived lysosomes (Figures 22-23).
Figure 22. Ultrastructural changes of cortical microvessels from young (A-B) and aged (C-D) ApoE4
Tg mice. Microvessels from young ApoE4 mice show the stress reaction of vascular endothelium.
Destruction was also seen in the matrix of perivascular nerve terminals (arrow) and perivascular cells
(indicated by double asterisk). Magnification: A) 25,000; B) 5,000; C) 10,000; D) 20,000 (Copyright
permission from Shenk J.C. et al., J. Neurological Sciences, 2008, in press).
255
Figure 23. Ultrastructural feature of age-associated neuronal mitochondrial change in ApoE4 Tg(+)
mice. Mitochondria-derived lysosome association with lipofuscin appears to be the main feature of
mitochondrial damage. Arrowhead: Mitochondria-derived lysosomes. Asterisk: Normal mitochondria.
Double Arrowhead: Hypoxic (electron-dense) mitochondria. Magnification: A and B) 20,000; C)
25,000; D) 15,000 (Copyright permission from Shenk J.C. et al., J. Neurological Sciences, 2008, in
press).
9. CONCLUSIONS
Certainly we are only just beginning to dissect the relationship between
neurodegenerative diseases like Alzheimers and other age-related disorders such as
atherosclerosis and stroke. However, it is already apparent that chronic vascular
hypoperfusion is a seminal characteristic common to each of their etiologies. Chronic
hypoperfusion appears to be a central initiating factor for vascular abnormality,
mitochondrial damage, and an imbalance in the activity of NOS isoforms, ET-1, oxidative
stress markers, mtDNA and mitochondrial enzymes in the vascular wall and in brain
parenchymal cells predominantly in CVA and AD. This imbalance augments chronic
hypoperfusion and follows oxidative stress. Therefore, determining the mechanisms behind
these imbalances may provide crucial information in the development of new, more effective
therapies for stroke and AD patients in the near future.
256
Future studies must seek to answer the following questions: (1) What are the major
factors altering and/or controlling cerebral blood flow during accumulation of chronic
hypoperfusion and/or the development of atherosclerotic changes in brain microvessels? (2)
What are the roles of vasoactive substances (namely NO and ET-1) during the development
of these changes? (3) Does chronic hypoperfusion with concomitant oxidative stress
accelerate vascular and neuronal lesions (including mtDNA deletions) during normal aging
and/or when the brain is exposed to chronic hypoxia?
Resolving these issues will allow for novel therapeutic approaches that will modify the
natural history of these chronic disorders associated with aging.
ACKNOWLEDGEMENTS
Supported by the Philip Morris USA Research Management Group and Alzheimers
Association (IIRG).
REFERENCES
[1]
257
[12] Smith, M.A., Richey Harris, P.L., Sayre, L.M., et al. (1997b). Widespread
peroxynitrite-mediated damage in Alzheimer's disease. The Journal of Neuroscience,
17, 2653-2657.
[13] Smith, M.A., Vasak, M., Knipp, M., et al. (1998). Dimethylargininase, a nitric oxide
regulatory protein in Alzheimer disease. Free Radical Biology and Medicine, 25, 898902.
[14] Smith, M.A., Rottkamp, C.A., Nunomura, A., et al. (2000). Oxidative stress in
Alzheimer's disease. Biochimica et Biophysica Acta, 1502, 139-144.
[15] Prelli, F., Castano, E.M., van Duinen, S.G., et al. (1988). Different processing of
Alzheimer's beta-protein precursor in the vessel wall of patients with hereditary
cerebral hemorrhage with amyloidosis-Dutch type. Biochemical and Biophysical
Research Communications, 151, 1150-1155.
[16] Lovell, M.A., Xie, C., and Markesbery, W.R. (1998). Decreased glutathione transferase
activity in brain and ventricular fluid in Alzheimer's disease. Neurology, 51, 15621566.
[17] Prasad, M.R., Lovell, M.A., Yatin, M., et al. (1998). Regional membrane phospholipid
alterations in Alzheimer's disease. Neurochemical Research, 23, 81-88.
[18] Markesbery, W.R. (1997). Oxidative stress hypothesis in Alzheimer's disease. Free
Radical Biology & Medicine, 23, 134-147.
[19] Markesbery, W.R. and Carney, J.M. (1999). Oxidative alterations in Alzheimer's
disease. Brain Pathology, 9, 133-146.
[20] Mecocci, P., MacGarvey, U., Kaufman, A.E., et al. (1993). Oxidative damage to
mitochondrial DNA shows marked age-dependent increases in human brain. Annals of
Neurology, 34, 609-616.
[21] Mecocci, P., MacGarvey, U., and Beal, M.F. (1994). Oxidative damage to
mitochondrial DNA is increased in Alzheimer's disease. Annals of Neurology, 36, 747751.
[22] Mecocci, P., Beal, M.F., Cecchetti, R., et al. (1997). Mitochondrial membrane fluidity
and oxidative damage to mitochondrial DNA in aged and AD human brain. Molecular
and Chemical Neuropathology, 31, 53-64.
[23] Nunomura, A., Perry, G., Hirai, K., et al. (1999a). Neuronal RNA oxidation in
Alzheimer's disease and Down's syndrome. Annals of the New York Academy of
Sciences, 893, 362-364.
[24] Nunomura, A., Perry, G., Pappolla, M.A., et al. (1999b). RNA oxidation is a prominent
feature of vulnerable neurons in Alzheimer's disease. The Journal of Neuroscience, 19,
1959-1964.
[25] Nunomura, A., Perry, G., Aliev, G., et al. (2001). Oxidative damage is the earliest event
in Alzheimer disease. Journal of Neuropathology and Experimental Neurology, 60,
759-767.
[26] Aliev, G., Smith, M.A., Seyidova, D., et al. (2002a). The role of oxidative stress in the
pathophysiology of cerebrovascular lesions in Alzheimer's disease. Brain Pathology,
12, 21-35.
258
[27] Smith, M.A., Taneda, S., Richey, P.L., et al. (1994). Advanced Maillard reaction end
products are associated with Alzheimer disease pathology. Proceedings of the National
Academy of Sciences of the United States of America, 91, 5710-5714.
[28] Smith, M.A., Sayre, L.M., and Perry, G. (1996). Is Alzheimer's a disease of oxidative
stress? Alzheimer's Disease Review, 1, 63-67.
[29] Sayre, L.M., Zelasko, D.A., Harris, P.L., et al. (1997). 4-Hydroxynonenal-derived
advanced lipid peroxidation end products are increased in Alzheimer's disease. Journal
of Neurochemistry, 68, 2092-2097.
[30] Perry, G., Nunomura, A., Hirai, K., et al. (2000). Oxidative damage in Alzheimer's
disease: the metabolic dimension. International Journal of Developmental
Neuroscience, 18, 417-421.
[31] Granger, D.N., Benoit, J.N., Suzuki, M., et al. (1989). Leukocyte adherence to venular
endothelium during ischemia-reperfusion. The American Journal of Physiology, 257,
G683-G688.
[32] Cirillo, R., Salvatico, E., Aliev, G., et al. (1992). Effect of cloricromene during
ischemia and reperfusion of rabbit hindlimb: evidence for an involvement of leukocytes
in reperfusion-mediated tissue and vascular injury. Journal of Cardiovascular
Pharmacology, 20, 969-975.
[33] Cirillo, R., Aliev, G., Hornby, E.J., et al. (1994). Endothelium as a therapeutical target
in peripheral occlusive arterial diseases: consideration for pharmacological
interventions. Pharmacological Research, 29, 293-311.
[34] Salvatico, E., Aliev, G.M., Novello, D., et al. (1994). Functional depression of isolated
perfused rat heart mediated by activated leukocytes: protective effect of cloricromene.
Journal of Cardiovascular Pharmacology, 24, 638-647.
[35] Sala, A., Aliev, G.M., Rossoni, G., et al. (1996). Morphological and functional changes
of coronary vasculature caused by transcellular biosynthesis of sulfidopeptide
leukotrienes in isolated heart of rabbit. Blood, 87, 1824-1832.
[36] Matz, R.L., Schott, C., Stoclet, J.C., et al. (2000). Age-related endothelial dysfunction
with respect to nitric oxide, endothelium-derived hyperpolarizing factor and
cyclooxygenase products. Physiological Research, 49, 11-18.
[37] Stewart-Lee, A.L., Ferns, G.A., and Anggard, E.E. (1995). Differences in onset of
impaired endothelial responses and in effects of vitamin E in the hypercholesterolemic
rabbit carotid and renal arteries. Journal of Cardiovascular Pharmacology, 25, 906913.
[38] Aliev, G. and Burnstock, G. (1998b). Watanabe rabbits with heritable
hypercholesterolaemia: a model of atherosclerosis. Histology and Histopathology, 13,
797-817.
[39] Kalaria, R.N. (1999). The blood-brain barrier and cerebrovascular pathology in
Alzheimer's disease. Annals of the New York Academy of Sciences, 893, 113-125.
[40] Kalaria, R.N. (2000). The role of cerebral ischemia in Alzheimer's disease.
Neurobiology of Aging, 21, 321-330.
[41] Price, J.M., Sutton, E.T., Hellermann, A., et al. (1997). beta-Amyloid induces
cerebrovascular endothelial dysfunction in the rat brain. Neurological Research, 19,
534-538.
259
[42] Iadecola, C., Zhang, F., Niwa, K., et al. (1999). SOD1 rescues cerebral endothelial
dysfunction in mice overexpressing amyloid precursor protein. Nature Neuroscience, 2,
157-161.
[43] Niwa, K., Carlson, G.A. and Iadecola, C. (2000). Exogenous A beta1-40 reproduces
cerebrovascular alterations resulting from amyloid precursor protein overexpression in
mice. Journal of Cerebral Blood Flow and Metabolism, 20, 1659-1668.
[44] Grammas, P., Moore, P., and Weigel, P.H. (1999). Microvessels from Alzheimer's
disease brains kill neurons in vitro. The American Journal of Pathology, 154, 337-342.
[45] Stewart, P.A., Hayakawa, K., Akers, M.A., et al. (1992). A morphometric study of the
blood-brain barrier in Alzheimer's disease. Laboratory Investigation, 67, 734-742.
[46] Aliev, G., Smith, M.A., Vinters, H., et al. (1999). Mitochondria abnormalities mark
vulnerable neurons in Alzheimer's disease. Journal of Neuropathology and
Experimental Neurology, 58, 511.
[47] Aliev G., Seyidova D., Lamb B.T., et al. (2002). Atherosclerotic lesions and
mitochondria DNA deletions in brain microvessels as a central target for the
development of human AD and AD-like pathology in a aged YAC APP transgenic
mice. Annals of the New York Academy of Sciences, 977, 1-20.
[48] Vinters, H.V., Miller, B.L., and Pardridge, W.M. (1988). Brain amyloid and Alzheimer
disease. Annals of Internal Medicine, 109, 41-54.
[49] Etiene, D., Kraft, J., Ganju, N., et al. (1998). Cerebrovascular pathology contributes to
the heterogeneity of Alzheimer's disease. Journal of Alzheimer's Disease, 1, 119-134.
[50] Selkoe, D.J. (1994). Cell biology of the amyloid beta-protein precursor and the
mechanism of Alzheimer's disease. Annual Review of Cell Biology, 10, 373-403.
[51] Octave, J.N. (1995). The amyloid peptide precursor in Alzheimer's disease. Acta
Neurologica Belgica, 95, 197-209.
[52] Jakobovits, A., Lamb, B.T., and Peterson, K.R. (2000). Production of transgenic mice
with yeast artificial chromosomes. Methods in Molecular Biology, 136, 435-453.
[53] Kulnane, L.S. and Lamb, B.T. (2001). Neuropathological characterization of mutant
amyloid precursor protein yeast artificial chromosome transgenic mice. Neurobiology
of Disease, 8, 982-992.
[54] Hock, B.J.J. and Lamb, B.T. (2001). Transgenic mouse models of Alzheimer's disease.
Trends in Genetics, 17, S7-S12.
[55] Crawford, J.G. (1998). Alzheimer's disease risk factors as related to cerebral blood
flow: additional evidence. Medical Hypotheses, 50, 25-36.
[56] Lindahl, B. and Lindahl, U. (1997). Amyloid-specific heparan sulfate from human liver
and spleen. The Journal of Biological Chemistry, 272, 26091-26094.
[57] Kisilevsky, R. (1998). Amyloid beta threads in the fabric of Alzheimer's disease.
Nature Medicine, 4, 772-773.
[58] Kawai, M., Kalaria, R.N., Harik, S.I., et al. (1990). The relationship of amyloid plaques
to cerebral capillaries in Alzheimer's disease. The American Journal of Pathology, 137,
1435-1446.
[59] Iwamoto, N., Nishiyama, E., Ohwada, J., et al. (1997). Distribution of amyloid deposits
in the cerebral white matter of the Alzheimer's disease brain: relationship to blood
vessels. Acta Neuropathologica (Berlin), 93, 334-340.
260
[60] Perry, G. and Smith, M.A. (1998). The case for vascular abnormalities in AD. Current
Research in Alzheimer's Disease, 3, 181-186.
[61] Perry, G., Smith, M.A., McCann, C.E., et al. (1998). Cerebrovascular muscle atrophy is
a feature of Alzheimer's disease. Brain Research, 791, 63-66.
[62] Joachim, C.L., Morris, J.H., and Selkoe, D.J. (1989). Diffuse senile plaques occur
commonly in the cerebellum in Alzheimer's disease. American Journal of Pathology,
135, 309-319.
[63] Coria, F., Castano, E., Prelli, F., et al. (1988). Isolation and characterization of amyloid
P component from Alzheimer's disease and other types of cerebral amyloidosis.
Laboratory Investigation, 58, 454-458.
[64] Tagliavini, F., Ghiso, J., Timmers, W.F., et al. (1990). Coexistence of Alzheimer's
amyloid precursor protein and amyloid protein in cerebral vessel walls. Laboratory
Investigation, 62, 761-767.
[65] Kumar, A., Schapiro, M.B., Haxby, J.V., et al. (1990). Cerebral metabolic and
cognitive studies in dementia with frontal lobe behavioral features. Journal of
Psychiatric Research, 24, 97-109.
[66] Friston, K.J. and Frackowiak, R.S. (1991). Cerebral function in aging and Alzheimer's
disease: the role of PET. Electroencephalography and Clinical Neurophysiology, 42,
355-365.
[67] De Jong, G.I., De Vos, R.A., Steur, E.N., et al. (1997). Cerebrovascular hypoperfusion:
a risk factor for Alzheimer's disease? Animal model and postmortem human studies.
Annals of the New York Academy of Sciences, 826, 56-74.
[68] de la Torre, J.C. (1997). Hemodynamic consequences of deformed microvessels in the
brain in Alzheimer's disease. Annals of the New York Academy of Sciences, 826, 75-91.
[69] Galle, J., Bengen, J., Schollmeyer, P., et al. (1995). Impairment of endotheliumdependent dilation in rabbit renal arteries by oxidized lipoprotein(a). Role of oxygenderived radicals. Circulation, 92, 1582-1589.
[70] Meguro, K., Blaizot, X., Kondoh, Y., et al. (1999). Neocortical and hippocampal
glucose hypometabolism following neurotoxic lesions of the entorhinal and perirhinal
cortices in the non-human primate as shown by PET. Implications for Alzheimer's
disease. Brain, 122, 1519-1531.
[71] de la Torre, J.C. (2000a). Critically attained threshold of cerebral hypoperfusion: the
CATCH hypothesis of Alzheimer's pathogenesis. Neurobiology of Aging, 21, 331-342.
[72] Beal, M.F. (1995). Aging, energy, and oxidative stress in neurodegenerative diseases.
Annals of Neurology, 38, 357-366.
[73] Jagust, W.J., Friedland, R.P., Budinger, T.F., et al. (1988). Longitudinal studies of
regional cerebral metabolism in Alzheimer's disease. Neurology, 38, 909-912.
[74] de la Torre, J.C. (2002b). Alzheimer disease as a vascular disorder: nosological
evidence. Stroke, 33, 1152-1162.
[75] Thomas, A.J., Morris, C.M., Ferrier, I.N., et al. (2000). Distribution of amyloid beta 42
in relation to the cerebral microvasculature in an elderly cohort with Alzheimer's
disease. Annals of the New York Academy of Sciences, 903, 83-88.
261
[76] Hofman, A., Ott, A., Breteler, M.M., et al. (1997). Atherosclerosis, apolipoprotein E,
and prevalence of dementia and Alzheimer's disease in the Rotterdam Study. Lancet,
349, 151-154.
[77] Kalaria, R.N. and Ballard, C. (1999). Overlap between pathology of Alzheimer disease
and vascular dementia. Alzheimer Disease and Associated Disorders, 13, Supplemental
(3), S115-S123.
[78] Skoog, I., Kalaria, R.N., and Breteler, M.M. (1999). Vascular factors and Alzheimer
disease. Alzheimer Disease and Associated Disorders, 13, Supplemental 3, S106-S114.
[79] Smith, J.D. and Breslow, J.L. (1997). The emergence of mouse models of
atherosclerosis and their relevance to clinical research. Journal of Internal Medicine,
242, 99-109.
[80] Roses, A.D. (1995). On the metabolism of apolipoprotein E and the Alzheimer
diseases. Experimental Neurology, 132, 149-156.
[81] Ellis, R.J., Olichney, J.M., Thal, L.J., et al. (1996). Cerebral amyloid angiopathy in the
brains of patients with Alzheimer's disease: the CERAD experience, Part XV.
Neurology, 46, 1592-1596.
[82] Kuo, Y.M., Emmerling, M.R., Bisgaier, C.L., et al. (1998). Elevated low-density
lipoprotein in Alzheimer's disease correlates with brain abeta 1-42 levels. Biochemical
and Biophysical Research Communications, 252, 711-715.
[83] Montine, T.J., Montine, K.S., and Swift, L.L. (1997). Central nervous system
lipoproteins in Alzheimer's disease. The American Journal of Pathology, 151, 15711575.
[84] Grant, D.N. (1997). Dietary links to Alzheimer's disease. Alzheimer's Disease Review,
2, 42-55.
[85] Refolo, L.M., Pappolla, M.A., Malester, B., et al. (2000). Hypercholesterolemia
accelerates the Alzheimer's amyloid pathology in a transgenic mouse model.
Neurobiology of Disease, 7, 321-331.
[86] Moreira, P.I., Siedlak, S.L., Wang, X., et al. (2007). Autophagocytosis of mitochondria
is prominent in Alzheimer disease. Journal of Neuropathology and Experimental
Neurology, 66, 525-532.
[87] Sparks, D.L. (1997). Coronary artery disease, hypertension, ApoE, and cholesterol: a
link to Alzheimer's disease? Annals of the New York Academy of Sciences, 826, 128146.
[88] Sparks, D.L., Kuo, Y.M., Roher, A., et al. (2000). Alterations of Alzheimer's disease in
the cholesterol-fed rabbit, including vascular inflammation. Preliminary observations.
Annals of the New York Academy of Sciences, 903, 335-344.
[89] D. Acuna-Castroviejo, Martin, M., Macias, M., et al. (2001). Melatonin, mitochondria,
and cellular bioenergetics. Journal of Pineal Research, 30, 65-74.
[90] Schulz, J.B., Matthews, R.T., Klockgether, T., et al. (1997). The role of mitochondrial
dysfunction and neuronal nitric oxide in animal models of neurodegenerative diseases.
Molecular and Cellular Biochemistry, 174, 193-197.
[91] Fiskum, G., Murphy, A.N., and Beal, M.F. (1999). Mitochondria in neurodegeneration:
acute ischemia and chronic neurodegenerative diseases. Journal of Cerebral Blood
Flow and Metabolism, 19, 351-369.
262
[92] Castellani, R., Hirai, K., Aliev, G., et al. (2002). Role of mitochondrial dysfunction in
Alzheimer's disease. Journal of Neuroscience Research, 70, 357-360.
[93] Hirai, K., G. Aliev, G., A. Nunomura, A., et al. (2001). Mitochondrial abnormalities in
Alzheimer's disease. The Journal of Neuroscience, 21, 3017-3023.
[94] Beckman, K.B. and B.N. Ames 1998a Mitochondrial aging: open questions.
Ann.N.Y.Acad.Sci., 854:118-127.
[95] Beckman, K.B. and Ames, B.N. (1998b). The free radical theory of aging matures.
Physiological Reviews, 78, 547-581.
[96] Beckman, K.B. and Ames, B.N. (1999). Endogenous oxidative damage of mtDNA.
Mutation Research, 424, 51-58.
[97] Wallace, D.C. (1999). Mitochondrial diseases in man and mouse. Science, 283, 14821488.
[98] Bonilla, E., Tanji, K., Hirano, M., et al. (1999). Mitochondrial involvement in
Alzheimer's disease. Biochimica et Biophysica Acta, 1410, 171-182.
[99] Al Abdulla, N.A. and Martin, L.J. (1998). Apoptosis of retrogradely degenerating
neurons occurs in association with the accumulation of perikaryal mitochondria and
oxidative damage to the nucleus. The American Journal of Pathology, 153, 447-456.
[100] Wallace, D.C. (1997). Mitochondrial DNA in aging and disease. Scientific American,
277, 40-47.
[101] Aliev, G., Shi, J., Perry, G., et al. (2000a). Neuronal mitochondrial abnormalities in
yeast artificial chromosome (YAC) transgenic mice overexpressing amyloid precursor
protein (APP). Society for Neuroscience, 30, 26; 301.4(Abstract).
[102] Aliev, G., Smith, M.A., Turmaine, M., et al. (2001). Atherosclerotic lesions are
associated with increased immunoreactivity for inducible nitric oxide synthase and
endothelin-1 in thoracic aortic intimal cells of hyperlipidemic Watanabe rabbits.
Experimental and Molecular Pathology, 71, 40-54.
[103] Shi, J., Perry, G., Berridge, M.S., et al. (2002). Labeling of cerebral amyloid beta
deposits in vivo using intranasal basic fibroblast growth factor and serum amyloid P
component in mice. Journal of Nuclear Medicine, 43, 1044-1051.
[104] Cormier, A., Morin, C., Zini, R., et al. (2001). In vitro effects of nicotine on
mitochondrial respiration and superoxide anion generation. Brain Research, 900, 7279.
[105] Shi, J., Perry, G., Aliev, G., et al. (1999). Serum amyloid P is not present in amyloid
deposits of a transgenic animal model. NeuroReport, 10, 3229-3232.
[106] Aliev, G., Smith, M.A., de la Torre, J.C., et al. (2004). Mitochondria as a primary target
for vascular hypoperfusion and oxidative stress in Alzheimers disease. Mitochondrion,
4/5(6), 649-663.
[107] Aliev, G., Liu, J., Shenk, J.C., et al. (2008a). Neuronal mitochondrial amelioration by
feeding acetyl-L-carnitine and lipoic acid to aged rats. J Cell Mol Med. 12(3) (in press),
J Cell Mol Med. 2008 Mar 28 [Epub ahead of print]. (a).
[108] de la Torre, J.C., and Aliev, G. (2005). Inhibition of vascular Nitric Oxide after rat
chronic brain ischemia: Spatial memory and immunocytochemical changes. Journal of
Cerebral Blood Flow and Metabolism, 25(6), 663-672.
263
[109] Obrenovich, M.E., Smith, M.A., Siedlak, S.L., et al. (2006). Overexpression of GRK2
in Alzheimers disease and in a Chronic Hypoperfusion Rodent Model is an Early
Marker of Brain Mitochondrial Lesions. Neurotoxicity Research, 10(1), 43-56.
[110] Shenk, J.C., Gasimov, E., Liu, J., et al. (2008). ApoE4 overexpression initiates agedependent brain hypoperfusion, mitochondrial lesions and cognitive impairment that
can be prevented by feeding mice acetyl-L-Carnitine and R-Lipoic acid. Journal of
Neurological Science, (in press).
[111] Aliev, G., Gasimov, E., Obrenovich, M.E., et al. (2008b). Atherosclerotic lesions and
mitochondria DNA deletions in brain microvessels: implication in the pathogenesis of
Alzheimers disease. Vascular Health and Risk Management, Feb. 21[Epub ahead of
print].
[112] Aliyev, A., Chen, S., Seyidova, D., et al. (2005). Mitochondria DNA deletions in
atherosclerotic hypoperfused brain microvessels as a primary target for the
development of Alzheimers disease. Journal of Neurological Science, V, 229-230;
285-292.
[113] Moreira, P.I., Siedlak, S.L., Wang, X., et al. (2007a). Autophagocytosis of
mitochondria is prominent in Alzheimer disease. Journal of Neuropathology &
Experimental Neurology, 66(6), 525-532. Erratum in: Journal of Neuropathology &
Experimental Neurology, (2007a). 66(7), 674.
[114] Moreira, P.I., Siedlak, S.L., Wang, X., et al. (2007b). Increased autophagic degradation
of mitochondria in Alzheimer disease. Autophagy, 3(6), 614-615. Epub (2007a). Aug
14.
[115] Moreira, P.I., Nunomura, A., Nakamura, M., et al. (2008). Nucleic acid oxidation in
Alzheimer disease. Free Radic Biol Med, 44(8), 1493-505. Epub 2008 Jan 18.
Chapter X
ROLE OF APOLIPOPROTEIN E IN
NEURODEGENERATION
Carlo Lovati
University of Milan, Ospedale L. Sacco, Milan, Italy.
ABSTRACT
Apolipoprotein E (ApoE) is a polymorphic protein involved in many biological
functions, as lipid levels control. It is implicated in a number of cardiovascular and
cerebral pathologies. ApoE gene maps on 19q13.2 and it exists in three allelic variants,
2, 3 and 4. ApoE 4 variant promotes atherosclerosis and is significantly less frequent
in centenarians than in controls, whereas the 2 allele frequency is increased.
ApoE has several functions within the central nervous system, where it is
synthesized by both astrocytes and neurons. ApoE takes up lipids generated after
neuronal degeneration and redistributes them to cells requiring lipids for proliferation or
membrane repair. Enhanced synthesis of ApoE3, but not ApoE4, stimulates repair of
hippocampal damage and neuronal sprouting, and ApoE3, but not ApoE4, showed a
neuronal protective effect even against excitotoxin-induced neuronal damage.
ApoE has been detected in senile plaques, congophilic angiopathy, and
neurofibrillary tangles in Alzheimers disease (AD). ApoE 4 is a risk factor for
developing AD and has a negative effect on cognitive functions. Its frequency is
increased among subjects with memory disturbances and in patients with AD. The
possible protective role of ApoE 2 against AD is less defined.
Even though 4 homozygosity is virtually sufficient to cause AD, the observation of
the existence of 4 homozygotes free from any neurological disorder underlines that the
inheritance of 4 does not necessarily result in the development of dementia. This is
fundamental concerning the use of ApoE genotype as a biomarker in the diagnostic and
prognostic evaluation of a patient: the presence of the 4 allele may increase the
probability to be correct in the diagnosis of AD, which of course remains at present
mainly clinical.
Correspondence concerning this article should be addressed to: Carlo Lovati, E-mail: [email protected].
Carlo Lovati
266
1. APOLIPOPROTEIN E
Apolipoprotein E (ApoE) is a polymorphic protein composed by 299 amino acids. ApoE
is involved in a large number of biological functions in different anatomical systems. It is
essential for lipid levels control and lipid metabolisms, with a number of implications for
cardiovascular and cerebral pathology.
ApoE gene maps on 19q13.2 locus and it exists in three main allelic variants, 2, 3 and
4, which respectively encode for the three ApoE isoforms ApoE2, E3, and E4. The E2, E3,
and E4 isoforms differ in amino acid sequence at 2 sites, site A (residue 112) and site B
(residue 158). At sites A/B, ApoE2, -E3, and -E4 contain cysteine/cysteine, cysteine/arginine,
and arginine/arginine, respectively [1,2]. E3 is the most frequent isoform, the wildtype one.
E4 differs from E3 by a cys-to-arg change at position 112. Four different variations giving a
band at the E2 position with isoelectric focusing have been described: E2(arg158-to-cys),
E2(lys146-to-gln), E2(arg145-to-cys) and E2-Christchurch(arg136-to-ser). E2(arg158-to-cys)
is the most common of the four [3].
267
The importance of the wild type ApoE and the negative effect of the E4 variant were
underlined by the observation that the 4 allele of the ApoE, which promotes premature
atherosclerosis, was significantly less frequent in centenarians than in controls, whereas the
frequency of the 2 allele was significantly increased [5]. Besides these effects on lipid levels
and their deposition in arterial walls, a direct implication of ApoE on cardiac-valves
pathology such as aortic valve stenosis was observed.
ApoE is also involved in the immunologic response to lipid antigens. In fact, exogenous
lipid antigens need apolipoprotein to achieve T-cell activation [6]. Apolipoprotein E mediates
the presentation of serum-borne lipid antigens and can be secreted by antigen-presenting cells
as a mechanism to survey the local environment to capture antigens or to transfer microbial
lipids from infected cells to antigen-presenting cells.
In addition, ApoE influences retina and optic nerve trophism. The inheritance of specific
ApoE alleles is linked to the incidence of age-related macular degeneration of the retina and a
polymorphism in the ApoE gene (-219G) is associated with increased optic nerve damage.
268
Carlo Lovati
3. IS APOE A BIOMARKER?
The observation of the existence of healthy subjects with 4 homozygosity, free from any
neurological disorder and free from neurofibrillary tangles and senile plaques at autopsy,
pointed out that the inheritance of ApoE 4 does not necessarily result in the development of
dementia or AD.
This concept is fundamental concerning the use of ApoE genotype as a biomarker in the
diagnostic and prognostic evaluation of a patient: the presence of the 4 allele may increase
the probability to be correct in the diagnosis of AD, which of course remains at present
269
mainly clinical. Otherwise, its lack does not exclude the diagnosis and it does not reduce the
suspect of AD, if clinical manifestations fulfil diagnostic criteria.
In 1996, a confirmatory study further demonstrated an increased risk for AD and other
dementias in patients who were homozygous or heterozygous for the 4 [22]. Nevertheless, in
the same study, Authors highlighted that most ApoE 4 carriers do not develop dementia and
about 50% of patients with AD were negative for the 4 allele. Data on an elderly population
suggested that regardless of ApoE genotype, more than half of the population will not
develop AD by age 100 [22].
Therefore, the ApoE 4 allele is neither necessary nor sufficient for the expression of
AD. This concept underlines the importance of other environmental or genetic factors that
may increase the risk of AD, either independently or together with ApoE 4.
4.2. Ethnicity
Even though in almost all populations, the distribution of ApoE alleles is quite similar
(3 allele 70-80%, 4 allele 10-15% and 2 allele 5-10%), their frequencies among AD
patients vary in different ethnic groups. So the effect of ApoE genotype on the clinical
(diagnostic and prognostic) evaluation of a patient needs to be also adapted to ethnicity, that
seems to modify ApoE effects.
Most of the reports concerning the role of ApoE in AD confirmed the association
between ApoE 4 allele and both sporadic and familial LOAD, with some ethnic differences.
For example, Tang et al. [27] compared relative risks conferred by ApoE genotypes in a
population of cases and controls from 3 ethnic groups in a New York community. The
relative risk for AD associated with ApoE 4 homozygosity was increased in all ethnic
groups but with different relative risk: African American RR=3.0; Caucasian RR=7.3;
Carlo Lovati
270
Hispanic RR= 2.5 (compared with the RR with ApoE 3 homozygosity). The risk was also
increased for ApoE 4 heterozygous Caucasians and Hispanics, but not for African
Americans.
Additionally, among over 6000 Caucasian middle-aged individuals (47 to 68 years), it
was found that 4 carriers had greater cognitive decline over a 6-year period compared to
those not carrying an 4 allele. On the contrary, results from a study on 1,693 African
American patients were inconclusive [28].
4.3. Gender
Also gender seems to modify the effect of ApoE: in sporadic LOAD, women have a
significantly higher risk of developing AD than men. In this case, a significant gender
difference for the ApoE 4 heterozygous genotype was found. ApoE 4 heterozygous females
had higher risk than those without 4 and no significant difference emerged between ApoE4
heterozygous and homozygous.
In males, only ApoE 4 homozygous had a higher risk to develop AD, whereas there
were no significant differences between ApoE4 heterozygous and subjects not carrying the 4
allele [29]. A direct comparison of ApoE 4 heterozygous men and women revealed a
significant 2-fold increased risk in women.
271
272
Carlo Lovati
risk of AD above all in 75 year-old or older subjects, but without evidence of synergy with
ApoE 4, at least among the population of Northern Ireland.
Another gene combination that increases the negative effect of ApoE 4 as risk factor for
AD involves Myeloperoxidase (MPO), a potent oxidant found in immune cells and detected
also in activated microglia/macrophages and within A plaques. It was found that the
presence of the MPO A allele in conjunction with ApoE 4 significantly increased the risk of
AD, but only in men [43].
These are just few of the potential genes interacting with ApoE and modulating its effect
as risk factor for AD. Their presence and other likely interactions that may modify ApoE
effects in synergy or in antagonism should be considered.
273
The following data are reported to underline that ApoE genotype can not be used to
modify the diagnosis or to shift toward one of the possible alternative diagnosis when clinical
doubts are still present.
In fact, to date, the role of the ApoE genotype on the development of other types of
dementia is still controversial. Whereas both 2 and 4 alleles have been repeatedly
demonstrated to play an opposite role in the development of AD, to date controversial results
on such role for other types of dementia have been obtained.
274
Carlo Lovati
In 1994, Betard et al. [64] found an increased frequency of ApoE 4 among patients with
LBD (0.472). Much lower frequency of the 4 allele (0.22), was found when a careful
exclusion of LBD patients that had concurrent AD was applied [65] The observation of an
association between an increased frequency of the 4 allele in patients having coexisting
clinical and pathological features of AD and LBD, (i.e. amyloid plaques and Lewy bodies)
but not in patients with a pure neuropathological form of LBD [66] reinforced the hypothesis
of a specific link between AD and ApoE, not present in LBD and other forms of dementia.
On the contrary, Tsuang et al. [67] found a higher frequency of the 4 allele among patients
with the Lewy body variant of AD compared to patients with AD without Lewy bodies
(47.3% vs 35.1%, respectively): the finding suggested an association between the 4 allele
and the development of Lewy bodies.
275
association between the presence of the 4 allele and the typical amnestic phenotype,
characterized by initial presentation of forgetfulness and difficulties with memory, as in
aMCI. Those with the memory phenotype were 3 times more likely to carry an 4 allele
compared to AD patients who displayed a non-memory phenotype, with initial complaints
including problems with calculation, agnosia, and apraxia. The memory phenotype was
almost exclusively observed in homozygous 4 carriers.
An age dependent effect of the ApoE 4 allele on conversion from MCI to AD was
observed: only in over 70-year MCI patients ApoE 4 was associated with the development
of AD. No association between ApoE 4 and transformation to AD was found in younger
subjects [71]. These data reinforce the evidence that ApoE is particularly involved in late
onset AD and that the presence of ApoE 4 in a patient with MCI increases the probability of
evolution toward AD, even if it always remains only a possibility.
Recently (Lovati C, personal observation) it was observed that aMCI is the only type of
MCI differing from controls for ApoE distribution and that this difference is sustained by the
increased frequency of 4 allele (as in AD). No differences were found in ApoE alleles
distribution between non amnestic and vascular MCI. These data reinforce the hypothesis that
aMCI is the initial clinical step of AD and that ApoE genotype may be used as an adjunctive
element in the differential diagnosis and prognosis of MCI patients. Even in this condition it
is strongly necessary to remember that ApoE 4 allele is neither necessary nor sufficient for
the expression of AD and that to date the diagnostic process in demented people is mainly
clinic.
REFERENCES
[1] Weisgraber KH, Rall SC Jr, Mahley RW. Human E apoprotein heterogeneity. Cysteinearginine interchanges in the amino acid sequence of the apo-E isoforms. J Biol Chem
1981;256(17):9077-9083.
[2] Rall SC Jr, Weisgraber KH, Mahley RW. Human apolipoprotein E. The complete amino
acid sequence. J Biol Chem 1982;257(8):4171-4178.
[3] Smit M, de Knijff P, van der Kooij-Meijs E, et al. Genetic heterogeneity in familial
dysbetalipoproteinemia. The E2(lys146----gln) variant results in a dominant mode of
inheritance. J Lipid Res 1990;31(1):45-53.
[4] Huang Y. Molecular and cellular mechanisms of apolipoprotein E4 neurotoxicity and
potential therapeutic strategies. Curr Opin Drug Discov Devel 2006;9(5):627-641.
[5] Schchter F, Faure-Delanef L, Gunot F, et al. Genetic associations with human
longevity at the APOE and ACE loci. Nat Genet 1994;6(1):29-32.
[6] Van den Elzen P, Garg S, Len L, et al. Apolipoprotein-mediated pathways of lipid
antigen presentation. Nature 2005;437(7060):906-910.
[7] Elshourbagy NA, Liao WS, Mahley RW, Taylor JM. Apolipoprotein E mRNA is
abundant in the brain and adrenals, as well as in the liver, and is present in other
peripheral tissues of rats and marmosets. Proc Natl Acad Sci USA 1985;82(1):203-207.
276
Carlo Lovati
[8] Huang Y, Weisgraber KH, Mucke L, Mahley RW. Apolipoprotein E: diversity of cellular
origins, structural and biophysical properties, and effects in Alzheimer's disease. J Mol
Neurosci 2004;23(3):189-204.
[9] Boyles JK, Zoellner CD, Anderson LJ, et al. A role for apolipoprotein E, apolipoprotein
A-I, and low density lipoprotein receptors in cholesterol transport during regeneration
and remyelination of the rat sciatic nerve. J Clin Invest 1989;83(3):1015-1031.
[10] Ignatius MJ, Gebicke-Haerter PJ, Pitas RE, Shooter EM. Apolipoprotein E in nerve
injury and repair. Prog Brain Res 1987;71:177-184.
[11] Poirier J, Davignon J, Bouthillier D, et al. Apolipoprotein E polymorphism and
Alzheimer's disease. Lancet. 1993;342(8873):697-699.
[12] Aleshkov S, Abraham CR, Zannis VI. Interaction of nascent ApoE2, ApoE3, and ApoE4
isoforms expressed in mammalian cells with amyloid peptide beta (1-40). Relevance to
Alzheimer's disease. Biochemistry 1997;36(34):10571-10580.
[13] Buttini M, Orth M, Bellosta S, et al. Expression of human apolipoprotein E3 or E4 in the
brains of Apoe-/- mice: isoform-specific effects on neurodegeneration. J Neurosci
1999;19(12):4867-4880.
[14] LeBlanc AC, Poduslo JF. Regulation of apolipoprotein E gene expression after injury of
the rat sciatic nerve. J Neurosci Res 1990;25(2):162-71.
[15] Ignatius MJ, Gebicke-Hrter PJ, Skene JH, et al. Expression of apolipoprotein E during
nerve degeneration and regeneration. Proc Natl Acad Sci USA 1986;83(4):1125-1129.
[16] Nathan BP, Bellosta S, Sanan DA, et al. Differential effects of apolipoproteins E3 and E4
on neuronal growth in vitro. Science 1994;264(5160):850-852.
[17] Corder EH, Saunders AM, Strittmatter WJ, et al. Gene dose of apolipoprotein E type 4
allele and the risk of Alzheimer's disease in late onset families. Science
1993;261(5123):921-923.
[18] Saunders AM, Schmader K, Breitner JC, et al. Apolipoprotein E epsilon 4 allele
distributions in late-onset Alzheimer's disease and in other amyloid-forming diseases.
Lancet 1993;342(8873):710-711.
[19] Corder EH, Saunders AM, Risch NJ, et al. Protective effect of apolipoprotein E type 2
allele for late onset Alzheimer disease. Nat Genet 1994;7(2):180-184.
[20] Strittmatter WJ, Weisgraber KH, Huang DJ, et al. Binding of human apolipoprotein E to
synthetic amyloid beta peptide: isoform-specific effects and implications for late-onset
Alzheimer disease. Proc Natl Acad Sci USA 1993;90(17):8098-8102.
[21] Talbot C, Lendon C, Craddock N, et al. Protection against Alzheimer's disease with apoE
epsilon 2. Lancet 1994;343(8910):1432-1433.
[22] Myers RH, Schaefer EJ, Wilson PW, et al. (1996) Apolipoprotein E epsilon4 association
with dementia in a population-based study: The Framingham study. Neurology
1996;46(3):673-7.
[23] Kawamata J, Tanaka S, Shimohama S, et al. Apolipoprotein E polymorphism in Japanese
patients with Alzheimer's disease or vascular dementia. J Neurol Neurosurg Psychiatry
1994;57(11):1414-1416.
[24] Yoshizawa T, Yamakawa-Kobayashi K, Komatsuzaki Y, et al. Dose-dependent
association of apolipoprotein E allele epsilon 4 with late-onset, sporadic Alzheimer's
disease. Ann Neurol 1994;36(4):656-659.
277
[25] Levy-Lahad E, Lahad A, Wijsman EM, et al. Apolipoprotein E genotypes and age of
onset in early-onset familial Alzheimer's disease. Ann Neurol 1995;38(4):678-680.
[26] Huang W, Qiu C, von Strauss E, et al. APOE genotype, family history of dementia, and
Alzheimer disease risk: a 6-year follow-up study. Arch Neurol 2004;61(12):1930-1934.
[27] Tang MX, Maestre G, Tsai WY, et al. Relative risk of Alzheimer disease and age-atonset distributions, based on APOE genotypes among elderly African Americans,
Caucasians, and Hispanics in New York City. Am J Hum Genet 1996;58(3):574-584.
[28] Blair CK, Folsom AR, Knopman DS, et al. APOE genotype and cognitive decline in a
middle-aged cohort. Neurology 2005;64(2):268-276.
[29] Payami H, Zareparsi S, Montee KR, et al. Gender difference in apolipoprotein Eassociated risk for familial Alzheimer disease: a possible clue to the higher incidence of
Alzheimer disease in women. Am J Hum Genet 1996;58(4):803-811.
[30] Nicoll JA, Roberts GW, Graham DI. Apolipoprotein E epsilon 4 allele is associated with
deposition of amyloid beta-protein following head injury. Nat Med 1995;1(2):135-137.
[31] Teasdale GM, Nicoll JA, Murray G, Fiddes M. Association of apolipoprotein E
polymorphism with outcome after head injury. Lancet 1997;350(9084):1069-1071.
[32] Crawford FC, Vanderploeg RD, Freeman MJ, et al. APOE genotype influences
acquisition and recall following traumatic brain injury. Neurology 2002;58(7):11151118.
[33] Koponen S, Taiminen T, Kairisto V, et al. APOE-epsilon4 predicts dementia but not
other psychiatric disorders after traumatic brain injury. Neurology 2004;63(4):749-750.
[34] Qiu C, Winblad B, Fastbom J, Fratiglioni L. Combined effects of APOE genotype, blood
pressure, and antihypertensive drug use on incident AD. Neurology 2003;61(5):655-660.
[35] Kadotani H, Kadotani T, Young T, et al. Association between apolipoprotein E epsilon4
and sleep-disordered breathing in adults. JAMA 2001;285(22):2888-2890.
[36] Gottlieb DJ, DeStefano AL, Foley DJ, et al. APOE epsilon4 is associated with
obstructive sleep apnea/hypopnea: the Sleep Heart Health Study. Neurology
2004;63(4):664-648.
[37] O'Hara R, Schrder CM, Kraemer HC, et al. Nocturnal sleep apnea/hypopnea is
associated with lower memory performance in APOE epsilon4 carriers. Neurology
2005;65(4):642-644.
[38] Kamboh MI, Sanghera DK, Ferrell RE, DeKosky ST. APOE*4-associated Alzheimer's
disease risk is modified by alpha 1-antichymotrypsin polymorphism. Nat Genet
1995;10(4):486-488.
[39] Lehmann DJ, Johnston C, Smith AD. Synergy between the genes for
butyrylcholinesterase K variant and apolipoprotein E4 in late-onset confirmed
Alzheimer's disease. Hum Mol Genet 1997;6(11):1933-1936.
[40] Wiebusch H, Poirier J, Svigny P, Schappert K. Further evidence for a synergistic
association between APOE epsilon4 and BCHE-K in confirmed Alzheimer's disease.
Hum Genet 1999;104(2):158-163.
[41] McIlroy SP, Crawford VL, Dynan KB, et al. Butyrylcholinesterase K variant is
genetically associated with late onset Alzheimer's disease in Northern Ireland. J Med
Genet 2000;37(3):182-185.
278
Carlo Lovati
[42] Reynolds WF, Hiltunen M, Pirskanen M, et al. MPO and APOEepsilon4 polymorphisms
interact to increase risk for AD in Finnish males. Neurology 2000;55(9):1284-1290.
[43] LinksKurz A, Egensperger R, Haupt M, et al. Apolipoprotein E epsilon 4 allele,
cognitive decline, and deterioration of everyday performance in Alzheimer's disease.
Neurology 1996;47(2):440-443.
[44] Growdon JH, Locascio JJ, Corkin S, et al. Apolipoprotein E genotype does not influence
rates of cognitive decline in Alzheimer's disease. Neurology 1996;47(2):444-448.
[45] Asada T, Kariya T, Yamagata Z, et al. ApoE epsilon 4 allele and cognitive decline in
patients with Alzheimer's disease. Neurology 1996;47(2):603.
[46] Harrington CR, Roth M, Xuereb JH, et al. Apolipoprotein E type epsilon 4 allele
frequency is increased in patients with schizophrenia. Neurosci Lett 1995;202(1-2):101104.
[47] Scarmeas N, Brandt J, Albert M, et al. Association between the APOE genotype and
psychopathologic symptoms in Alzheimer's disease. Neurology 2002;58(8):1182-1188.
[48] Bernardi L, Maletta RG, Tomaino C, et al. The effects of APOE and tau gene variability
on risk of frontotemporal dementia. Neurobiol Aging 2006;27(5):702-709.
[49] Gustafson L, Abrahamson M, Grubb A, et al. Apolipoprotein-E genotyping in
Alzheimer's disease and frontotemporal dementia. Dement Geriatr Cogn Disord
1997;8(4):240-243.
[50] Geschwind D, Karrim J, Nelson SF, Miller B.The apolipoprotein E epsilon4 allele is not
a significant risk factor for frontotemporal dementia. Ann Neurol 1998;44(1):134-138.
[51] Short RA, Graff-Radford NR, Adamson J, et al. Differences in tau and apolipoprotein E
polymorphism frequencies in sporadic frontotemporal lobar degeneration syndromes.
Arch Neurol 2002;59(4):611-615.
[52] Srinivasan R, Davidson Y, Gibbons L, et al. The apolipoprotein E epsilon4 allele
selectively increases the risk of frontotemporal lobar degeneration in males. J Neurol
Neurosurg Psychiatry 2006;77(2):154-158.
[53] Engelborghs S, Dermaut B, Goeman J, et al. Prospective Belgian study of
neurodegenerative and vascular dementia: APOE genotype effects. J Neurol Neurosurg
Psychiatry 2003;74(8):1148-1151.
[54] Verpillat P, Camuzat A, Hannequin D, et al. Apolipoprotein E gene in frontotemporal
dementia: an association study and meta-analysis. Eur J Hum Genet 2002;10(7):399-405.
[55] Davidson Y, Gibbons L, Purandare N, et al. Apolipoprotein E epsilon4 allele frequency
in vascular dementia. Dement Geriatr Cogn Disord 2006;22(1):15-19.
[56] Traykov L, Rigaud AS, Baudic S, et al. Apolipoprotein E epsilon 4 allele frequency in
demented and cognitively impaired patients with and without cerebrovascular disease. J
Neurol Sci 2002;203-204:177-181.
[57] Guidi I, Galimberti D, Lonati S, et al. Oxidative imbalance in patients with mild
cognitive impairment and Alzheimer's disease. Neurobiol Aging 2006;27(2):262-269.
[58] Jellinger KA, Attems J. Neurofibrillary tangle-predominant dementia: comparison with
classical Alzheimer disease. Acta Neuropathol. 2007;113(2):107-117.
[59] Baum L, Lam LC, Kwok T, et al. Apolipoprotein E epsilon4 allele is associated with
vascular dementia. Dement Geriatr Cogn Disord 2006;22(4):301-305.
279
[60] Treves TA, Bornstein NM, Chapman J, et al. APOE-epsilon 4 in patients with Alzheimer
disease and vascular dementia. Alzheimer Dis Assoc Disord 1996;10(4):189-191.
[61] Frank A, Dez-Tejedor E, Bullido MJ, et al. APOE genotype in cerebrovascular disease
and vascular dementia. J Neurol Sci 2002;203-204:173-176.
[62] Frisoni GB, Calabresi L, Geroldi C, et al. Apolipoprotein E epsilon 4 allele in
Alzheimer's disease and vascular dementia. Dementia 1994;5(5):240-242.
[63] Mahieux F, Couderc R, Moulignier A, et al. Apolipoprotein E4: phenotype in patients
with Alzheimer's disease. Ann Neurol 1994;35(4):506-507.
[64] Btard C, Robitaille Y, Gee M, et al. Apo E allele frequencies in Alzheimer's disease,
Lewy body dementia, Alzheimer's disease with cerebrovascular disease and vascular
dementia. Neuroreport 1994;5(15):1893-1896.
[65] Lippa CF, Smith TW, Saunders AM, et al. Apolipoprotein E genotype and Lewy body
disease. Neurology 1995;45(1):97-103.
[66] Nielsen AS, Ravid R, Kamphorst W, Jrgensen OS. Apolipoprotein E epsilon 4 in an
autopsy series of various dementing disorders. J Alzheimers Dis 2003;5(2):119-125.
[67] Tsuang DW, Wilson RK, Lopez OL, et al. Genetic association between the APOE*4
allele and Lewy bodies in Alzheimer disease. Neurology 2005;64(3):509-513.
[68] Slooter AJ, Breteler MB, Ott A, et al. APOE genotyping in differential diagnosis of
Alzheimer's disease. Lancet 1996;348(9023):334.
[69] Lovati C, Bertora P, et al. (2007). Prevalence of ApoE-e2 allele in different kinds of
dementia. Neurology 68 (12) suppl. 1: A309 (2007).
[70] Mariani E, Monastero R, Mecocci P. Mild cognitive impairment: a systematic review. J
Alzheimers Dis 2007;12(1):23-35.
[71] Devanand DP, Pelton GH, Zamora D, et al. Predictive utility of apolipoprotein E
genotype for Alzheimer disease in outpatients with mild cognitive impairment. Arch
Neurol 2005;62(6):975-980.
INDEX
A
AAT, 163, 179, 181
abdominal, 128
aberrant, 68, 170, 171
abnormalities, 6, 37, 42, 46, 50, 64, 172, 212, 242,
243, 247, 248, 249, 252, 254, 256, 259, 260, 262
academic, 159, 172
access, 87, 92
accidental, 129
accuracy, 6, 11, 12, 13, 32, 33, 43, 45, 46, 47, 51,
52, 56, 83, 84, 87, 92, 105, 120, 123, 124, 141,
143, 145, 146, 159, 172, 188, 198, 211
ACE, 275
acetylcholine, 48, 58
acetylcholinesterase, 31, 41, 48, 49, 53, 58, 60, 63,
64, 204
acetylcholinesterase inhibitor, 31, 204
acid, 88, 136, 164, 184, 246, 249, 262, 263
acidic, 88
actin, 201
activation, 34, 37, 38, 39, 55, 159, 160, 161, 162,
163, 164, 166, 167, 168, 170, 173, 177, 181, 182,
183, 188, 193, 196, 197, 198, 200, 204, 205, 208,
209, 217, 230, 231, 237, 238, 247, 267
acute, 72, 74, 77, 146, 147, 150, 157, 160, 161, 162,
166, 170, 171, 181, 190, 199, 200, 216, 250, 261
acute ischemic stroke, 77, 200
adaptation, 245
additives, 95
adducts, 245
adenosine, 248
adenosine triphosphate, 248
adhesion, 71, 169, 188, 192, 193, 204, 217, 218, 230,
234, 238, 244, 245
adhesions, 244, 245
adhesive interaction, 162
adipocyte, 230
adipocytes, 215, 216
adipose, 127, 231, 239
adipose tissue, 239
administration, 16, 178, 207
administrative, 23, 118
adsorption, 94
adult, 134, 163, 203, 208, 237, 271
adults, 38, 78, 148, 277
advanced glycation end products (AGEs), 167, 245
aerobic, 248, 250
aetiology, 8
African American, 269, 270, 277
African Americans, 270, 277
African-American, 209
age, 1, 2, 3, 5, 6, 7, 19, 20, 21, 22, 30, 31, 32, 35, 36,
38, 45, 63, 65, 67, 70, 71, 74, 76, 78, 82, 86, 110,
111, 112, 128, 148, 161, 165, 168, 169, 172, 175,
177, 178, 181, 184, 186, 188, 190, 198, 200, 210,
211, 212, 218, 219, 220, 221, 223, 224, 226, 228,
229, 230, 233, 236, 242, 246, 247, 249, 251, 253,
255, 257, 263, 266, 267, 268, 269, 271, 275, 277
ageing, 29, 37, 38, 39, 48, 55, 56, 173, 228, 236
agent, 159, 207
agents, 31, 226
age-related macular degeneration (AMD), 177, 190,
198, 267
aggregates, 71, 134, 151, 158, 163, 164, 203
aggregation, 69, 73, 79, 95, 157, 162, 163, 165, 169,
196, 197, 202
282
Index
aging, 2, 3, 24, 29, 35, 39, 54, 55, 57, 58, 62, 65, 75,
78, 152, 198, 206, 233, 235, 236, 239, 243, 246,
248, 250, 256, 260, 262
agnosia, 275
aid, 75, 124, 141, 174, 186, 201
AIDS, 139
air, 38
albumin, 125, 141, 176, 177
alcohol, 6, 67, 142, 213
alcohol abuse, 6
alcoholics, 78
algorithm, 83, 84, 101, 113
allele, 9, 62, 63, 137, 149, 155, 165, 168, 175, 186,
207, 234, 265, 266, 267, 268, 269, 270, 271, 272,
273, 274, 275, 276, 277, 278, 279
alleles, 199, 267, 268, 269, 272, 273, 274, 275
allergic, 128
allergic reaction, 128
alpha, 145, 151, 189, 190, 191, 194, 196, 198, 199,
200, 201, 203, 204, 206, 207, 208, 209, 232, 235,
237, 271, 277
alpha1-antitrypsin, 200
alpha-2-macroglobulin, 190
ALS, 73, 139, 153, 250
alternative, 12, 87, 134, 144, 187, 227, 273
alternative causes, 12
alternatives, 18
alters, 202, 233
amelioration, 262
American Psychiatric Association, 68, 75, 213, 230
amine, 41, 178
amino, 31, 54, 67, 70, 88, 103, 104, 134, 136, 214,
266, 275
amino acid, 31, 67, 70, 104, 134, 136, 214, 266, 275
amino acids, 70, 134, 214, 266
amnesia, 25, 56
amoeboid, 167
Amsterdam, 157
amygdala, 47, 58
amyloid angiopathy, 158, 171, 199, 261
amyloid deposits, 47, 54, 158, 161, 164, 167, 168,
169, 172, 189, 197, 249, 259
amyloid fibril formation, 205
amyloid fibrils, 163, 164, 207, 232
amyloid plaques, 34, 47, 52, 55, 64, 164, 170, 193,
198, 204, 206, 233, 259, 274
amyloid precursor protein, 31, 46, 53, 79, 88, 89,
136, 206, 208, 212, 233, 259, 260, 262
amyloidosis, 162, 164, 166, 168, 195, 198, 203, 242,
257
Index
arachidonic acid, 160, 184
arachnoiditis, 129
arginine, 266, 275
arrhythmia, 147
arsenic, 142
arteries, 39, 246, 258, 260
arteriosclerosis, 243, 247
artery, 130, 261
artificial, 106, 249, 259, 262
aseptic, 127, 129, 145
aspirate, 130
assessment, 7, 8, 12, 34, 36, 52, 53, 55, 64, 73, 84,
86, 88, 125, 147, 154, 206, 212
associations, 165, 247, 275
astrocytes, 159, 161, 162, 163, 165, 166, 170, 171,
189, 195, 196, 197, 203, 205, 217, 230, 238, 265,
267
astrocytoma, 201
astrogliosis, 217
asymmetry, 54
asymptomatic, 32, 45, 48, 174
atherogenesis, 216, 235
atherosclerosis, 233, 236, 239, 242, 243, 245, 248,
249, 255, 258, 261, 265, 267
ATP, 248, 250
atrophy, 4, 34, 35, 36, 37, 39, 41, 43, 54, 55, 56, 57,
58, 63, 65, 66, 68, 77, 87, 139, 144, 153, 155,
159, 167, 172, 173, 174, 175, 206, 247, 248
attention, vii, 4, 16, 18, 19, 20, 50, 84, 85, 186, 221,
222, 243
attitudes, 85
autoantibodies, 141
autocrine, 223
autoimmune, 143
autoimmunity, 152
automation, 91
autopsy, 31, 47, 50, 61, 63, 70, 71, 79, 81, 82, 85,
99, 108, 109, 115, 118, 159, 172, 184, 212, 268,
272, 279
autosomal dominant, 171, 175
availability, 40, 86, 95, 101
axon, 138
axonal, 36, 73, 76, 118, 131, 133, 134, 135, 137,
139, 140, 150, 151, 152, 184
axonal degeneration, 76, 118, 131, 133, 134, 135,
140, 150
axons, 68, 70, 71, 72, 133, 134, 138, 184, 267
283
B
background noise, 85
bacterial, 142, 150
barrier, 40, 87, 124, 125, 146, 147, 242, 244, 245
barriers, 123
basal forebrain, 58, 233
basal ganglia, 41, 51, 127
basement membrane, 170, 247
basic fibroblast growth factor, 252, 262
basic research, 91
batteries, 5, 75
battery, 11, 21, 22, 23, 24
BDNF, 210
behavior, 98, 115
Belgium, 81, 82, 109, 135
beneficial effect, 165
benefits, 70, 85, 117, 206, 242
benign, 170
benzodiazepine, 48, 159, 167, 173
beta, vii, 48, 52, 54, 55, 63, 64, 68, 76, 77, 79, 88,
120, 136, 145, 148, 149, 152, 154, 155, 168, 176,
189, 190, 191, 192, 196, 197, 198, 199, 200, 201,
202, 203, 204, 205, 206, 207, 208, 209, 210, 230,
231, 232, 234, 235, 238, 257, 258, 259, 276
-amyloid, 30, 31, 67, 77, 78, 96, 216
bias, 33, 84
bilateral, 129
binding, 47, 48, 50, 51, 60, 71, 72, 88, 90, 104, 134,
141, 159, 162, 163, 164, 167, 169, 170, 173, 177,
194, 207, 209, 215, 216, 217, 230, 231, 233, 236,
252
bioanalytical, 119
bioassay, 92
biochemical, 41, 51, 65, 69, 70, 75, 76, 83, 85, 86,
87, 118, 132, 146, 148, 153, 201, 203, 212, 213,
220, 223, 229
biochemistry, 61, 201
bioenergetics, 261
biologic, 132, 230
biological, vii, 29, 30, 31, 32, 40, 69, 75, 78, 83, 90,
94, 97, 98, 101, 117, 119, 121, 158, 159, 162,
176, 191, 192, 211, 212, 214, 219, 221, 222, 223,
228, 229, 230, 252, 265, 266, 272
biological markers, vii, 29, 31, 121, 191, 229
biologically, 40
biology, 31, 259
biomarker, 33, 36, 49, 51, 74, 81, 82, 83, 84, 85, 86,
87, 88, 92, 94, 95, 97, 109, 110, 111, 112, 113,
114, 115, 116, 117, 118, 119, 124, 131, 132, 133,
284
Index
134, 135, 137, 140, 141, 143, 144, 145, 150, 151,
157, 158, 159, 160, 172, 173, 174, 175, 177, 178,
181, 183, 184, 186, 188, 205, 208, 212, 214, 218,
234, 265, 268
biomarkers, vii, 12, 32, 36, 39, 45, 47, 51, 52, 65, 67,
69, 70, 73, 74, 75, 77, 81, 82, 83, 84, 85, 86, 87,
88, 92, 95, 105, 110, 113, 115, 116, 117, 118,
119, 120, 121, 123, 124, 125, 128, 131, 132, 133,
137, 138, 140, 141, 143, 144, 146, 148, 151, 152,
154, 155, 158, 159, 160, 173, 174, 175, 176, 177,
178, 181, 184, 186, 187, 188, 189, 191, 192, 194,
195, 196, 197, 206, 210, 211, 213, 220, 231, 232,
233, 234, 236, 238
biomolecules, 90
biophysical, 270, 276
biopsy, 247, 249, 251
biosynthesis, 152, 190, 258
biotin, 93
birth, 16
bleeding, 247
blocks, 164
blood, 32, 37, 38, 39, 40, 41, 62, 116, 117, 121, 124,
125, 129, 141, 142, 146, 147, 159, 160, 162, 163,
164, 166, 168, 169, 171, 176, 187, 188, 197, 199,
205, 210, 227, 231, 237, 242, 243, 244, 245, 246,
247, 248, 254, 258, 259, 266, 271, 277
blood flow, 39, 40, 41, 243, 248, 254
blood pressure, 271, 277
blood vessels, 246, 247, 259
blood-brain barrier (BBB), 125, 140, 163, 164, 165,
166, 168, 197, 205, 210, 237, 242, 244, 247, 252,
254, 258, 259
blots, 224, 226, 228
body fluid, 138, 144, 188, 212
body temperature, 234
BOLD, 37, 38, 55
bone, 38, 128, 130
borderline, 85
boundary conditions, 94, 101
bovine, 236
brain abnormalities, 63
brain activity, 37, 38, 63, 234
brain damage, 20, 22, 125, 131, 242
brain functions, 227
brain injury, 142, 267
brain size, 7
brain structure, 38, 43, 126, 129, 229
brain tumor, 142
breakdown, 141, 246, 252
breast, 148, 223, 235, 237
C
Ca2+, 163
calcium, 163, 189, 233, 248
caliber, 128, 129
calibration, 96, 98, 101, 102, 117
cancer, 148, 149, 216, 235, 237, 245
cancer cells, 216
candidates, 17, 82, 88, 212
capacity, 2, 7, 32, 218, 230, 236
capillary, 248, 253
carbohydrates, 202
carbon, 40, 48, 57
cardiovascular, 132, 239, 244, 245, 265, 266
cardiovascular disease, 244, 266
cardiovascular system, 239, 266
carrier, 159, 169, 177
cartilage, 177
case study, 22, 27
casein, 168
caspase, 164, 203
category b, 2
cathepsin G, 161, 166
catholic, 64
caucasian, 269, 270
caucasians, 270, 277
cauda equina, 129
CBD, 139
CD14, 167, 190, 194
CD40, 201
CD45, 161
cDNA, 151, 203, 205, 214, 253
CDR, 1, 3, 5
ceiling effect, 23
cell, 68, 71, 77, 90, 95, 103, 125, 133, 137, 159, 161,
162, 165, 166, 170, 171, 183, 189, 209, 212, 216,
217, 218, 221, 223, 225, 230, 231, 232, 234, 237,
238, 239, 242, 243, 245, 247, 248, 250, 252
cell adhesion, 71, 171, 232, 238
cell culture, 103, 162, 237
cell cycle, 170, 183
cell death, 209, 218, 221, 237, 250
cell division, 218
cell line, 95, 103, 161, 217, 223, 230, 237
cell lines, 95, 103, 217, 230, 237
Index
cell metabolism, 243
cell signaling, 137, 234
cell surface, 71, 77, 165, 166, 231
cellular immunity, 234
central nervous system (CNS), 67, 71, 108, 134, 137,
139, 144, 145, 146, 147, 150, 169, 181, 190, 195,
200, 204, 206, 207, 208, 209, 212, 213, 217, 225,
229, 247, 249, 265, 267
centralized, 90, 92
cerebellar ataxia, 153
cerebellum, 46, 47, 127, 165, 191, 217, 238, 260
cerebral amyloid angiopathy, 135, 165
cerebral amyloidosis, 168, 260
cerebral blood flow, 38, 40, 41, 221, 235, 243, 246,
253, 256, 259
cerebral blood flow (CBF), 38, 215, 231, 246, 247,
253
cerebral blood volume, 57
cerebral cortex, 60, 164, 170
cerebral hemorrhage, 195, 257
cerebral hypoperfusion, 58, 248, 260
cerebral ischemia, 258
cerebral metabolism, 206, 260
cerebrospinal fluid, vii, 47, 52, 67, 70, 75, 76, 77,
78, 79, 81, 82, 87, 118, 119, 120, 121, 123, 124,
131, 133, 138, 146, 147, 148, 149, 150, 151, 152,
153, 154, 155, 158, 159, 172, 189, 190, 191, 192,
193, 194, 195, 196, 197, 198, 199, 200, 202, 203,
204, 206, 207, 208, 209, 210, 230, 238, 249
cerebrovascular, 142, 175, 208, 209, 242, 243, 244,
245, 246, 247, 257, 258, 259, 278, 279
cerebrovascular accident, 142, 242
cerebrovascular disease, 244, 245, 247, 278, 279
cerebrovascular diseases, 244, 245, 247
certainty, 6, 172
cervical, 130
chemical, 24, 41, 94, 116
chemical properties, 41
chemiluminescence, 89
chemistry, 94
chemokine, 161, 167, 181, 182, 195, 209, 217
chemokine receptor, 161, 167, 181, 182, 209
chemokine synthesis, 195
chemokines, 162, 185, 188, 197, 217, 230
chicken, 85, 90
children, 19, 20
chimera, 250
cholesterol, 87, 132, 165, 193, 202, 221, 249, 261,
266, 276
cholinergic, 16, 25, 34, 48, 233
285
286
Index
co-existence, 247
cognition, 41, 55, 142, 143, 186, 209, 226, 233, 235
cognitive, 1, 2, 3, 4, 5, 6, 7, 8, 11, 12, 13, 14, 15, 16,
17, 18, 19, 20, 21, 22, 23, 25, 26, 29, 30, 31, 32,
33, 34, 36, 37, 38, 39, 40, 42, 44, 45, 47, 48, 49,
53, 54, 56, 57, 59, 62, 63, 64, 66, 68, 70, 75, 115,
123, 124, 133, 136, 138, 140, 141, 142, 143, 144,
155, 159, 168, 170, 172, 175, 178, 181, 185, 186,
192, 193, 194, 202, 204, 205, 207, 208, 209, 213,
219, 221, 232, 233, 234, 235, 237, 239, 248, 260,
263, 265, 268, 270, 274, 277, 278, 279
cognitive activity, 234
cognitive deficit, 1, 2, 3, 4, 29, 31, 32, 42, 124, 138,
140, 141, 143, 144
cognitive deficits, 4, 29, 31, 32, 42, 144
cognitive disorders, 1, 3, 54, 213
cognitive domains, 3, 19, 20, 32, 48
cognitive dysfunction, 6, 12, 16
cognitive function, 2, 3, 5, 6, 19, 20, 21, 30, 32, 38,
39, 53, 178, 181, 186, 204, 221, 232, 265, 268,
274
cognitive impairment, 1, 2, 3, 4, 5, 6, 7, 8, 16, 19,
21, 29, 34, 36, 44, 48, 49, 53, 57, 59, 62, 66, 68,
70, 115, 124, 142, 155, 168, 173, 193, 194, 213,
219, 233, 235, 237, 263, 279
cognitive performance, 2, 5, 23, 40, 186, 202
cognitive process, 235
cognitive test, 66
cognitive testing, 66
cognitive variables, 270
cohort, 5, 8, 49, 172, 186, 219, 220, 229, 260, 274,
277
collaboration, 7
collagen, 71, 163, 169, 170, 192, 214, 233, 238
commercial, 42, 138
commissure, 126
community, 4, 75, 159, 172, 205, 269
community-based, 4, 75, 159, 172
compatibility, 97
compensation, 39
compilation, 129
complement, 105, 157, 160, 161, 162, 163, 164, 167,
168, 170, 171, 176, 177, 181, 185, 187, 193, 195,
198, 201, 206, 207, 208, 209, 210, 212, 216
complement components, 160, 162, 208
complement inhibitors, 163
complement pathway, 162, 201
complement system, 161, 162, 209
complementary, 32, 176
complexity, 51, 87
compliance, 39
complications, 128
components, 71, 170, 195, 247
composition, 92, 106, 123, 124, 127, 146, 158
compounds, vii, 31, 69, 214, 219
comprehension, 220
computed tomography, 40, 50, 61
computer, 34
computing, 17
concentration, 38, 91, 94, 95, 99, 100, 101, 102, 104,
107, 109, 110, 111, 113, 124, 141, 153, 175, 192,
200, 202, 210, 252
concrete, 26
conditioning, 237
confidence, 101, 113, 114, 174, 271
confidence interval, 113, 114, 271
confidence intervals, 113, 114
conformational, 171
confusion, 16, 273
conjugation, 90, 93
consensus, 3, 5, 66, 82, 117, 129, 132
constraints, 123, 124
contamination, 141
contrast agent, 38, 130
control, 19, 21, 23, 40, 41, 72, 84, 104, 108, 112,
113, 114, 138, 140, 158, 160, 165, 167, 170, 174,
183, 185, 186, 188, 194, 201, 212, 216, 217, 218,
219, 220, 224, 226, 228, 250, 253, 265, 266
control group, 19, 21, 108, 112, 140, 183, 186, 253
controlled, 66, 179, 221, 238
conversion, 4, 6, 8, 17, 32, 45, 53, 54, 61, 65, 173,
235, 275
conversion rate, 6, 32
copper, 71
corpus callosum, 37, 126
correlation, 21, 34, 42, 44, 47, 49, 51, 71, 72, 74, 98,
110, 144, 149, 155, 175, 183, 191, 193, 198, 200,
205, 219, 223, 226, 227, 228, 237, 249, 251
correlation coefficient, 110
correlations, 37, 43, 54, 144, 219
cortex, 41, 42, 43, 44, 45, 47, 58, 61, 65, 143, 165,
183, 191, 196, 197, 206, 227, 249
cortical, 36, 37, 39, 41, 43, 45, 47, 48, 49, 53, 54, 55,
64, 66, 131, 142, 164, 246, 249, 252, 253, 254
cortical neurons, 131
corticobasal degeneration, 53, 54, 79, 142
cortisol, 212, 222, 226, 227, 230, 235
cost effectiveness, 36
cost-effective, 92
costs, 40, 59, 86, 92, 93, 146, 206
Index
cotinine, 252
cough, 128
coupling, 37, 91, 94, 98, 103
covalent, 91, 94, 164
covalent bond, 164
covariate, 112
covering, 103
COX-2, 170, 176, 184, 196, 197
C-reactive protein, 163, 179, 181, 210, 216
Creutzfeldt-Jakob disease, 109, 149, 150
critically ill, 95
cross-sectional, 3, 30, 35, 64, 184, 186
cross-sectional study, 184
CRP, 163, 181, 185, 186, 216
CS, 192
C-terminal, 70, 88, 103, 214, 215
cultural, 33
culture, 18, 57, 150, 164, 187, 205
curve-fitting, 101
customers, 92
CVM, 119
CXC, 166
CXCL8, 166
cycles, 107, 141
cyclooxygenase, 258
cyclooxygenases, 160
cyst, 129
cystatin, 166, 168, 177, 185, 198, 201
cystatin C, 166, 168, 177, 185, 198, 201
cysteine, 41, 166, 199, 214, 266, 275
cysteine proteases, 199
cysteine residues, 214
cytochemistry, 252
cytochrome, 41, 65, 249
cytochrome oxidase, 41, 65
cytokine, 161, 167, 170, 178, 180, 185, 187, 190,
192, 199, 200, 205, 208, 219, 225, 226, 236, 237
cytokines, 120, 157, 160, 161, 162, 164, 169, 170,
178, 188, 197, 200, 201, 204, 206, 207, 209, 210,
216, 217, 219, 225, 226, 230, 234
cytology, 141, 143, 145
cytometry, 187
cytoplasm, 125, 249
cytoplasmic tail, 214
cytoprotective, 245
cytoskeleton, 137, 152, 201, 268
cytosol, 125, 134, 137
cytotoxic, 221
287
D
daily living, 1, 3, 32, 70
data analysis, 85, 90
data mining, 116
data set, 42, 46, 66
database, 86, 116, 190
de novo, 170, 191
death, 125, 131, 242, 243, 245
decay, 17
decisions, 84
defects, 46, 233, 248
deficiency, 16, 167, 194, 223, 234, 239, 248
deficit, 3, 25, 29, 43, 45, 57, 65, 142
deficits, 25, 30, 32, 38, 39, 64, 136
definition, 2, 3, 13, 117, 129
deformation, 60
degenerative conditions, 41
degenerative dementia, 131, 142, 268, 274
degradation, 49, 65, 159, 166, 169, 189, 201, 203,
209, 214, 247, 263
degrading, 48, 89, 118, 158, 175, 203
degree, 3, 12, 17, 29, 34, 36, 41, 46, 49, 55, 106,
130, 133, 138, 139, 140, 141, 155, 160, 162, 170,
173, 182, 189, 196, 242, 248, 249, 269
dehydroepiandrosterone, 211, 222, 229, 235, 239
dehydroepiandrosterone sulphate, 235
dehydrogenase, 224, 235
delivery, 248
delusions, 272
demand, 38, 95, 248
demographics, 29
demyelination, 174
density, 41, 49, 50, 131, 158, 164, 168, 182, 232,
236, 249, 276
dentate gyrus, 237
Department of Health and Human Services, 24, 78,
119, 153, 235
deposition, vii, 31, 34, 41, 47, 48, 56, 71, 72, 75, 76,
123, 137, 149, 158, 162, 163, 164, 165, 166, 167,
168, 169, 170, 171, 175, 177, 190, 191, 193, 195,
201, 202, 205, 206, 208, 212, 217, 226, 227, 229,
242, 243, 247, 249, 267, 270, 277
deposits, 59, 68, 135, 157, 158, 159, 160, 161, 163,
165, 166, 167, 169, 171, 182, 183, 198, 204, 220,
246, 247, 248, 249, 252, 262
depressed, 17
depression, 3, 4, 17, 25, 26, 67, 72, 73, 143, 258, 271
depressive symptoms, 272
deprivation, 223, 229
288
Index
derivatives, 52
desorption, 89, 176, 177, 186
destruction, 161
detection, 8, 12, 14, 16, 24, 29, 38, 40, 42, 47, 53,
55, 74, 87, 89, 95, 99, 103, 105, 143, 153, 159,
176, 178, 180, 185, 187, 234
DHEA, 227, 229, 230, 239
diabetic, 216
diagnostic, 3, 5, 7, 8, 11, 12, 13, 14, 19, 20, 22, 24,
26, 30, 32, 33, 36, 39, 42, 43, 47, 49, 51, 52, 62,
67, 69, 73, 76, 77, 82, 83, 85, 87, 90, 91, 92, 108,
110, 111, 112, 113, 115, 121, 123, 142, 144, 147,
159, 172, 174, 175, 182, 185, 187, 188, 211, 213,
214, 230, 265, 268, 269, 272, 275
Diagnostic and Statistical Manual of Mental
Disorders, 31, 75
diagnostic criteria, 5, 7, 8, 26, 32, 47, 52, 108, 123,
142, 269
diagnostic markers, 67, 69, 121, 188
diastolic blood pressure, 271
diastolic pressure, 271
diet, 249
dietary, 214, 234, 249
dietary fat, 214
differential diagnosis, 14, 30, 40, 46, 47, 48, 50, 52,
67, 76, 113, 121, 123, 124, 132, 135, 136, 137,
138, 139, 140, 141, 142, 146, 151, 152, 153, 154,
173, 174, 275, 279
differentiation, 14, 35, 36, 50, 59, 171, 230
diffusion, 53, 54, 56, 57, 63, 65, 124, 125, 159
diffusion tensor imaging, 53, 56, 57, 63
diffusivity, 37, 59, 62, 65
dilation, 249, 260
diluent, 99
dimerization, 105
disability, 168
discovery, 89, 120
discrimination, 34, 37, 46, 77, 113, 119, 121, 147,
197
discriminatory, 13
discs, 163
disease gene, 53
disease progression, 33, 51, 58, 72, 82, 112, 139,
154, 167, 173, 175, 208, 213
diseases, 135, 142, 143, 144, 262
disorder, 4, 6, 16, 29, 69, 190, 212, 243, 256, 260
dispersion, 163
distortions, 178
distracters, 17
distribution, 13, 41, 43, 99, 101, 149, 182, 220, 266,
269, 274, 275
disulfide, 165, 214, 215, 236
diversity, 239, 276
division, 158, 218
DNA, 88, 160, 163, 175, 176, 218, 232, 242, 245,
251, 252, 259, 262, 263
DNA damage, 218
docosahexaenoic acid, 185
domain structure, 88
dopamine, 41, 49, 50, 51, 58, 59, 60, 62, 63, 234
dopaminergic, 41, 48, 49, 50, 66
dosage, 268
Down syndrome, 78, 233
down-regulation, 192, 251
drainage, 159, 171
drug action, 40
drug design, 176
drug discovery, 91, 117
drug use, 271, 277
drugs, 25, 31, 41, 52, 83, 99, 131, 142, 159, 172,
178, 212, 216, 238, 243, 250
DSM-IV, 31, 75, 142, 159
DTI, 36, 37
duplication, 253
dura mater, 128
duration, 65, 219, 231
DWI, 39, 40
dysregulation, 219, 223, 226
E
early warning, 132
ECD, 41, 53, 55, 62
ECF, 124, 125, 133, 138
ECG, 131
economics, 93
education, 19, 20, 21, 33, 44, 53, 56, 60, 62, 63, 64,
65
EEG, 159
efficacy, 83, 85, 147, 187, 212
EGF, 188
egg, 85
elderly, 1, 2, 3, 4, 7, 8, 17, 21, 23, 26, 38, 45, 48, 64,
67, 76, 116, 159, 172, 186, 187, 192, 193, 197,
200, 205, 210, 218, 221, 231, 232, 233, 239, 243,
260, 269, 274, 277
elderly population, 7, 159, 172, 231, 269
elders, 209
electrocardiographic, 147
Index
electron, 242, 250, 255
electronic, iv
electrophoresis, 89, 176, 177, 185
electrophysiologic, 147
ELISA, 71, 73, 79, 88, 89, 94, 95, 96, 97, 98, 99,
100, 102, 105, 108, 109, 110, 114, 120, 121, 135,
138, 150, 151, 177, 180
ELISA method, 71, 73, 151
emission, 33, 40, 46, 50, 53, 55, 61, 62, 65, 66, 167,
173, 248
emotional, 17
emotional distress, 17
encephalitis, 137
encephalopathy, 137, 142, 150
encoding, 31, 151, 168, 171, 175, 190, 201, 221,
233, 271
endocrine, 211, 214
endocrine system, 211
endocrinological, 6
endocytosis, 218, 266
endogenous, 38, 39, 97, 231
endothelial, 216
endothelial cell, 162, 215, 216, 244, 245, 247, 256
endothelial cells, 162, 215, 216
endothelial dysfunction, 246, 258, 259
endothelin-1, 244, 262
endothelium, 216, 242, 244, 245, 246, 249, 254, 258,
260
energy, 242, 248, 250, 260
enolase, 123, 139, 153
entorhinal cortex, 34, 35, 43, 45, 47, 56, 61, 87, 167
environment, 67, 267
environmental, 266, 269, 270
enzymatic, 40, 41, 141, 184, 252
enzymatic activity, 41
enzyme, 48, 77, 89, 91, 120, 138, 151, 158, 175, 203
enzyme immunoassay, 151
enzyme-linked immunosorbent assay, 77, 89, 120
enzymes, 49, 89, 118, 139, 160, 171, 245, 246, 255
epidemiological, 44, 86, 115, 170, 172, 243, 252,
256, 268
epidemiology, 8
episodic, 6, 12, 38, 39, 43, 47, 48, 52, 55, 63, 70
episodic memory, 6, 12, 38, 39, 43, 47, 48, 52, 55,
63, 70
episodic memory (EM), 38
epithelial cells, 215
epitope, 90, 97, 103
epitopes, 73, 76, 90, 98, 103, 141, 152, 154, 161
equilibrium, 144
289
equipment, 92
erythrocytes, 129, 214, 215, 216, 236
ester, 41, 216
esterase, 58
esters, 239
estimating, 133
estradiol, 212, 223, 225, 235, 237
estrogen, 211, 212, 222, 223, 224, 229, 231, 232,
233, 234, 235, 236, 237, 238, 239
estrogen receptors, 212, 231, 235, 237
estrogens, 221, 222, 223, 225, 230, 232, 238
etanercept, 178, 207
ethical, 131
ethics, 108
ethnic groups, 269
ethnicity, 266, 269
etiologic agent, 236
etiology, 6, 31, 171, 175, 197
etiopathogenesis, 244
eukaryotic, 149
evidence, 8, 30, 32, 37, 39, 47, 52, 56, 57, 59, 62, 63,
71, 76, 107, 108, 110, 112, 115, 119, 120, 135,
142, 143, 171, 190, 193, 207, 212, 216, 218, 221,
227, 236, 242, 243, 245, 246, 248, 249, 253, 258,
259, 260, 272, 275, 277
evolution, 132, 170, 195, 275
examinations, 12, 203
excitation, 91
exclusion, 68, 87, 123, 147, 172, 174, 213, 247, 274
execution, 18, 20, 23
executive function, 4, 19, 20, 186
executive functions, 4, 19, 20
exercise, 82, 117
exogenous, 39, 267
exons, 134, 215
experimental condition, 97, 106
expert, 117, 118, 159, 172
expertise, 34
experts, 117
exponential, 86
exposure, 227
extracellular, 68, 69, 70, 71, 125, 133, 138, 158, 163,
164, 167, 168, 169, 183, 193, 203, 205, 208, 214,
215, 246
extracellular matrix, 71, 246
extraction, 38, 103
eyes, 128
Index
290
F
fabric, 259
factor H, 177, 185, 187, 210
failure, 11, 219, 223, 242, 248, 251
false, 11, 13, 14, 16, 17, 21
false alarms, 16, 17
false negative, 13, 14, 16
false positive, 13, 14, 17, 21
familial, 9, 79, 115, 135, 136, 158, 204, 207, 266,
268, 269, 273, 275, 277
familial dysbetalipoproteinemia, 266, 275
family, 3, 5, 17, 45, 166, 175, 181, 204, 214, 217,
230, 238, 266, 269, 277
family history, 17, 45, 266, 269, 277
family members, 3, 5
fat, 234, 237, 249
fatty acid, 202, 214, 216, 230, 231, 233, 237
fatty acids, 202, 214, 230, 231
FDG, 40, 41, 42, 43, 44, 45, 46, 47, 55, 56, 57, 58,
61, 64, 66, 173
feeding, 262, 263
females, 19, 20, 108, 109, 110, 230, 270, 273
ferritin, 140
fertility, 195
fetal, 127, 134
fetal brain, 134
F-FDG PET, 55
fiber, 65
fiber bundles, 65
fibrillar, 47, 68, 158, 160, 161, 162, 163, 164, 165,
167, 168, 169, 170, 171, 182, 183, 204, 206, 217,
218, 230, 231, 234
fibrils, 68, 158, 169, 195, 211, 217, 221
fibroblasts, vii, 212, 230
fibronectin, 163
filament, 134, 148, 151
filtration, 124
flexibility, 92
flight, 89, 176, 177, 186
flow, 41, 88, 91, 124, 126, 128, 187, 243
flow rate, 124
fluid, 18, 67, 69, 75, 76, 77, 78, 87, 118, 124, 125,
129, 131, 133, 138, 146, 147, 148, 149, 150, 152,
153, 155, 158, 159, 191, 192, 194, 195, 197, 199,
200, 201, 249, 257
fluid intelligence, 18
fluorescence, 91, 95, 98, 99, 101
fluorine, 40
fMRI, 33, 37, 38, 39, 55, 60, 63
G
gauge, 128
G-CSF, 188
GDNF, 188
gel, 89, 176, 177, 178
gels, 177, 178, 186, 187
gender, 53, 111, 185, 199, 220, 224, 228, 266, 270
gender effects, 53
gene, 31, 32, 59, 70, 86, 88, 165, 166, 171, 175, 176,
190, 191, 199, 201, 202, 208, 210, 212, 215, 216,
217, 221, 226, 231, 236, 237, 238, 239, 265, 266,
267, 269, 271, 272, 276, 278
gene expression, 171, 208, 212, 216, 217, 226, 276
gene pool, 266
gene promoter, 231
gene transfer, 236
Index
generation, 70, 82, 171, 252, 262
genes, 158, 171, 175, 176, 188, 192, 213, 217, 237,
251, 271, 272, 277
genetic, 37, 46, 51, 55, 63, 64, 79, 137, 142, 154,
161, 165, 171, 188, 190, 204, 205, 208, 243, 256,
266, 269, 270
genetic control, 208
genetic defect, 79
genetic factors, 269
genetic marker, 137, 205
genome, 176
genomics, 175
genotype, 45, 61, 117, 154, 199, 248, 249, 265, 266,
268, 269, 270, 271, 272, 273, 274, 275, 277, 278,
279
genotypes, 269, 277
geriatric, 76
gestalt, 18
glass, 106, 141
glia, 170, 244, 253
glial, 68, 140, 144, 150, 153, 159, 161, 182, 188,
221, 230, 242, 254
glial cells, 144, 150, 153, 159, 161, 221, 230, 242
glial fibrillary acidic protein (GFAP), 140
gliosis, 135, 152
gloves, 127
glucocorticoid receptor, 212, 239
glucocorticoids, 212, 227
glucose, 40, 42, 43, 44, 45, 46, 47, 53, 55, 56, 58, 61,
62, 64, 66, 140, 143, 173, 214, 248, 260
glucose metabolism, 40, 42, 43, 44, 45, 46, 47, 53,
55, 58, 61, 66, 173, 214
glutamate, 256
glutamatergic, 48
glutathione, 257
glycation, 200
glycolysis, 248
glycoprotein, 165, 177, 201, 203, 214, 231, 234, 238,
239
glycoproteins, 210
glycosaminoglycans, 160, 163
glycosylated, 202, 214, 215
glycosylation, 105, 176, 214
goals, 30, 69, 116
gold, 14, 32, 85, 96, 105, 125, 242, 253
gold standard, 14, 32, 85, 105, 125, 242
government, 86
grain, 172, 198
grains, 135
grants, 117
291
graph, 147
gray matter, 35, 53, 54, 59, 161, 203, 246
grey matter, 35, 36
grouping, 274
groups, 5, 6, 13, 19, 20, 22, 30, 36, 45, 48, 74, 84,
85, 107, 108, 111, 112, 113, 145, 146, 173, 178,
181, 184, 186, 187, 223, 224, 230, 269, 273
growth, 68, 76, 82, 86, 169, 170, 188, 206, 210, 214,
230, 235, 245, 276
growth factor, 188, 230
growth factors, 188, 230
growth hormone, 214, 235
GST, 233
guessing, 16
guidance, 101, 186
guidelines, 47, 51, 52, 60, 69, 93
Guillain-Barre syndrome, 150
gyri, 126
gyrus, 35, 36, 41, 42, 43, 46, 249
H
half-life, 41
handling, 92, 107, 141, 186, 187
hands, 21, 61
harm, 131, 132
HDL, 234
head, 127, 128, 130, 137, 149, 270, 277
head injury, 137, 149, 270, 277
headache, 129, 147
health, 7, 86, 195, 201, 220, 234
heart, 214, 239, 243, 258, 277
heart disease, 214, 239, 243
height, 127, 128
heme, 200
heme oxygenase, 200
hemispheric asymmetry, 38
hemostasis, 216
herpes, 142
herpes simplex, 142
heterodimer, 178
heterogeneity, 3, 4, 6, 259, 275
heterogeneous, 2, 5, 31, 39, 70, 90, 157, 173, 183,
247, 273, 274
heterozygotes, 63, 194
high density lipoprotein, 230
high risk, 1, 3, 32, 45, 74, 148, 213
high scores, 21
high-density lipoprotein, 239
high-risk, 2
292
Index
hippocampal, 35, 37, 39, 43, 46, 49, 55, 56, 58, 61,
62, 64, 66, 68, 87, 164, 165, 172, 173, 192, 195,
221, 227, 252, 253, 260, 265, 267
hippocampus, 30, 34, 35, 37, 43, 47, 49, 56, 71, 87,
138, 165, 167, 168, 173, 176, 199, 206, 207, 221,
226, 233, 235, 236, 237, 269
hips, 127
Hispanic, 270
Hispanics, 270, 277
histamine, 189
histochemical, 41
histological, 47, 137
HIV, 140, 142, 152, 162, 202
HIV-1, 152, 202
HLA, 201
homeostasis, 87, 212
homocysteine, 88, 117
homogeneity, 94
homogeneous, vii, 2, 38
homolog, 231
homology, 230, 232
homozygosity, 265, 268, 269
homozygote, 248
hormone, 216, 221, 227
hormones, 221, 230
horse, 90
host, 229, 232
HPA, 226, 229
HPA axis, 226
human, 24, 38, 44, 47, 48, 63, 72, 77, 79, 88, 93, 97,
98, 119, 120, 121, 125, 134, 137, 146, 148, 163,
164, 165, 166, 168, 169, 176, 183, 186, 190, 194,
197, 200, 201, 202, 203, 204, 208, 210, 212, 214,
218, 230, 231, 233, 235, 236, 237, 238, 249, 250,
251, 252, 253, 257, 259, 260, 275, 276
human brain, 38, 72, 88, 125, 134, 165, 183, 208,
257
human genome, 176
humans, 47, 231, 243, 251
hybridization, 249, 252, 253
hybridoma, 95, 103
hydrocephalus, 6, 127, 129
hydrophobic, 214
hypercalcemia, 142
hypercapnia, 246
hypercholesterolemia, 248, 249
hyperhomocysteinemia, 31
hyperlipidemia, 31
hyperphosphorylation, 30, 52, 69, 134, 174, 227
hypertension, 243, 261, 271
hypoglycemia, 142
hypogonadal, 223, 232
hypometabolic, 43
hypoperfusion, 40, 45, 46, 159, 172, 242, 243, 244,
245, 246, 248, 249, 252, 253, 255, 256, 260, 262,
263
hypopnea, 271, 277
hypotension, 271
hypothalamic, 223, 226
hypothalamus, 126
hypothesis, 12, 17, 30, 44, 54, 63, 71, 72, 133, 136,
160, 161, 210, 217, 219, 232, 242, 247, 249, 257,
260, 274, 275
hypothyroidism, 142
hypoxia, 221, 252, 271
hypoxic, 242, 245
I
ICAM, 160, 162, 188
identification, 2, 4, 24, 29, 30, 31, 34, 51, 68, 74, 86,
88, 89, 95, 103, 151, 176, 177, 189, 231
identity, 91, 235
idiopathic, 150, 153
IGF, 188, 189
IGF-I, 189
IgG, 119
IL-1, 161, 170, 176, 178, 180, 185, 187, 188, 189,
192, 203, 204, 210, 213, 217, 219
IL-10, 178, 185, 187, 204
IL-2, 178, 218
IL-6, 161, 163, 178, 180, 181, 185, 186, 187, 200,
212, 217, 219, 222, 225, 226, 228, 229, 233
IL-8, 181, 185, 187
ilium, 127
image analysis, 43, 61
images, 34, 39, 42, 50, 116, 178
imaging, 30, 33, 34, 36, 38, 40, 41, 43, 44, 46, 47,
48, 49, 50, 51, 52, 54, 56, 58, 59, 60, 61, 62, 75,
83, 119, 129, 159, 172, 173, 174, 186, 188
imaging modalities, 30
imaging techniques, 36, 48, 159, 173, 186, 188
imbalances, 243, 245, 255
immune cells, 272
immune function, 175
immune response, 187
immune system, 164, 195, 199, 204, 225
immunization, 90, 171, 202
immunoassays, 90, 101, 103, 120, 180, 187
immunocompetent cells, 206
Index
immunocytochemistry, 249
immunogenicity, 90
immunoglobulin, 150
immunoglobulins, 90, 162
immunohistochemical, 138, 158, 160, 171, 177, 181,
182, 204
immunohistochemistry, 175
immunological, 94, 153
immunoprecipitation, 176
immunoreactivity, 95, 97, 98, 103, 104, 105, 160,
168, 206, 207, 247, 252, 262
immunostain, 170
immunotherapy, 31, 155
impairments, 2, 3, 16, 49
implementation, 85, 117
impurities, 95
in situ, 90, 251, 253
in situ hybridization, 253
in vitro, 54, 76, 92, 158, 162, 163, 165, 166, 170,
183, 200, 205, 208, 211, 221, 225, 235, 246, 251,
259, 267, 268, 276
in vivo, 12, 34, 40, 47, 48, 49, 54, 65, 141, 143, 164,
165, 168, 190, 193, 217, 221, 246, 251, 262, 268
inactivation, 177
inactive, 227
incidence, 4, 7, 8, 14, 19, 30, 170, 211, 221, 230,
233, 238, 239, 267, 272, 277
inclusion, 4, 84, 92, 93, 108, 112, 134, 138, 144,
151, 174
inclusion bodies, 134
incubation, 96, 97, 103, 163, 209
incubation period, 209
incubation time, 96
independence, 33, 64
indication, 14, 22, 247
indicators, 46, 67, 75, 83, 211, 213, 218
indices, 12, 18, 23, 63, 213, 256
inducible protein, 166, 181
induction, 181, 192
industry, 86, 90, 121
infarction, 7
infection, 152
infections, 140, 142
infectious, 143
inflammation, 30, 87, 136, 157, 158, 160, 163, 167,
170, 171, 176, 177, 178, 179, 180, 182, 186, 188,
193, 195, 199, 205, 209, 213, 214, 216, 217, 223,
229, 233, 234, 237, 244, 245
inflammatory, vii, 145, 147, 157, 158, 159, 160, 161,
162, 166, 169, 170, 171, 174, 181, 184, 185, 187,
293
189, 190, 193, 196, 197, 200, 213, 217, 219, 221,
225, 235
inflammatory disease, 174
inflammatory mediators, 162, 171
inflammatory response, 159, 160, 161, 169, 170,
171, 217, 219, 225
inflammatory responses, 159, 217
inheritance, 265, 267, 268, 275
inherited, 142, 158
inhibition, 60, 199, 227, 246, 252
inhibitor, 163, 164, 166, 168, 170, 179, 181, 182,
189, 192, 199, 209, 231
inhibitors, 31, 49, 166, 179, 213
inhibitory, 212, 226
initiation, 75, 159, 162, 170, 215, 245
injection, 40, 128, 217
injury, 129, 133, 149, 150, 151, 165, 180, 185, 217,
242, 244, 245, 252, 258, 267, 270, 276
innate immunity, 167, 194, 195
innovation, 118
iNOS, 242, 244
insertion, 127, 128
insight, 57, 254
instability, 73
instruction, 18
instruments, 5
insulin, 31, 89, 158, 175, 233, 235
insulin-like growth factor, 235
insults, 221
integration, 91, 106
integrin, 71
integrins, 71, 79, 169, 193
integrity, 21, 62, 163
intellectual functioning, 70
intellectual property, 85
intellectual property rights, 85
intensity, 32, 39, 72, 91, 94, 95, 98, 99, 101
interaction, 163, 164, 165, 192, 268, 276
interactions, 61, 200, 227, 236, 266, 270, 271, 272
intercalation, 163
intercellular adhesion molecule, 162
interference, 17, 104, 106
interferon, 166, 178, 181, 194
interferon (IFN), 178, 204
interleukin, 166, 167, 190, 191, 192, 195, 198, 199,
202, 206, 209, 212, 213, 228, 236
interleukin-1, 167, 192, 195, 198, 199, 202
interleukin-1, 191, 195, 200, 204, 238
interleukin-6, 190, 191, 198, 199, 206, 209, 212
interleukin-8, 166
Index
294
J
JAMA, 7, 120, 155, 209, 232, 238, 239, 277
Jung, 201
K
killing, 242
kinases, 217
knees, 127
L
L1, 127
L2, 127
labeling, 59, 109, 177, 186
labor, 92
Index
lipid metabolism, 175, 197, 216, 233, 266
lipid peroxidation, 242, 245, 252, 258
lipid rafts, 215
lipids, 234, 265, 267
lipodystrophy, 142
lipofuscin, 252, 255
lipopolysaccharide, 187
lipoprotein, 131, 164, 209, 232, 249, 260, 276
lipoproteins, 165, 180, 193, 214, 217, 236, 249, 261
liquid chromatography, 105, 120
liquids, 90
literature, 5, 11, 15, 17, 22, 24, 91, 112, 132, 242,
243
liver, 125, 188, 259, 266, 267, 275
LOAD, 175, 269, 270, 271
local anesthesia, 127
local anesthetic, 127, 128
localised, 139
localization, 37, 148, 158, 249, 253
location, 85, 88, 130, 184
locus, 266
LOD, 99, 100
London, 25, 26, 123
longevity, 275
longitudinal studies, 3, 35, 85, 116, 137
longitudinal study, 17, 35, 45, 184, 185, 191, 199
long-term, 17, 95, 107, 108, 165, 250
long-term memory, 17
long-term potentiation, 165
losses, 90, 247
lover, 4
low molecular weight, 177
low risk, 181
low-density, 197, 236, 261
low-density lipoprotein, 197, 236, 261
low-density lipoprotein receptor, 197
LPS, 167, 187, 194, 219
lumbar, 106, 108, 124, 126, 127, 128, 129, 130, 131,
141, 143, 147, 152, 204
lumbar puncture, 106, 108, 124, 126, 127, 129, 130,
131, 147
lumbar spine, 129
lung, 139, 153
lung cancer, 139, 153
lymphocyte, 200
lymphocytes, 218, 232, 234, 235, 237
lysine, 245
lysis, 141
lysosome, 164, 214, 255
lysosomes, 253, 255
295
M
mAb, 90, 91, 94, 95, 97, 98, 99, 103, 104, 110
macromolecules, 244, 245
macrophage, 161, 162, 166, 216, 217, 220, 235, 237
macrophage inflammatory protein, 166
macrophages, 217, 225, 230, 236, 272
magnetic, 37, 38, 54, 62, 63, 146, 159, 172, 208
magnetic field, 38
magnetic resonance, 37, 54, 62, 63, 146, 159, 172,
208
magnetic resonance imaging (MRI), 33, 34, 35, 36,
37, 38, 39, 40, 43, 46, 47, 52, 53, 54, 55, 56, 57,
58, 62, 63, 65, 66, 68, 75, 126, 144, 146, 159,
167, 172, 173, 174, 205, 208
magnetization, 40
Maillard reaction, 258
maintenance, 2, 163
major depression, 25, 76
major histocompatibility complex, 161
malaria, 216, 237
males, 19, 20, 108, 109, 110, 230, 270, 273, 278
malignant, 235
mammalian cell, 276
mammalian cells, 276
management, 47, 48, 51, 60, 127, 147, 243
manganese, 142, 246
manifold, 85
MAPK, 197, 217
mapping, 55, 62, 64, 66, 103
market, 89, 92
marrow, 233
mask, 144
masking, 90, 141
mass spectrometry, 89, 90, 176
mastoid, 38
mathematical, 4
matrices, 11, 16, 17, 25, 26
matrix, 89, 92, 97, 106, 107, 110, 163, 177, 186,
195, 254
matrix protein, 163
maturation, 245
MCI, vii, 1, 2, 3, 4, 5, 6, 8, 29, 30, 32, 34, 35, 36, 37,
39, 40, 43, 45, 48, 49, 53, 54, 55, 60, 61, 62, 65,
70, 74, 115, 116, 119, 135, 143, 155, 158, 172,
173, 175, 176, 177, 178, 180, 181, 184, 185, 187,
205, 208, 211, 212, 213, 218, 219, 220, 230, 266,
274, 275
MCP-1, 166, 167, 180, 181, 185, 195
296
Index
measurement, 33, 36, 40, 48, 84, 87, 92, 95, 98, 101,
119, 120, 125, 133, 135, 141, 143, 184, 188, 190,
192, 227
measures, 7, 12, 25, 32, 33, 37, 40, 49, 51, 58, 107,
119, 174, 213
median, 91, 98, 99, 101, 102, 112, 126, 181, 184
mediators, 167, 171, 185
medication, 16, 17, 271
medicine, 234
medulla, 131
medulla oblongata, 131
memory, 1, 2, 3, 4, 5, 7, 8, 14, 16, 17, 18, 19, 20, 24,
25, 29, 32, 39, 41, 43, 45, 48, 60, 62, 64, 65, 67,
70, 75, 87, 142, 155, 186, 188, 191, 226, 231,
232, 234, 236, 239, 243, 262, 265, 268, 270, 274,
277
memory deficits, 43, 188
memory loss, 3, 87
memory performance, 2, 70, 232, 277
men, 211, 222, 223, 226, 228, 229, 239, 270, 272
meninges, 124, 125
meningitis, 137, 142, 147, 150
meningoencephalitis, 145
menopausal, 212, 220, 221, 223, 226, 227, 228, 229,
230, 235, 236
menopause, 211, 221, 223, 229, 230, 234, 236
mental ability, 243
mental disorder, 230
mental impairment, 16
mental state, 133, 181, 186
mercury, 142
meta-analysis, 85, 151, 165, 233, 236, 273, 278
metabolic, 6, 41, 42, 43, 45, 46, 53, 57, 61, 62, 64,
87, 142, 209, 221, 248, 256, 258, 260
metabolic disorder, 142
metabolic rate, 62, 248
metabolic syndrome, 209
metabolism, 40, 41, 42, 43, 45, 46, 57, 61, 70, 76,
152, 160, 161, 163, 166, 168, 169, 193, 196, 210,
212, 213, 233, 239, 248, 249, 250, 261
metabolite, 216, 252
metabolomics, 187
MFI, 91, 98, 99, 101
MHC, 161, 167
mice, 166, 167, 168, 169, 191, 193, 202, 209, 217,
223, 227, 232, 237, 239, 246, 249, 252, 253, 254,
255, 259, 262, 263, 267, 276
microarray, 171, 176, 191
microbes, 237
microbial, 267
Index
molecular pathology, 55
molecular weight, 134, 137, 166, 176, 214
molecules, vii, 36, 39, 40, 90, 157, 161, 169, 170,
171, 181, 193, 204, 214, 217, 218
monoclonal, 72, 90, 145, 161, 204, 252
monoclonal antibodies, 72, 90, 145, 152, 161, 204
monoclonal antibody, 252
monocyte, 161, 162, 166, 167, 197, 220, 231, 236,
238
monocyte chemoattractant protein, 166, 167, 197
monocytes, 202, 215, 216, 217, 223, 231, 239
monomeric, 206
morbidity, 133, 175
morning, 227
morphological, 40, 70, 238, 250
morphological abnormalities, 40
morphometric, 247, 259
mortality, 129, 130, 131, 147, 202
motion, 36
motor neuron disease, 135
mouse, 90, 98, 168, 190, 193, 201, 233, 237, 249,
252, 259, 261, 262
mouse model, 168, 193, 201, 233, 252, 259, 261
movement, 55, 88
movement disorders, 55
mRNA, 134, 165, 203, 215, 234, 238, 267, 275
mtDNA, 242, 249, 251, 252, 253, 255, 256, 262
multi-infarct dementia, 25, 153, 192
multiple regression, 43
multiple sclerosis, 142, 148, 162, 192
multiplexing, 90, 92
multiplicity, 223
multivariate, 46, 59, 66
muscle, 247, 260
muscle atrophy, 260
mutant, 168, 223, 259
mutants, 214
mutation, 199
mutations, 31, 136, 158, 175, 216, 223, 236, 251
myeloma, 90
myocardial infarction, 147
myotonic dystrophy, 135
N
NAD, 73
NADH, 252
naming, 69
national, 65, 86
National Academy of Sciences, 258
297
298
Index
neuroimaging, 6, 29, 30, 32, 33, 34, 38, 45, 47, 51,
52, 54, 55, 61, 70, 86, 116, 234
neuroimaging techniques, 30
neuroinflammation, 51, 79, 161, 167, 178, 183, 185,
187, 193, 208
neuroleptics, 41
neurologic disorders, 73
neurological disease, 44, 146, 150, 151, 178
neurological disorder, 73, 149, 192, 265, 268
neuronal apoptosis, 164, 207, 217
neuronal cells, 163, 183, 184, 247
neuronal death, vii, 30, 125, 131, 133, 140, 158
neuronal degeneration, 37, 72, 140, 152, 153, 265,
267
neuronal loss, 34, 133, 167, 173, 212, 218, 223, 227,
252
neuronal survival, 170, 231
neurons, 30, 31, 32, 69, 70, 125, 126, 133, 138, 139,
144, 150, 161, 162, 164, 165, 167, 170, 171, 183,
184, 190, 196, 203, 217, 221, 227, 231, 234, 237,
242, 243, 244, 246, 247, 251, 252, 253, 257, 259,
262, 265, 267
neuron-specific enolase, 153
neuropathological, 31, 34, 43, 44, 85, 160, 172, 198,
203, 219, 226, 274
neuropathology, 58, 59, 69, 79, 115, 148, 174, 192,
194, 196
neuropathy, 142
neuropeptide, 202
neuroprotection, 207
neuroprotective, 198, 206, 207, 211, 221, 222, 227,
230, 232
neuroprotective agents, 221
neuropsychological assessment, 19, 20, 37
neuropsychological tests, 12, 33
neuropsychology, 46
neuroscience, 54
neurosyphilis, 142
neurotoxic, 30, 145, 164, 167, 169, 170, 211, 222,
223, 227, 260
neurotoxic effect, 30, 145, 164, 227
neurotoxicity, 88, 164, 165, 203, 209, 275
neurotransmission, 40, 41, 248
neurotransmitter, 34, 39, 136
neurotrophic, 71, 176, 192, 221
neutrophil, 166
neutrophils, 237
NFL, 152
NFT, 73, 88
NF-B, 176
NHS, 94
nicotine, 252, 262
nicotinic acid, 142
nigrostriatal, 49, 234
NINDS, 19, 26
nitric oxide (NO), 219, 232, 242, 244, 257, 258, 261,
262
nitric oxide synthase, 219, 232, 244, 262
NO synthase, 242
noise, 94
non invasive, 14
non-AD dementias, 87
non-enzymatic, 184
non-human, 260
non-invasive, 12, 37, 69, 115, 220
nonlinear, 60
non-steroidal anti-inflammatory drugs (NSAIDs),
170
normal, vii, 2, 3, 4, 8, 13, 14, 15, 19, 20, 21, 22, 23,
26, 29, 31, 32, 35, 39, 40, 41, 42, 43, 44, 45, 48,
49, 50, 51, 52, 55, 56, 57, 59, 60, 61, 63, 66, 67,
68, 70, 72, 73, 74, 75, 76, 77, 78, 83, 85, 87, 116,
120, 124, 125, 128, 131, 132, 134, 135, 137, 140,
143, 145, 146, 149, 159, 161, 166, 170, 173, 181,
184, 193, 200, 208, 209, 213, 217, 221, 243, 245,
249, 256, 266, 274
normal aging, vii, 2, 3, 4, 8, 32, 35, 39, 41, 55, 57,
61, 66, 67, 73, 75, 78, 85, 87, 170, 213, 256, 274
normal children, 26
normal conditions, 131
normal pressure hydrocephalus, 52, 140
normalization, 42
NOS, 219, 244, 255
NSE, 139, 140, 145
N-terminal, 70, 71, 88, 134, 177
nuclear, 216, 227, 237, 251
nucleation, 165
nuclei, 46, 207
nucleosomes, 232
nucleotide sequence, 214
nucleotides, 215
nucleus, 232, 251, 262
nurses, 3
nutrients, 68
nutritional deficiencies, 6
O
obese, 235
observations, 17, 169, 217, 250, 252, 261
Index
obstructive sleep apnea, 271, 277
occipital cortex, 46
occipital lobe, 37
occupational, 5, 44
odds ratio, 271
oestrogen, 234
old age, 168, 186, 205
older adults, 1, 5, 54, 63
oligodendrocytes, 163
oligomeric, 165, 171, 183
oligomers, 30, 88, 198
oncology, 132
operator, 101
opioid, 48
optic nerve, 267
optical, 99
optical density, 99
optimal performance, 96
optimization, 81, 86, 94, 191
oral, 237
organelles, 251
organic, 108, 176
organic disease, 108
organic solvent, 176
organization, 7, 105, 231, 238
orientation, 18, 22, 68
outpatient, 131
outpatients, 279
overproduction, 242
oxidation, 198, 242, 245, 251, 252, 257, 263
oxidative, 30, 62, 87, 136, 170, 185, 199, 202, 203,
212, 213, 218, 223, 234, 235, 236, 242, 244, 245,
246, 248, 250, 251, 252, 253, 254, 255, 256, 257,
258, 260, 262, 271
oxidative damage, 235, 236, 250, 251, 257, 262
oxidative stress, 30, 62, 87, 136, 170, 185, 199, 202,
203, 213, 223, 234, 242, 244, 245, 246, 248, 250,
252, 253, 254, 255, 256, 257, 258, 260, 262, 271
oxide, 256
oxygen, 38, 40, 217, 244, 245, 248, 250, 252, 260
oxygen consumption, 40, 245, 252
oxygenation, 37, 40, 62
P
p38, 197
p53, 234
pain, 12, 128
paper, 19, 21, 47, 52, 121, 132, 146
paracentesis, 147
299
paracrine, 223
paramagnetic, 38, 39
parameter, 8, 59, 119, 224
paraneoplastic, 142
parasite, 216
parenchyma, 124, 125, 126, 158, 220
parenchymal, 242, 244, 255
parenchymal cell, 242, 244, 255
parietal cortex, 41, 217, 238
parietal lobe, 34, 40
parietal lobes, 34, 40
Parkinson, 17, 25, 36, 48, 54, 60, 63, 65, 67, 72, 73,
77, 109, 121, 135, 139, 142, 143, 153, 159, 178,
187, 190, 191, 198, 208, 234
Parkinson disease, 65, 187
parkinsonism, 135
passive, 94, 159, 171
pathogenesis, 52, 68, 89, 118, 136, 149, 160, 161,
168, 170, 171, 174, 175, 186, 188, 193, 194, 213,
216, 219, 222, 229, 242, 245, 248, 249, 250, 251,
252, 253, 260, 263, 268, 271, 273
pathogenic, 69, 75, 83, 132, 170, 171, 175, 188, 196,
231, 247
pathologic diagnosis, 60
pathology, 2, 6, 12, 14, 15, 19, 20, 30, 32, 34, 37, 43,
52, 53, 59, 64, 72, 76, 77, 87, 108, 124, 127, 132,
135, 140, 143, 144, 148, 151, 153, 155, 159, 161,
167, 168, 170, 172, 178, 183, 197, 202, 204, 217,
218, 230, 242, 243, 247, 248, 249, 251, 254, 258,
259, 261, 266, 267
pathophysiological, 152, 206, 212, 233, 250
pathophysiology, 49, 134, 244, 245, 248, 254, 256,
257
pathways, 55, 70, 78, 87, 115, 160, 164, 171, 190,
196, 217, 218, 239, 270, 275
patient management, 92, 143, 243
PCR, 140
PDC, 17
PDGF, 188
peer, 70
PENN, 86
Pennsylvania, 81, 86, 116
peptide, vii, 68, 70, 71, 76, 78, 89, 103, 136, 158,
160, 162, 163, 166, 171, 176, 190, 191, 192, 196,
197, 198, 200, 202, 205, 208, 209, 213, 239, 246,
248, 249, 259, 268, 271, 276
peptides, 30, 70, 72, 79, 88, 90, 95, 96, 99, 103, 106,
119, 120, 136, 162, 163, 164, 166, 176, 246, 249
perception, 12
perceptual processing, 41
300
Index
Index
postmenopausal women, 211, 221, 223, 232, 238
postmortem, 37, 49, 144, 170, 200, 204, 249, 260
postsynaptic, 49, 50
post-translational modifications, 105, 141, 187
posture, 127
power, 22, 33, 36, 51, 70, 145, 146, 160
praxis, 19, 20, 21
pRb, 197
precipitation, 176
preclinical, 2, 3, 17, 33, 37, 45, 57, 59, 60, 62, 67,
70, 108, 112, 173, 212, 232
pre-clinical, 29
prediction, 8, 37, 45, 61, 120, 149, 173, 204, 206
predictor variables, 112, 113
predictors, 7, 65, 77, 112, 149, 233
preference, 234, 237
prefrontal cortex (PFC), 38
pregnant, 128
pregnant women, 128
premenopausal, 223
premenopausal women, 223
presenilin 1, 158, 175
pressure, 127, 128, 129, 131, 140, 143, 147, 216
presynaptic, 41, 49, 50, 66
prevention, 59, 75, 168, 231, 234, 238
preventive, 29, 174, 203, 249
primacy, 16, 17
primacy effect, 16, 17
primary care, 120
primary degenerative dementia, 7, 8, 142, 143
primate, 260
primates, 234
principal component analysis, 66
printing, 89
priorities, 86
private, 116, 117
probability, 4, 84, 112, 115, 219, 230, 265, 268, 271,
275
probe, 54, 253
problem solving, 19, 20
procedures, 42, 82, 90, 93, 95, 96, 101, 107, 117,
147
process control, 94, 95, 103
production, 27, 31, 52, 68, 90, 93, 94, 99, 100, 102,
105, 136, 146, 158, 164, 166, 167, 171, 187, 197,
200, 204, 207, 209, 217, 219, 221, 222, 223, 225,
227, 232, 236, 237, 248, 250
progesterone, 235
progestins, 221
prognosis, 8, 12, 15, 29, 32, 144, 213, 275
301
Index
302
psychiatric disorders, 4, 73, 277
psychiatric illness, 271
psychoanalysis, 147
psychobehavioural, 68
psychosis, 142, 271
public, 82, 86, 116, 117
public health, 82, 86, 117
PUFAs, 245
purification, 105, 120
pyramidal, 138, 196, 237
Q
quality control, 82, 93, 95, 117
R
radical, 250
radiolabeled, 173
radiological, 174
radionuclides, 38
radiopharmaceuticals, 40
RAGE, 167, 209
random, 31, 148
range, 4, 22, 29, 32, 37, 74, 91, 97, 98, 99, 100, 101,
102, 109, 112, 125, 128, 181, 184
RANTES, 166
rat, 90, 98, 153, 164, 165, 169, 203, 205, 206, 207,
223, 230, 237, 246, 252, 258, 262, 267, 276
rats, 164, 230, 262, 275
raw material, 82, 94, 95, 96
raw materials, 82, 94, 95, 96
reactant, 166, 199
reactants, 170, 216
reactive oxygen species (ROS), 170, 217, 226, 232,
242
reactivity, 92, 103
reagent, 178
reagents, 82, 92, 93, 94, 95, 117
reasoning, 18, 24
recall, 16, 17, 277
recalling, 219
recency effect, 16, 17
receptors, 41, 48, 49, 59, 62, 66, 128, 161, 167, 190,
194, 199, 200, 214, 216, 217, 218, 222, 226, 230,
235, 276
recognition, 16, 17, 19, 20, 39, 42, 144, 223, 230,
232, 237
reconstruction, 36, 126
recovery, 191
recruiting, 220
recurrence, 14
red blood cells, 212
redox, 242, 244, 245
reduction, 37, 38, 41, 43, 49, 50, 54, 61, 71, 92, 93,
102, 131, 164, 171, 219, 220, 221, 223, 227, 245,
248, 269
reflection, 87, 88
regeneration, 77, 169, 184, 197, 276
regional, 37, 40, 41, 43, 44, 55, 57, 58, 59, 62, 64,
173, 203, 206, 247, 248, 254, 260
region-of-interest, 37
regression, 84, 112, 113, 115, 182
regression analysis, 112
regulation, 137, 169, 192, 212, 223, 226, 234, 236,
237, 245, 246
regulators, 149, 171, 209
relationship, 14, 22, 36, 38, 44, 48, 55, 65, 112, 115,
125, 131, 144, 171, 204, 221, 224, 232, 246, 247,
249, 252, 255, 259, 268
relationships, 233
relatives, 189, 196, 269
relaxation, 246
relevance, 84, 110, 123, 124, 136, 138, 234, 261
reliability, 36
remodeling, 169, 170, 267
remodelling, 184
remyelination, 267, 276
renal, 142, 258, 260
repair, 170, 171, 265, 267, 276
reperfusion, 242, 251, 252, 256, 258
replication, 237
research, 4, 12, 19, 22, 23, 26, 29, 34, 38, 51, 52, 64,
65, 67, 70, 75, 89, 91, 92, 95, 117, 120, 124, 132,
136, 137, 143, 159, 172, 174, 186, 213, 242, 246,
252, 261
researchers, 2, 12, 18, 212
reserve capacity, 44
reservoir, 227
residues, 136
resistance, 128, 130, 246
resolution, 34, 38, 40, 41, 59, 150, 178
resources, 39
respiration, 252, 262
respiratory, 250, 251, 252
responsiveness, 204, 234, 237
restoration, 169
retention, 17, 47, 48
retina, 267
Index
retinoblastoma, 171
retinoic acid, 216
rheumatic, 242
rheumatoid arthritis, 147, 179
Rho, 148
risk, vi, 3, 4, 8, 29, 30, 31, 32, 35, 37, 39, 62, 63, 64,
70, 75, 86, 115, 128, 129, 130, 131, 135, 154,
159, 161, 165, 166, 168, 172, 175, 181, 184, 186,
194, 198, 199, 201, 209, 211, 212, 213, 216, 217,
219, 220, 221, 223, 227, 229, 230, 238, 243, 245,
247, 248, 249, 259, 260, 265, 268, 269, 270, 271,
272, 273, 274, 276, 277, 278
risk factors, 8, 31, 86, 128, 154, 161, 199, 212, 223,
229, 243, 245, 249, 259, 270
risks, 269
RNA, 175, 176, 242, 245, 251, 252, 257
roadmap, 81
robotics, 92
rodent, 223
rodents, 214
rofecoxib, 6, 9
room temperature, 96, 107, 128
ROS, 244, 245, 246, 252
rubella, 142
RXR, 216
S
safety, 83, 132, 145
sample, 4, 14, 19, 23, 43, 74, 85, 90, 92, 93, 95, 96,
99, 100, 103, 104, 105, 106, 107, 109, 116, 117,
119, 129, 141, 145, 148, 167, 176, 206, 236, 273
sampling, 108, 110, 123, 141, 186
SAP, 160, 162, 163, 164, 168, 183, 184, 185, 208,
252
scaling, 101
scaling approach, 101
scavenger, 167, 194, 203, 211, 214, 216, 217, 230,
232, 233, 235
SCD, 19
schizophrenia, 272, 278
schizophrenic patients, 272
schooling, 23
science, 51, 239
scientific, 12, 31, 69, 70, 83, 116, 242
scientific community, 12, 69, 70
scientific progress, 31
scintigraphy, 55
scores, 5, 6, 21, 37, 48, 50, 181, 183, 184
SDF-1, 166
303
SDH, 235
SDS, 165
search, 82, 121, 140, 148, 160, 174, 175, 177, 203,
213, 214, 229
searching, 176, 187
secretion, 163, 166, 168, 208, 217, 219, 233
segmentation, 34
selecting, 84
selectivity, 103, 104
self-assembly, 192
self-organization, 190
SEM, 220
semantic, 12, 43, 54, 55
semantic memory, 43
senile, 8, 16, 30, 68, 69, 70, 71, 72, 87, 136, 149,
160, 167, 190, 193, 197, 199, 200, 201, 203, 208,
213, 216, 217, 219, 220, 231, 236, 242, 246, 260,
265, 268, 269
senile dementia, 8, 190, 199, 200, 201, 203, 213,
231, 236
senile plaque, 191
senile plaques, 16, 30, 68, 69, 70, 71, 87, 136, 149,
160, 193, 197, 201, 208, 216, 217, 219, 220, 231,
242, 246, 260, 265, 268, 269
sensitivity, 11, 12, 13, 14, 17, 18, 19, 20, 21, 22, 23,
24, 26, 30, 31, 34, 36, 37, 46, 50, 52, 67, 69, 73,
74, 75, 84, 94, 95, 97, 99, 100, 115, 131, 135,
136, 137, 142, 143, 144, 155, 159, 172, 174, 175,
182, 189, 218, 232
separation, 90, 113, 177, 178
sequencing, 151
series, 17, 20, 31, 85, 93, 99, 101, 102, 110, 279
serine, 73, 134, 166, 181, 182, 189, 190
serpin, 166, 181
serum, vii, 90, 95, 109, 124, 125, 140, 151, 153, 158,
160, 162, 163, 172, 176, 177, 180, 181, 185, 189,
190, 191, 194, 195, 196, 198, 199, 202, 203, 204,
207, 210, 249, 262, 267
serum albumin, 125, 153
services, iv
severity, 4, 6, 7, 14, 22, 41, 42, 43, 48, 149, 155,
173, 183, 203, 205, 219, 231, 237, 247, 256
sex, 23, 108, 184, 212, 221, 223, 224, 226, 227, 229,
230, 233, 239
sex ratio, 108
sex steroid, 239
SGP, 203
shape, 18, 19
shaping, 137
shares, 32
304
Index
spectrophotometry, 147
spectrum, 124, 135, 142, 143, 204, 252
speed, 23, 243
spin, 38, 40, 56, 59
spin labeling, 56
spinal cord, 87, 124, 127
spinal tap, 147
spine, 127
spinocerebellar ataxia, 109
spleen, 90, 215, 259
splenium, 37
sporadic, 9, 31, 115, 135, 136, 137, 149, 158, 165,
171, 232, 268, 269, 270, 276, 278
sprouting, 170, 265, 267
stability, 72, 94, 95, 107, 108, 118, 121, 134, 154,
248
stabilize, 68, 73
stages, 2, 6, 21, 22, 23, 29, 30, 32, 34, 37, 52, 68, 77,
85, 157, 159, 162, 167, 171, 172, 173, 174, 181,
183, 184, 187, 188, 189, 196, 197, 205, 219, 246,
251
stakeholders, 116
standard deviation, 2, 23, 99, 145
standard error, 113
standard operating procedures, 116
standardization, 79, 82, 85, 86, 121
standards, 59, 105, 119
statins, 31
statistics, 42, 148
stenosis, 267
sterile, 130
steroid, 226, 236, 238
steroids, 227, 233
stimulus, 187, 242
stock, 102, 107
storage, 25, 85, 106, 107, 108, 141, 186
strategies, 6, 29, 30, 70, 75, 90, 101, 123, 145, 159,
174, 213, 275
stratification, 186
streptavidin, 91, 95, 96
stress, 231, 235, 236, 242, 244, 245, 252, 253, 254,
255, 256, 257
striatum, 47, 142
stroke, 72, 74, 77, 137, 221, 243, 244, 245, 255
structural changes, 54, 85
subacute, 142
subarachnoid haemorrhage, 137, 147
subarachnoid hemorrhage, 147, 149
subcellular, 235, 252
subcutaneous tissue, 128
Index
subdural haematoma, 6, 52
subgroups, 29, 46, 220
subjective, 32, 34, 173
substances, 38, 40, 92, 125, 133, 141, 244, 256
substantia nigra, 49
substitution, 132, 146
substrates, 44, 55, 248
subtraction, 23
suburban, 159, 172
suffering, 13, 17
sulfate, 160, 206, 208, 222, 227, 237, 239, 259
superior temporal gyrus, 36
superiority, 46
superoxide, 246, 250, 252, 262
superoxide dismutase, 246
suppliers, 95
suppression, 57, 147
suppressor, 191, 200
surfactant, 185, 202
surgery, 129
surgical, 129
surrogates, 131, 132
survival, 64, 133, 184, 192, 221
susceptibility, 39, 57, 218, 221, 268, 271, 273, 274
switching, 85
symbols, 100
symptom, 26, 274
symptoms, 2, 6, 49, 70, 85, 87, 131, 136, 174, 184,
243, 248, 249, 272, 278
synapse, 87
synapses, 30, 31, 69, 184
synaptogenesis, 71
synaptophysin, 167, 168
syndrome, 2, 4, 53, 54, 65, 70, 135, 142, 154, 159,
165, 173, 191, 206, 257, 266, 274
synergistic, 277
synthesis, 40, 49, 157, 162, 169, 171, 190, 221, 250,
256, 265, 267
synthetic, 79, 90, 95, 103, 121, 214, 216, 276
systematic, 138, 151, 279
systematic review, 138, 151, 279
systems, 1, 5, 39, 40, 48, 89, 171, 234, 250, 266
systolic blood pressure, 271
T
T cell, 166, 218, 236
T cells, 218, 236
tandem mass spectrometry, 89, 105, 120
tangles, 30, 75, 77, 135, 138, 171, 231
305
TAR, 88
targets, 118, 242, 250, 254
task force, 78, 121
task performance, 38
taste, 214
tau, vii, 46, 47, 52, 56, 64, 67, 68, 69, 70, 72, 73, 74,
75, 76, 77, 78, 79, 88, 95, 96, 97, 98, 99, 100,
103, 104, 106, 107, 108, 109, 110, 112, 113, 115,
117, 119, 120, 121, 123, 131, 133, 134, 135, 136,
138, 139, 140, 141, 143, 144, 148, 149, 151, 154,
155, 157, 158, 167, 169, 171, 173, 174, 175, 181,
182, 184, 185, 186, 187, 188, 197, 200, 206, 213,
217, 227, 238, 268, 278
TBI, 137, 142, 270
Tc, 54, 62
T-cell, 162, 267
technical assistance, 118
technician, 109
technology, 82, 89, 90, 91, 92, 93, 94, 95, 97, 98, 99,
102, 103, 110, 114, 120, 188
telomeres, 218
temperature, 94, 106, 107, 110, 141
temporal, 22, 34, 35, 36, 37, 38, 39, 41, 43, 46, 47,
49, 54, 55, 65, 97, 135, 139, 142, 159, 170, 172,
173, 183, 196, 197, 205, 208, 221, 248, 249
temporal lobe, 34, 37, 39, 43, 46, 55, 65, 142, 159,
172, 173, 205, 208, 221, 248
terminals, 254
test data, 86, 116
test procedure, 103
test scores, 3, 43
testosterone, 223
TGF, 180, 201, 204, 232
thalamus, 41, 126, 142
theory, 64, 262
therapeutic, vii, 29, 30, 40, 52, 67, 69, 70, 83, 85,
105, 118, 119, 132, 144, 164, 170, 178, 187, 188,
191, 213, 256, 275
therapeutic agents, 67
therapeutic approaches, 144, 256
therapeutic interventions, 85, 105
therapeutic targets, 40
therapeutics, 58, 120, 175
therapy, 48, 132, 146, 200, 213, 221, 231, 233, 235,
239, 250
thiazolidinediones, 216
thinking, 18
thioredoxin, 177, 221, 232
thoracic, 262
three dimensional (3D), 66, 126
306
Index
U
ubiquitin, 143, 155
ubiquitous, 236
ultrastructure, 242, 250, 256
uncertainty, 47, 52
underlying mechanisms, 49
unfolded, 170
unfolded protein response, 170
uniform, 1, 3, 223
untranslated regions, 215
UPR, 183
urban, 159, 172, 236
urinary, 192
urinary plasminogen activator, 192
urine, 116, 117, 185, 187
urokinase, 170
users, 42, 92
V
vaccination, 145
VaD, 72, 73, 75, 243, 273, 274
VAD, 15, 19, 20, 108, 109
validation, 8, 49, 64, 81, 83, 84, 85, 86, 90, 91, 92,
94, 101, 112, 117, 119, 132
validity, 3, 13, 42, 46, 52
Index
values, 2, 15, 21, 23, 43, 45, 48, 74, 78, 83, 91, 94,
98, 99, 100, 104, 106, 108, 110, 112, 148, 173,
229
variability, 6, 90, 93, 94, 95, 101, 102, 247, 278
variable, 41, 101, 112, 124
variables, 84, 94, 101, 112, 272
variance, 112
variation, 101, 141, 146, 165, 197, 204
vascular, 4, 14, 19, 24, 34, 38, 52, 57, 59, 76, 87,
108, 109, 137, 142, 153, 158, 163, 172, 175, 178,
196, 197, 200, 201, 204, 207, 210, 213, 216, 218,
232, 242, 243, 244, 245, 246, 247, 248, 249, 252,
253, 254, 255, 256, 258, 260, 261, 262, 275, 276,
278, 279
vascular dementia, 4, 14, 19, 24, 26, 59, 76, 108,
109, 137, 142, 153, 163, 175, 178, 196, 197, 200,
201, 207, 210, 213, 218, 232, 243, 261, 273, 276,
278, 279
vascular diseases, 244, 245
vascular inflammation, 261
vascular risk factors, 248
vascular system, 247
vascular wall, 242, 247, 249, 253, 255
vasculature, 245, 247, 248, 249, 258
vasculitis, 140, 174
vasodilation, 246
VCAM, 162
ventricle, 126
ventricles, 124, 126, 127
ventricular, 71, 131, 147, 204, 249, 257
ventricular arrhythmias, 147
vertebrae, 127, 130
vertebrates, 214
very low density lipoprotein(VLDL), 266
vessels, 129, 161, 212, 242, 243, 247, 248, 249
video, 125, 133, 138
viral, 142
visible, 247
visual, 12, 18, 19, 20, 21, 24, 25, 34, 37, 41, 43
vitamin A, 216
vitamin B1, 142
vitamin B12, 142
vitamin E, 258
VLA, 170
vocabulary, 16
voxel-based morphometry, 34, 53, 54
vulnerability, 57, 271
307
W
water, 36, 37, 39, 40, 59, 124, 127
wealth, 167
websites, 86
wells, 99
white matter, 34, 35, 36, 37, 47, 53, 56, 57, 62, 63,
65, 78, 152, 161, 206, 259
wild type, 267
women, 212, 221, 222, 223, 226, 227, 228, 229, 230,
234, 235, 236, 239, 270, 277
workers, 16, 17, 24, 47, 242
working memory, 38, 57, 63
World Health Organization (WHO), 105
wound infection, 128
Y
YAC, 249, 251, 252, 253, 259, 262
yeast, 249, 259, 262
yield, 84, 89, 90, 185, 187
young adults, 16, 63
Z
zinc, 71