0% found this document useful (1 vote)
512 views240 pages

Casting, Welding, Machine Tools, Material SC PDF

Sand casting uses sand as the primary mould material. The sand is mixed with small amounts of other materials like clay and water to improve mouldability and strength. A pattern with the shape of the desired casting is packed into the sand mould. Molten metal is poured through a sprue hole and channels called runners into the mould cavity. After solidification, the mould is broken and the finished casting is removed. Because the mold is destroyed, a new mold must be made for each casting.

Uploaded by

Sanjay Kajal
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
0% found this document useful (1 vote)
512 views240 pages

Casting, Welding, Machine Tools, Material SC PDF

Sand casting uses sand as the primary mould material. The sand is mixed with small amounts of other materials like clay and water to improve mouldability and strength. A pattern with the shape of the desired casting is packed into the sand mould. Molten metal is poured through a sprue hole and channels called runners into the mould cavity. After solidification, the mould is broken and the finished casting is removed. Because the mold is destroyed, a new mold must be made for each casting.

Uploaded by

Sanjay Kajal
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
You are on page 1/ 240

S d i

Sandcasting
y The molten metal is poured into the sprue hole, flows
y Sand casting uses ordinary sand as the primary through the runners,
runners and enters the mold cavity
mould material. through an opening called a gate.
y The sand grains are mixed with small amounts of y G i
Gravity fl
flow i the
is h most common means off
other materials, such as clay and water, to improve introducing the metal into the mold.

M t lC ti
MetalCasting mouldability and cohesive strength,
strength and are then
packed around a pattern that has the shape of the
desired casting.
casting
y After solidification, the mold is broken and the
finished casting is removed.
y The casting is then fettled by cutting off the ingate
y The pattern must be removed before pouring, the
and the feeder head.
mold
ld is
i usually
ll made
d in
i two
t or more pieces.
i
y Because the mold is destroyed, a new mold must be
y An opening called a sprue hole is cut from the top of
made for each casting.
casting
B SKM d l
BySKMondal the mold through the sand and connected to a
system of channels called runners. Contd. Contd

Sequentialstepsinmakingasandcasting
i l i ki d i y The mold is opened, the pattern board is drawn
y Apatternboardisplacedbetweenthebottom(drag) (removed),
(removed) and the runner and gate are cut into the
andtop(cope)halvesofaflask,withthebottomsideup. surface of the sand.

y Sandisthenpackedintothedraghalfofthemold. y The mold is reassembled with the pattern board


removed,
d and
d molten
l metall is poured
d through
h h the
h
sprue.
y Abottomboardispositionedontopofthepackedsand,
andthemoldisturnedover,showingthetop(cope)half
ofpatternwithsprue andriserpinsinplace. y The contents are shaken from the flask and the metal
segment is separated from the sand, ready for further
p
processing.
g
y Thecopehalfofthemoldisthenpackedwithsand.
Th h lf fth ldi th k d ith d
Contd

CastingTerms
y Flask: A moulding flask is one which holds the sand
mould
ld intact.
i t t It is
i made
d up off wood
d for
f temporary
t
applications
pp or metal for longterm
g use.

y Drag: Lower moulding flask.

y Cope: Upper moulding flask.

y Cheek: Intermediate moulding flask used in three


piece
i moulding.
ldi
For-2015 (IES, GATE & PSUs) Page 1 of 240 Rev.0
Contd
y Moulding sand: The freshly prepared refractory
y Pattern: Pattern is a replica
p j
of the final object to be
material used for making the mould cavity. It is a
made with some modifications.
mixture of silica,
silica clay and moisture in appropriate
y Parting line: This is the dividing line between the two
proportions.
moulding
ld fl k that
flasks h makes
k up the
h sand
d mould.
ld
y Backing sand: This is made up of used and burnt
y Bottom board: This is a board normally made of wood,
wood
sand.
which is used at the start of the mould making.
y Core:
C U d for
Used f making
ki hollow
h ll cavities
i i ini castings.
i
Threeflaskmould
Contd

Padding
y Pouring
g basin: A small funnelshaped
p cavityy at the top
p y Chaplet: Chaplets are used to support cores inside the y Tapering
T i off thinner
thi section
ti towards
t d thicker
thi k section
ti
of the mould into which the molten metal is poured. mould cavity. is known as 'padding'.
y Sprue: The passage through which the molten metal y This will require extra material.
y Chill: Chills are metallic objects, which are placed in
from the pouring basin reaches the mould cavity.
cavity y If p
paddingg is not p
provided, centre line shrinkage
g or
the
h mould
ld to increase
i the
h cooling
li rate off castings.
i porosity will result in the thinner section.
y Runner: The passage ways in the parting plane through y Riser: It is a reservoir of molten metal provided in the
which molten metal flow is regulated before they reach casting so that hot metal can flow back into the mould
the
h mould
ld cavity. cavity when there is a reduction in volume of metal due
y Gate: The actual entry point through which molten to solidification
metal enters the mould cavity in a controlled rate. Contd Contd

IES2001 IES1996 IES2007


Which of the following methods are used for Which one of the following is the correct
The main purpose of chaplets is
obtaining
bt i i directional
di ti l solidification
lidifi ti forf riser
i design
d i statement?
t t t?
(a) To ensure directional solidification Gate is provided in moulds to
1. Suitable placement of chills
(b) To provide efficient venting (a) Feed the casting at a constant rate
2. Suitable placement of chaplets ((b)) Give p
passage
g to g
gases
(c) For aligning the mold boxes (c) Compensate for shrinkage
3. Employing padding
(d) To
T support the
h cores (d) Avoid cavities
Select the correct answer.
( ) 1 and
(a) d 2 (b) 1 and
d 3 (c)
( ) 2 and
d 3 (d) 1, 2 and
d3
For-2015 (IES, GATE & PSUs) Page 2 of 240 Rev.0
GATE2009 GATE1992 GATE2011
Inagreensandmouldingprocess,uniform Green sand mould indicates that
rammingleadsto (a) polymeric mould has been cured
MatchtheitemsinColumnIandColumnII.
MatchtheitemsinColumnIandColumnII
(a) Lesschanceofgasporosity (b) mould has been totally dried
ColumnIColumnII
P MetallicChills1 Supportforthecore
P.MetallicChills1.Supportforthecore (b) Uniformflowofmoltenmetalintothemould ((c)) mould is g
green in colour
Q.MetallicChaplets2.Reservoirofthemoltenmetal cavity (d) mould contains moisture
R Riser3 Controlcoolingofcritical
R.Riser3.Controlcoolingofcritical (c) Greaterdimensionalstabilityofthecasting
sections (d) Lesssandexpansiontypeofcastingdefect
S ExothermicPadding4 Progressivesolidification
S.ExothermicPadding4.Progressivesolidification
(a) P1,Q3,R2,S4 (b) P1,Q4,R2,S3
(c) P3,Q4,R2,S1
P 3 Q 4 R 2 S 1 (d) P 4 Q 1 R 2 S 3
P4,Q1,R2,S3

Pattern PatternAllowances Sh i k
Shrinkageallowance
ll
A pattern is a replica of the object to be made by the 1. Shrinkageorcontractionallowance y All metals shrink when cooling except perhaps
gp
casting process,, with some modifications. bismuth.
bismuth
The main modifications are 2. Draftortaperallowance
y The addition of pattern allowances,
allowances y This is because of the interatomic vibrations which
3. Machiningorfinishallowance
M hi i fi i h ll
y The provision of core prints, and are amplified by an increase in temperature.
4 Distortionorcamberallowance
4.
y Elimination of fine details, which cannot be obtained
y The shrinkage allowance is always to be added to the
by casting and hence are to be obtained by further 55. Rappingallowance
pp g
processing linear dimensions. Even in case of internal dimensions.

Contd

Liquidshrinkageandsolidshrinkage y Gray CI with a carbon equivalent of 4.3% has y Pattern Allowances


y Liquid
Li id shrinkage
h i k refers
f to the
h reduction
d i in
i volume
l Cast Iron 10 mm/m
negative shrinkage, that is, it actually expands
when the metal changes temperature from pouring to Brass, Copper, Aluminium 15 mm/m
solidus temperature in liquid state.
state To account for this,
this upto 2.5%
2 5% because of graphite precipitation.
precipitation So,
So
risers are provided in the moulds. Steell 20 mm/m
y Solidification shrinkage g refers to the reduction in for this, no riser is needed. Zinc, Lead 25 mm/m
volume when metal changes from liquid to solid state
at the solidus temperature. To account for this, risers
are provided
id d in
i the
h moulds.
ld
y Solid shrinkage is the reduction in volume caused,
when a metal loses temperature in the solid state.
state The
shrinkage allowance is provided to take care of this
educt o .
reduction.
For-2015 (IES, GATE & PSUs) Page 3 of 240 Rev.0
IES1995 GATE1999 IES1999
Which one of the following materials will require In
I solidification
lidifi ti off metal
t l during
d i casting,
ti
Which of the following materials requires the
the largest size of riser for the same size of casting? compensation
p for solid contraction is
l
largest
t shrinkage
hi k allowance,
ll while
hil making
ki a
pattern for casting? (a) Provided by the oversize pattern
((a)) Aluminium
( ) Aluminium
(a) l
(b) Cast iron (b) Achieved by properly placed risers
(b) Brass
(c) Steel (c) Cast Iron (c) Obtained by promoting directional
(d) Plain Carbon Steel solidification
lidifi i
(d) Copper.
(d) Made by providing chills

GATE2001 GATE2004
ISRO2007
Shrinkage allowance on pattern is provided to
Shrinkage allowance is made by Gray cast iron blocks 200 x 100 x 10 mm are to be
p
compensate for shrinkage
g when
( ) Adding
(a) dd to externall and
d internall dimensions
d castt in
i sand d moulds.ld Shrinkage
Sh i k allowance
ll f
for
(a) The temperature of liquid metal drops from pattern making is 1%. The ratio of the volume of
(b) Subtracting from external and internal pouring to freezing temperature
dimensions pattern
tt t that
to th t off the
th casting
ti will
ill be
b
(b) The metal changes from liquid to solid state at
((c)) Subtracting
g from external dimensions and freezing temperature
adding to internal dimensions (a) 0.97 (b) 0.99 (c) 1.01 (d) 1.03
(c) The temperature of solid phase drops from
(d) Adding to external dimensions and subtracting f
freezing
i to room temperature
from internal dimensions
(d) The temperature of metal drops from pouring
to room temperature

GATE2008 GATE2011 IAS1995


A cubic casting of 50 mm side undergoes volumetric Assertion
A i (A):
(A) A pattern is i made
d exactly
l similar
i il to
solidification shrinkage and volumetric solid the part to be cast.
While cooling, a cubical casting of side 40 mm
contraction of 4% and 6% respectively.
respectively No riser is R
Reason (R) Pattern
(R): P i used
is d to make
k the
h mould ld
undergoes 3%, 4% and 5% volume shrinkage used. Assume uniform cooling in all directions. The cavity for pouring in molten for casting.
side of the cube after solidification and contraction is ( ) Both
(a) B h A and d R are individually
i di id ll true and
d R is
i the
h
during the liquid state, phase transition and solid
(a) 48.32 mm correct explanation of A
state
state, respectively
respectively. The volume of metal (b) 49.90 mm (b) Both
B h A and d R are individually
i di id ll true but
b R isi not the
h
compensated from the riser is correct explanation of A
(c) 49
49.94
94 mm
( ) A is
(c) i true but
b R is i false
f l
(a) 2% (b) 7% (c) 8% (d) 9% (d) 49.96 mm
(d) A is false but R is true

For-2015 (IES, GATE & PSUs) Page 4 of 240 Rev.0


IAS2003 D ft
Draft
Match
M h ListLi I (Material
(M i l to be b cast)) with
i h List
Li II y To
T reduce
d the
th chances
h off the
th damage
d off the
th mould
ld
(Shrinkage Allowance in mm/m) and select the
correct answer using the codes given below the lists: cavityy at the time of p
pattern removal,, the vertical faces
ListI ListII of the pattern are always tapered from the parting line.
(MaterialtoCast)(ShrinkageAllowanceinmm/m)
(A) Greycastiron 1. 7 10 This provision is called draft allowance.
(B) Brass 2
2. 15
y Inner surfaces
f off the
h pattern require higher
h h draft
d f than
h
(C) Steel 3. 20
(D) Zinc 4
4. 24 outer surfaces.
surfaces
Codes:A B C D A B C D
y Draft is always provided as an extra metal.
(a) 1 2 3 4 (b) 3 4 1 2
(c) 1 4 3 2 (d) 3 2 1 4 DRAFTALLOWANCE

Sh k ll
ShakeAllowance ll
DistortionAllowance P M i l
PatternMaterials
y Wood
W d patterns
tt are relatively
l ti l easy to
t make.
k Wood
W d is
i nott
y At the time of pattern removal, the pattern is rapped y A metal when it has just solidified is very weak and very dimensionally stable. Commonly used teak, white
therefore is likelyy to be distortion p
prone. pine and mahogany wood.
wood
all around the vertical faces to enlarge the mould
y Metal patterns are more expensive but are more
cavity slightly to facilitates its removal.
removal y This is particularly so for weaker sections such as long dimensionally stable and more durable.
durable Commonly used
flat portions, V, U sections or in a complicated casting CI, Brass, aluminium and white metal.
y Itt iss a negative
egat ve a
allowance
owa ce aand
d iss to be app
applied
ed o
onlyy to which may have thin and long sections which are y Hard plastics,
plastics such as urethanes,
urethanes and are often preferred
those dimensions, which are parallel to the parting connected to thick sections. with processes that use strong, organically bonded sands
that tend to stick to other pattern materials.
materials
plane. y In the fullmold process, expanded polystyrene (EPS) is
y The foundry practice should be to make extra
used.
used
material provision for reducing the distortion.
y Investment casting uses wax patterns.

Thepatternmaterialshouldbe IES1994 GATE2000


y Easilyworked,shapedandjoined Which of the following materials can be used for
Disposablepatternsaremadeof
y Lightinweight making patterns?
y Strong,hardanddurable (a) Wood
1. Aluminium 2. Wax 33. Mercuryy 4
4. Lead
y Resistanttowearandabrasion (b) Rubber
Select the correct answer using the codes given below:
y Resistanttocorrosion,andtochemicalreactions (c) Metal
Codes:
y Dimensionallystableandunaffectedbyvariationsin (d) P l
Polystyrene
(a) 1,3 and 4 (b) 2,3 and 4 (c) 1, 2 and 4 (d) 1, 2 and 3
temperatureandhumidity.
y Availableatlowcost.
For-2015 (IES, GATE & PSUs) Page 5 of 240 Rev.0
T f P tt
TypesofPattern T f P tt
TypesofPattern TypesofPattern
Single
Si l Piece
Pi Pattern
P tt Split Pattern or Two Piece Pattern
y Cope and Drag Pattern
These are inexpensive and the simplest type of This is the most widely used type of pattern for intricate
castings When the contour of the casting makes its
castings. These
ese aaree ssimilar
a to sp
splitt patte
patterns.
s. In add
addition
t o to
patterns.
tt A the
As th name indicates,
i di t theyth are made
d off a
single piece. withdrawal from the mould difficult, or when the depth splitting the pattern, the cope and drag halves of
of the casting is too high,
high then the pattern is split into two the p
pattern along g with the ggatingg and riser systems
y
parts so that one part is in the drag and the other in the are attached separately to the metal or wooden
Gated Pattern cope.
p plates along
p g with the alignment
g pins. Theyy are
p
Gating and runner system are integral with the called the cope and drag patterns.
pattern. This would eliminate the hand cutting of
the runners and gates and help in improving the
productivity of a moulding.

TypesofPattern TypesofPattern T f P tt
TypesofPattern
y Follow Board Pattern
y Match Plate Pattern y Loose Piece Pattern This type of pattern is adopted for those
The
h cope and d drag
d patterns along
l with
h the
h This type of pattern is also used when the castings where there are some portions,
portions which
gating and the risering are mounted on a single contour of the part is such that withdrawing the are structurally weak and if not supported
pattern from the mould is not possible.
possible properly are likely to break under the force of
matching metal or wooden plate on either side.
ramming.

IES2008 T f P tt
TypesofPattern T fP
TypesofPattern
y Sweep Pattern y Skeleton Pattern
The pattern adopted for those castings where there It is used to sweep the complete casting by means A skeleton of the pattern made of strips of wood
are some portions
ti which
hi h are structurally
t t ll weak k andd of a plane sweep.
s eep These are used for generating is used for building the final pattern by packing
are likely to break by the force of ramming are large shapes, which are axisymmetrical or sand around the skeleton. After packing the
called:
ll d prismatic in nature such as bellshaped
bell shaped or sand the desired form is obtained with the help
sand,
(a) Loose piece pattern cylindrical. of a strickle. This type of pattern is useful
generally for very large castings,
castings required in
(b) Follow board pattern
small quantities where large expense on
((c)) Skelton p
pattern complete wooden pattern is not justified.
justified
(d) Single piece pattern

For-2015 (IES, GATE & PSUs) Page 6 of 240 Rev.0


CoolingCurve Fluidity
( )
GATE2012(PI)
The ability of a metal to flow and fill a mold is known
as fluidity. In sand casting, fluidity of the molten metal
Pouring Temperature i
increases with
ith
y The most important controlling factor of fluidity is the
pouring
p g temperature
p or the amount of superheat.
p (A) increase in degree of superheat
y Higher the pouring temperature, the higher the fluidity. (B) decrease in pouring rate
y Excessive temperatures should be avoided, however. At ((C)) increase in thermal conductivityy of the mould
high pouring temperatures, metalmold reactions are (D) increase in sand grain size
accelerated and the fluidity may be so great as to permit
penetration.
i
y Penetration is a defect where the metal not only fills the
mold cavity
ca it but also fills the small voids
oids between
bet een the sand
particles in a sand mold.

ISRO2011 Core Desiredcharacteristicsofacore


Fluidity in casting (CI) operation is greatly y Used for making cavities and hollow projections.
y Green Strength: A core made of green sand should
i fl
influenced
d by
b b strong
be t enough
h to
t retain
t i the
th shape
h till it goes for
f
y All sides of core are surrounded by the molten metal baking.
a) Melting temperature of molten metal and are therefore subjected to much more severe y Dry Strength:h It should
h ld have
h adequate
d d strength
dry h
thermal and mechanical conditions and as a result the so that when the core is placed in the mould, it
b) Pouring temperature of molten metal core sand should be of higher strength than the should
h ld beb able
bl to resist the
h metall pressure acting on
moulding sand. it.
c)) Finish of the mould
y Refractoriness: Since in most cases, the core is
d) Carbon content of molten metal surrounded all around it is desirable that the core
material should have higher refractoriness.
Contd

y Then,, the p
permeabilityy number,, R is obtained byy
VH y Calculatethepermeabilitynumberofsandifittakes1min
y Permeability: Gases evolving from the molten metal R= 25stopass2000cm3 ofairatapressureof5g/cm2 through
and generated from the mould may have to go pAT
thestandardsample.
through the core to escape out of the mould. Hence WhereV=volumeofair=2000cm3
cores are required to have higher permeability.
permeability H=heightofthesandspecimen=5.08cm p = 5.0 g / cm 2
y Permeability Number: The rate of flow of air passing
p , g/ 2
p=airpressure,g/cm
p T = 1 min 25 s = 1.417
1 417 min
through
th h a standard
t d d specimen
i under
d a standard
t d d pressure is
i
termed as permeability number. A=crosssectionalareaofsandspecimen=20.268cm2 501.28
R= = 70.75
y The
Th standard
d d permeability
bili test is
i to measure time
i T timeinminutesforthecompleteairtopassthrough
T=timeinminutesforthecompleteairtopassthrough 5 1.417
1 417
taken by a 2000 cu cm of air at a pressure typically of
Insertingtheabovestandardvaluesintothe
980
8 PaP (10 / 2),
( g/cm ) to pass through
h h a standard
d d sand d
expression,weget
specimen confined in a specimen tube. The standard 501.28
specimen
i size
i isi 50.8
8 mm in
i diameter
di and
d a length
l h off R=
p.T240
50.8 mm. For-2015 (IES, GATE & PSUs) Page 7 of Rev.0
IES2007 y Friability: The ability to crumble should be a very
important consideration at the time of removal.
Whatispermeability?Permeabilityismoreimportant y Collapsibility:
p y At the time of cooling,
g, casting
g shrinks,, and
inthebasicprocessofsandcastingthanporosity.Give y Smoothness: Surface of the core should be smooth
unless the core has good collapsibility (ability to decrease
oneimportantreasonforthisfeature.
i t t f thi f t f good
for d finish
fi i h to
t the
th casting.
ti
in size) it is likely to provide resistance against shrinkage
[2marks] y Low Gas Emission
and thus can cause hot tears.

C S d
CoreSands C b Di id M ldi
CarbonDioxideMoulding
y The compressive strength of the bond increases with
y Sodium silicate (water glass, SiO2:Na2O) is used as a binder.
y Used
d clay
l free
f silica
l sand.
d This is essentially a quick process of core or mould standing time due to dehydration.
p p
preparation.
y Binders used are linseed oil,
oil core oil,
oil resins,
resins dextrin,
dextrin y Because of the high strength of the bond, the core need not
y The mould is prepared with a mixture of sodium silicate and
molasses, etc. sand and then treated with carbon dioxide for two to three be p
provided with anyy other reinforcements.
minutes such that a dry compressive strength of over 1.4
y Core oils are mixtures of linseed, soy, fish and MPa is arrived. y It does not involve any distortions due to baking and also
petroleum oils and coal tar. y The carbon dioxide is expected to form a weak acid, which better dimensional accuracies are achieved.
hydrolyses the sodium silicate resulting in amorphous silica,
y The general composition of a core sand mixture could which forms the bond. y The
Th sand
d mixture
i d
does not have
h good
d shelf
h lf life
lif and
d

be core oil (1%) and water (2.5


(2 5 to 6%).
6%) y The introduction of CO2 g gas starts the reaction byy forming
g therefore should be used immediatelyy after p
preparation.
p
hydrated sodium carbonate (Na2CO3 + H2O).
Contd

IES2002 GATE 2008(PI)


GATE 2008 (PI) GATE2014
Assertion (A): In CO2 casting process,
process the mould or g of a hollow p
In sand casting part of lead,, a cylindrical
y core
An
A aluminium
l i i alloy
ll (density
(d i 2600 ) casting
i is
i to be
b
core attains maximum strength. of diameter 120 mm and height 180 mm is placed inside
Reason (R): The optimum gassing time of CO2 produced. A cylindrical
p y hole of 100 mm diameter and
through the mould or core forms Silica Gel which the mould cavity. The densities of core material and lead
100 mm length is made in the casting using sand core
imparts sufficient strength to the mould or core.
core are 1600 kg/m3 and 11,300
11 300 kg/m3 respectively.
respecti el The net (density 1600 ). The net buoyancy force (in Newton)
(a) Both A and R are individually true and R is the
correct explanation of A force ((in N)) that tends to lift the core during
gppouring
g of acting on the core is ..
(b) Both A and R are individually true but R is not the molten metal will be
correct explanation of A
(c) A is true but R is false (a) 19.7 (b) 64.5 (c) 193.7 (d) 257.6
(d) A is
i false
f l but
b t R is
i true
t
For-2015 (IES, GATE & PSUs) Page 8 of 240 Rev.0
M ldi S d C
MouldingSandComposition
iti Oth Additi
OtherAdditives M ldi S d P
MouldingSandProperties
ti
y Sand:
S d Ordinary
O di silica
ili Sand
S d (SiO2),
) zircon,
i or olivine
li i y Porosity or Permeability: Permeability or porosity of
y Cereal binder up to 2% increases the strength.
the moulding sand is the measure of its ability to
sands. permit air to flow through it.
it
y Pitch
Pit h if used
d up to
t 3%
% would
ld improve
i th hot
the h t
y Clay: Acts as binding agents mixed to the moulding y Strength: It is defined as the property of holding
strength.
g
t th off sand
together d grains.
i A moulding
ldi sand
d should
h ld have
h
sands ample strength so that the mould does not collapse or
y Saw dust up to 2% may improve the collapsibility by
Kaolinite or fire clay (Al2O3 2SiO2 2H2O), and gett partially
ti ll destroyed
d t d during
d i conveying,
i t
turning
i over
slowly burning, and increase the permeability. or closing.
B
Bentonite
i (Al2O3 4SiO
SiO2 H2O nH
H2O).
O) y Other materials: sea coal, asphalt, fuel oil, graphite, y Refractoriness: It is the ability of the moulding sand
mixture to withstand the heat of melt without showing
y Water: Clay is activated by water.
water molasses iron oxide,
molasses, oxide etc.
etc any signs of softening or fusion.
Contd

y Plasticity: Itisthemeasureofthemouldingsandtoflow Oth S d


OtherSands IES2008
aroundandoverapatternduringrammingandtouniformly y Facing
g sand: The small amount of carbonaceous
filltheflask. material sprinkled on the inner surface of the mold
y Collapsibility:Thisistheabilityofthemouldingsandto cavityy to g
give a better surface finish to the castings.
g Small amount of carbonaceous material sprinkled
decreaseinvolumetosomeextentunderthecompressive y Backing sand: It is what constitutes most of the on the inner surface of mould cavity is called
forcesdevelopedbytheshrinkageofmetalduringfreezing
p y g g g refractory material found in the mould.mould This is made
andsubsequentcooling. up of used and burnt sand. (a) Backing sand
y Adhesiveness:Thisisthepropertyofsandmixtureto
p p y y Green Sand: The molding sand that contains
adheretoanotherbody(here,themouldingflasks).The ( ) Facing sand
(b)
moisture is termed as green sand. The green sand
mouldingsandshouldclingtothesidesofthemoulding
g g g
should have enough strength so that the constructed (c) Green sand
boxessothatitdoesnotfalloutwhentheflasksarelifted
andturnedover.Thispropertydependsonthetypeand
mould retains its shape.
(d) Dry sand
amountofbinderusedinthesandmix. y Dry
D sand: d When
Wh the th moisture
i t i the
in th moulding
ldi sand d is
i
completely expelled, it is called dry sand.

Grainsizenumber IES2002
y ASTM (American
( Society for Testing and Materials)) In the grain size determination using standard
grain size number, defined as
n-1
charts, the relation between the given size
N 2
number n and the average number of grains 'N'
y Where N is the number of grains per square inch
visible in a prepared specimen at 100X and n is the per square inch at a magnification of 100 X is
ASTM
S Mg grainsize
a s e number.
u be .
( ) N = 2n
(a)
y Low ASTM numbers mean a few massive grains; high
numbers refer to many small grains.
grains (b) N = 2nl

(c) N = 2n + 1
S dSli
SandSlinger
For-2015 (IES, GATE & PSUs) (d) N = 2n + 1 Page 9 of 240 Rev.0
CastingYield Gating System
GatingSystem
Thecastingyieldistheproportionoftheactual
g , , p
castingmass,w,tothemassofmetalpouredintothe
mould,W,expressedasapercentage.

w
Casting yield = 100
W

Contd

Gating System
GatingSystem y Runner: A runner is commonly a horizontal channel
y Ingate: Achannelthroughwhichthemoltenmetal
y Pouring basin: A small funnel shaped cavity at the
which connects the sprue with gates, thus allowing the entersthemouldcavity.
top of the mould into which the molten metal is
poured. molten metal to enter the mould cavity.
cavity The runners y Vent: Smallopeninginthemouldtofacilitateescape
p g p
ofairandgases.
are of larger crosssection and often streamlined to
y Sprue:
S Th passage through
The th h which
hi h the
th molten
lt metal,
t l
from the pouring basin, reaches the mould cavity. In slow down and smooth out the flow, and are designed
many cases it controls
t l the
th flow
fl off metal
t l into
i t the
th to provide approximately uniform flow rates to the
mould.
various parts of the mould cavity.
cavity Runners are
commonly made trapezoidal in crosssection.

Contd Contd

fG
TypesofGateorIngate IES2011 G
GATE 20 0 ( )
2010(PI)
Top
T gate: Causes
C turbulence
b l in
i the
h mould
ld cavity,
i it i is
i prone In light metal casting,
casting runner should be so designed During
D i the
h filling
filli process off a given
i sand
d mould
ld cavity
i byb
that:
to form dross,, favourable temperature
p gradient towards the
g molten metal through a horizontal runner of circular cross
1. It avoids
id aspiration
i ti
gate, only for ferrous alloys. section the frictional head loss of the molten metal in the
2. It avoids turbulence
runner will increase with the
Bottom gate: No mould erosion, used for very deep moulds, 3. The path of runner is reduced in area so that
higher pouring time,
time Causes unfavourable temperature
q
unequal volume of flow throughg each g
gate (a) increase in runner diameter
takes place (b) decrease in internal surface roughness of runner
gradients.
(a) 1 and 2 only (b) 1 and 3 only
Parting Gate: most widely used gate, easiest and most (c) decrease in length of runner
economical in preparation. (c) 2 and 3 only (d) 1, 2 and 3
(d) increase in average velocity of molten metal
Step Gate: Used for heavy and large castings, size of ingates
For-2015 (IES, GATE & PSUs) Page 10 of 240 Rev.0
are normally increased from top to bottom.
IES 2011
IES2011 IES1998 GATE2002
Match List I with List II and select the correct answer using
the code given below the lists : A sand casting mould
assembly is shown in The primary purpose of a sprue in a casting
ListI ListII
the above figure. The mould
ou d iss to
A.Topgate 1.Heavyandlargecastings elements marked A (a)Feed the casting at a rate consistent with the rate
B.Bottomgate
g 2.Mostwidelyusedandeconomical
y and B are respectively of solidification
C.Partinggate 3.Turbulence (a) Sprue and riser (b)Act as a reservoir for molten metal
(b) Ingate
I t andd riser
i ( ) d molten
(c)Feed l metall from
f the
h pouring
i basin
b i to theh
D.Stepgate 4.Unfavourable temperaturegradient
(c) Drag and runner gate
Codes
C d
(d) Riser and runner (d)Help feed the casting until all solidification takes
A B C D A B C D place
( ) 3
(a) 4 2 1 (b) 1 4 2 3
(c) 3 2 4 1 (d) 1 2 4 3

Th
Thegoalsforthegatingsystem
l f th ti t IES 1998
IES1998 IES2009
y To
T minimize
i i i turbulence
t b l to
t avoid
id trapping
t i gasses into
i t Whichofthefollowingaretherequirementsofanideal Considerthefollowingstatements:
C id th f ll i t t t
the mold gatingsystem?
1.Theactualentrypointthroughwhichthemolten
1 Themoltenmetalshouldenterthemouldcavitywithas
1.
y To get enough metal into the mold cavity before the metalentersthemouldcavityiscalledingate.
highavelocityaspossible.
metal starts to solidify 2.Bottomgateincaseofamouldcreatesunfavourable
g
2 Itshouldfacilitatecompletefillingofthemouldcavity.
2. Itshouldfacilitatecompletefillingofthemouldcavity
y To avoid shrinkage temperaturegradient.
3. Itshouldbeabletopreventtheabsorptionofairorgases
y Establish the best possible temperature gradient in the fromthesurroundingsonthemoltenmetalwhile 3.Sprueincaseofamouldismadetaperedtoavoidair
solidifying casting so that the shrinkage if occurs must flowingthroughit. inclusion.
be in the gating system not in the required cast part. Selectthecorrectanswerusingthecodesgivenbelow: Whichoftheabovestatementsis/arecorrect?
y Incorporates a system for trapping the nonmetallic (a)1,2and3 (b)1and2 (c)2and3 (d)1and3 (a)1only (b)1and2 (c)2and3 (d)1and3
inclusions.
inclusions

T
TypesofGatingSystems
f G ti S t P
PressurizedGatingSystem
i d G ti S t U P i d G ti S t
UnPressurizedGatingSystem
y The total cross sectional area decreases towards the y The total cross sectional area increases towards the
Thegatingsystemsareoftwotypes: mold cavity
mold cavity
y Back pressure is maintained by the restrictions in the
y Pressurizedgatingsystem metal flow y Restriction only
y at the bottom of sprue
p
y Flow of liquid (volume) is almost equal from all gates
y Flow of liquid (volume) is different from all gates
y Unpressurizedgatingsystem
U i d i y Back pressure helps in reducing the aspiration as the
sprue always runs full y Aspiration in the gating system as the system never
y Because
B off the
h restrictions
i i the
h metall flows
fl at high
hi h runs full
velocity leading to more turbulence and chances of
mold
ld erosion.
i y Less
L turbulence.
b l
For-2015 (IES, GATE & PSUs) Page 11 of 240 Rev.0
Sprue Design Sincethevelocitiesareproportionaltothesquareof
y Sprue: Sprue is the channel through which the molten p ,
thepotentialheads,ascanbederivedfrom
metal is brought into the parting plane where it enters the Bernoulli'sequation,
runners and ggates to ultimatelyy reach the mould cavity.
y
hc
y The molten metal when moving from the top of the cope to At = Ac
ht
the p
partinggpplane g
gains in velocityy and some lowpressure
p
area would be created around the metal in the sprue.
y Since the sand mould is permeable, atmospheric air would Theexacttaperingcanbeobtainedbytheequationof
be breathed into this lowpressure area which would then continuity.DenotingthetopandchokesectionsofThesprue by
be carried to the mould cavity.
y thesubscriptstand'c'respectively,weget
WhereH=actual
h l
y To eliminate this problem of air aspiration, the sprue is
sprue height
tapered
p to g
graduallyy reduce the cross section as it moves Vc
A t Vt = A c Vc At = Ac andht=h+H
away from the top of the cope as shown in Figure below (b). Vt
Contd Contd

GATE 2007
GATE2007
GATE2001 A 200 mm long g down sprue p has an area of cross
section of 650 mm2 where the pouring basin meets the
The height of the downsprue is 175 mm and its
p
down sprue ((i.e. at the beginning
g g of the down sprue).
p )
crosssectional
ti l area att the
th base
b i 200 mm2. The
is Th
A constant head of molten metal is maintained by the
crosssectional area of the horizontal runner is
pouring
p g basin. The Molten metal flow rate is 6.55 105
l 200 mm2. Assuming
also A i no losses,
l i di t the
indicate th 3
mm /s. Considering the end of down sprue to be open
correct choice for the time (in seconds) required to
p
to atmosphere and an acceleration due to g gravityy of
fill a mould cavity
ca it of volume
olume 1006 mm3. (Use g = 100
2 104mm/s2, the area of the down sprue in mm2 at its end
m/s ).
((avoidingg aspiration
p effect)) should be
( )
(a)2.67 (b)
(b)8.45 ( )
(c)26.72 (d)
(d)84.50
(a)650.0 (b)350.0 (c)290.7 (d)190.0

Contd

G ti
Gatingratio
ti IES2003 IES2005
A gating
ti ratio
ti off 1: 2: 4 is
i used
d to
t design
d i the
th gating
ti
y Gatingratioisdefinedas:Sprue area:Runnerarea:
system for magnesium alloy casting. This gating ratio The gating ratio 2: 8: 1 for copper in gating system
Ingate area.
area refers to the cross section areas of the various gating d i refers
design f tot the
th ratio
ti off areas of:
f
elements as given below:
y Forhighqualitysteelcastings,agatingratioof1:2:2or (a) Sprue: Runner: Ingate
1
1. Down sprue 2. 2 Runner bar 3.
3 Ingates
1:2:1.5willproducecastingsnearlyfreefromerosion, (b) Runner: Ingate: Sprue
The correct sequence of the above elements in the
ratio 1: 2: 4 is ((c)) Runner: Sprue:
p Ingate
g
willminimizeoxidation,andwillproduceuniform
ill i i i id i d ill d if
(a) 1, 2 and 3 (d) Ingate: Runner: Sprue
flow.
(b) 1,3 and d2
y Agatingratioof1:4:4mightfavour theformationof (c) 2, 3 and 1
oxidationdefects. (d) 3, 1 an 2
For-2015 (IES, GATE & PSUs) Page 12 of 240 Rev.0
GATE2010 IAS1999 Ri
RisersandRiserDesign
d Ri D i
Assertion
A i (A):
(A) The
Th rate off flow
fl off metall through
h h sprue y Risers are added reservoirs designed to feed liquid
is NOT a function of the crosssectional areas of metal to the solidifying casting as a means of
Inagatingsystem,theratio1:2:4represents sprue runner and gate.
sprue, gate compensating for solidification shrinkage.
(a) Sprue basearea:runnerarea:ingate area Reason (R): If respective crosssectional areas of y To perform this function, the risers must solidify after
p
sprue,, runner and g gate are in the ratio of 1: 2: 2,, the the casting.
casting
(b) Pouringbasinarea:ingate area:runnerarea system is known as unpressurised gating system.
(a) Both A and R are individuallyy true and R is the correct y According to Chvorinov's rule, a good shape for a riser
(c) Sprue basearea:ingate area:castingarea explanation of A would
ld be
b one that
th t has
h a long
l f
freezing
i time
ti (i
(i.e., a small
ll
(b) Both A and R are individually true but R is not the surface area per unit volume).
(d) Runnerarea:ingate
R i area:castingarea
i correct explanation
l i off A y Live risers (also known as hot risers) receive the last
(c) A is true but R is false hot metal that enters the mold and generally do so at a
(d) A is false
f l but
b R is true time when the metal in the mold cavity has already
begun to cool and solidify.

TypesofRisers
IES 1994
IES1994 Ch i
Chvorinovs
rule
l
Assertion (A): In a mould, a riser is designed and placed y Totalsolidificationtime(ts)=B(V/A) n
so that the riser will solidify after the casting has solidified.
wheren=1.5to2.0
Reason (R): A riser is a reservoir of molten metal which
[Wh
[Where,B=mouldconstantandisafunctionof(mould
B ld di f i f( ld
will supply molten metal where a shrinkage cavity would
have occurred. material,castingmaterial,andconditionofcasting]
(a) Both A and R are individually true and R is the correct n=2 andtriser =1.25tcasting
explanation
p of A 2 2
V V
(b) Both A and R are individually true but R is not the or A = 1.25
riser A casting
correct explanation
p of A
(c) A is true but R is false
Forcylinder V = D2H / 4

( )
(d) A is false but R is true ofdiameterD
fdi D 2
A = DH + 2 D
andheightH 4

IES2011 IES 1998


IES1998 GATE 2013 SameQuestion(PI)
GATE2013
The relationship between total freezing time t,
t A spherical drop of molten metal of radius 2 mm A cube
b shaped
h d casting
ti solidifies
lidifi in
i 5 min.
i The
Th
volume of the casting V and its surface area A,
g to Chvorinovs rule is :
according was found to solidify in 10 seconds. A similar drop of solidification time in min for a cube of the same
radius 4 mm would solidify in material, which is 8 times heavier than the original
V
(a ) t = k
A
(a) 14.14 seconds casting, will be
A
(b ) t = k
V (b) 20 seconds
d
2
( ) 10
(a) (b) 20 ( ) 24
(c) (d) 40
A
(c ) t = k
V (c) 28.30
28 30 seconds
2
V
(d ) t = k (d) 4
40 seconds
A
Where K is a constant
For-2015 (IES, GATE & PSUs) Page 13 of 240 Rev.0
GATE2014
GATE2014(PI) GATE2003
A cylindrical riser of 6 cm diameter and 6 cm height has
For a given volume of a riser, if the solidification
to be designed for a sand casting mould for producing a
With a solidification factor of 0.97 x 106 s/m2, the
time of the molten metal in riser needs to be
steel rectangular plate casting of 7 cm 10 cm 2 cm
solidification time (in seconds) for a spherical
quadrupled, the surface area of the riser should be
dimensions having the total solidification time of 1.36
1 36
casting of 200 mm diameter is
made
minute. The total solidification time (in minute) of the
( ) 539
(a) (b) 1078
8 ( ) 4311
(c) (d) 3233
(a) onefourth (b) half riser is ..
(c) double (d) four times

IES2006 GATE 2010(PI) GATE2007


Solidification
S lidifi ti time
ti off a metallic
t lli alloy
ll casting
ti isi
According to Chvorinov's equation, the
Volume of a cube of side 'l' and volume of a sphere of
solidification
lidifi ti time
ti off a casting
ti isi proportional
ti l to:
t (a) Directly proportional to its surface area
radius r are equal. Both the cube and the sphere are solid
(a) v2 (b) Directlyy p
proportional
p to the specific
p heat of the
and
d off same material.
t i l They
Th are being
b i cast.
t The
Th ratio
ti off the
th
cast material
(b) v p
solidification time of the cube to the same of the sphere is:
(c) Directly proportional to the thermal diffusivity of 3 6 2 2 3 2 4
4 r 4 r 4 r 4 r
(c) 1/v (a ) 6 l ( b ) ( c ) ( d )
the
h molten
l metall 6 l 6 l 6 l
(d) 1/v2
(d)Inversely proportional to the pouring
Where, v = volume of casting
temperature.

GATE 2011 (PI)


GATE2011(PI) GATE2009(PI)
In a sand casting process,
process a sphere and a cylinder of A solid
l d cylinder
l d off diameter
d D and
d height
h h equall to D, and
d a solid
ld
equal volumes are separately cast from the same molten cube of side L are being sand cast by using the same material.
Assuming there is no superheat in both the cases, the ratio of
metal under identical conditions. The height and
solidification time of the cylinder to the solidification time of the
diameter of the cylinder are equal. The ratio of the cube is
solidification time of the sphere to that of the cylinder is (a) (L/D)2
(b) (2L/D)2
((a)) 1.14
4 ((b)) 0.877
(c) (2D/L)2
(c) 1.31 (d) 0.76
(d) (D/L)2
For-2015 (IES, GATE & PSUs) Page 14 of 240 Rev.0
IES 2012
IES IES 2011 Conventional
IES2011Conventional
y A round casting is 20 mm in diameter and 50 mm in ConventionalQuestionESE2003
Theratioofsurfaceareaofvolumeforaunitvolumeof
Th ti f f f l f it l f
length. Another casting of the same metal is elliptical in
riserisminimumincaseof Compare the solidification time of two optimum side
cross section,
i with
i h a major
j to minor
i axis
i ratio
i off 2, and
d
(a)Cylindricalriser has the same length and cross
crosssectional
sectional area as the risers of the same volume with one has cylindrical shape
(b)Sphericalriser round casting. Both pieces are cast under the same and other is parallopiped. [30 Marks]

(c)Hemisphericalriser conditions. What is the difference in the solidification

(d)Cuboidsriser times
i off the
h two castings
i ? [ Marks]
[10 M k ]
Area of ellipse = ab
Ci
Circumference
f = 3 ( a + b ) ( 3a + b )( a + 3b )

= 2 (a 2
+ b2 ) / 2 (approx.)

GATE2014 M d l M th d
ModulusMethod
A cylindrical
li d i l blind
bli d riser
i with
ith diameter
di t d and d height
h i ht h,
h is
i y It has
h been
b empirically
i i ll established
t bli h d that
th t if the
th modulus
d l
placed on the top of the mold cavity of a closed type of the riser exceeds the modulus of the casting
g byy a
sandd moldld as shown
h i the
in th figure.
fi If the
th riser
i i off
is
factor of 1.2, the feeding during solidification would be D2
constant volume, then the rate of solidification in the + D2
riser
i is i the
th least
l t when
h theth ratio
ti h : d is
i 4
satisfactory.
f
Sprue basin
d MR = 1.2
1 2 Mc

(a) 1 : 2 (b) 2 : 1 y Modulus = volume/Surface area


Riser h
(c) 1 : 4 (d) 4 : 1 y In steel castings, it is generally preferable to choose a
Mold cavity riser with a heighttodiameter ratio of 1.
Contd

C i Method
Caines M th d
Q
ConventionalQuestionIES2008 Freezingratio=ratio ofcoolingcharacteristicsofcastingto
y Calculate the size of a cylindrical riser (height and diameter
theriser. A ( V)
X= Casting

equal) necessary to feed a steel slab casting of dimensions ( AV ) Riser


30 x 30 x 6 cm with a side riser,
riser casting poured horizontally Th i h ld lidif l
Therisershouldsolidifylastsox>1
into the mould.
a
AccordingtoCaine X= +c
[Use Modulus Method] Yb
[ 0 Marks]
[10 V riser
Y=anda,b,careconstant.
Vcasting

For-2015 (IES, GATE & PSUs) Page 15 of 240 Rev.0


Table:ConstantsinCaines Method Chills
Chill
Q
Conventional QuestionIES2007 y External chills are masses of highheatcapacity,
g p y, highthermal
g
y Calculate the size of a cylindrical riser (height and conductivity material that are placed in the mould (adjacent to
the casting) to accelerate the cooling of various regions.
diameter equal)) necessary to feed a steel slab Chills can effectively promote directional solidification or
increase the effective feeding distance of a riser. They can often
casting of dimensions 25 x 25 x 5 cm with a side b used
be d to reduce
d the
h number
b off risers
i required
i d for
f a casting.
i
riser, casting poured horizontally into the mould. y Internal chills are pieces of metal that are placed within the
mould cavity to absorb heat and promote more rapid
[Use Caines Method] solidification. Since some of this metal will melt during the
operation,
ope at o , itt w
will abso
absorb
b not
ot o
onlyy tthee heatcapacity
eat capac ty eenergy,
e gy, but
[ For steel a = 0.10, b = 0.03 and c = 1.00 ] also some heat of fusion. Since they ultimately become part of
the final casting, internal chills must be made from the same
alloy as that being cast.

IES1995 GATE1998,2007,2014(PI) IAS1994


Chillsareusedincastingmouldsto
Directional solidification in castings can be Chills are used in moulds to (a) Achievedirectionalsolidification
improved by using (b) Reducepossibilityofblowholes
(a) Achieve directional solidification
(c) Reducethefreezingtime
(a) Chills and chaplets (b) Reduce the possibility of blowholes (d) Increasethesmoothnessofcastsurface
( ) Chills and padding
(b) (c) Reduce freezing time
(c) Chaplets and padding (d) Smoothen
S h metall flow
fl for
f reducing
d i splatter.
l
(d) Chills, chaplets and padding.

Cupola IES 2012


IES
y Cupola has been the most widely used furnace for IES1997
melting cast iron.
iron Statement ((I):) Cupola
C p p y
furnace is not employed for
Assertion (A):
( ) Steell can be
b melted
l d in hot
h blast
bl cupola.
l melting steel in foundry
y In hot blast cupola, the flue gases are used to preheat the Reason (R): In hot blast cupola, the flue gases are used to
air blast to the cupola so that the temperature in the Statement ((II):) The temperatures
p generated within a
g
preheat the air blast to the cupola so that the temperature in cupola are not adequate for melting Steel
furnace is considerably higher than that in a the furnace is considerably higher than that in a
conventional cupola.
cupola Coke is fuel and Lime stone ((a)) Both Statement ((I)) and Statement ((II)) are
conventional
i l cupola.
l
individually true and Statement (II) is the correct
(CaCO3) is mostly used flux. (a) Both A and R are individually true and R is the correct explanation of Statement (I)
y Cost
C off melting
l i low.
l explanation
l i off A (b) Both Statement (I) and Statement (II) are
y Main disadvantages of cupola is that it is not possible to (b) Both A and R are individually true but R is not the individually true but Statement (II) is not the correct
produce iron below 2.8% carbon. correct explanation
l i off A explanation of Statement (I)
y Steel can be also p prepared
p in cupola
p byy employing
p y g (c) A is true but R is false (c) Statement (I) is true but Statement (II) is false
duplexing and triplexing operations. (d) A is false but R is true (d) Statement (I) is false but Statement (II) is true
For-2015 (IES, GATE & PSUs) Page 16 of 240 Rev.0
Crucible Furnace or Pot Furnace Induction Furnace
Electric Arc Furnace
ElectricArcFurnace y Smaller foundries generally prefer the crucible furnace. y The induction furnaces are used for all types of
y The crucible is g
generallyy heated byy electric resistance materials, the chief advantage being that the heat
y For heavy steel castings,
castings the
or gas flame. source is isolated from the charge and the slag and flux
openhearth type of furnaces get the necessary heat directly from the charge instead
with electric arc or oil fired of the heat source.
would be generally suitable in
view of the large heat required
for melting.
y Electric arc furnaces are more
suitable for ferrous materials and
are larger in capacity.

CastingCleaning(fettling)
g g( g)
Ladles Impuritiesinthemoltenmetalarepreventedfromreaching GATE1996
y yp g
themouldcavitybyprovidinga
y Twotypesofladlesusedinthepouringofcastings. (i) Strainer
Light impurities in the molten metal are prevented
(ii) Bottomwell f
from reaching
hi theth mouldld cavity
it by
b providing
idi a
(iii) Skimbob
(a) Strainer
(b) Button well
((c)) Skim bob
(d) All of the above

Pouring time
Pouringtime GATE2005 GATE 2006
GATE2006
In a sand casting operation, the total liquid head is
Timetakentofillthemouldwithtopgate maintained
i i d constant such h that
h it i is
i equall to the
h mouldld
Where A=Areaofmould A mould has a downsprue whose length is 20 cm height. The time taken to fill the mould with a top gate
A.H
tA = H H i ht f
H=Heightofmould
ld andd the
th cross sectional
ti l area att the
th base
b off the
th i tA. If the
is h same mould ld is
i filled
fill d with
i h a bottom
b gate,
A g 2gh m
Ag =AreaofGate downsprue is 1cm2. The downsprue feeds a then the time taken is tB. Ignore the time required to
Hm =Gateheight h i
horizontal
t l runner leading
l di into
i t the
th mould ld cavity
it off fill the
h runner and d frictional
fi i l effects.
ff A
Assume
volume 1000 cm3. The time required to fill the atmospheric pressure at the top molten metal surfaces.
mould cavity
ca it will
ill be Th relation
The l i between
b tA andd tB is
i
Timetakentofillthemouldwithbottomgate
(a)4.05 s (b)5.05 s (c)6.05 s (d)7.25 s (A) tB = 2 t A

( )
2A (B) tB = 2 t A
tB = hm hm H tA
Ag 2g ((C)) tB =
2
For-2015 (IES, GATE & PSUs) Page 17 of 240 Rev.0
(D) tB = 2 2 t A
GATE 2007(PI)LinkedS1
GATE 2007 (PI) Li k d S 1 GATE 2007(PI)LinkedS2
GATE 2007 (PI) Li k d S 2 Expressionforchokearea
In a sand casting process, a sprue of 10 mm base In a sand casting process, a sprue of 10 mm base m
diameter and 250 mm height leads to a runner diameter and 250 mm height leads to a runner CA = mm2
ct 2gH
which fills a cubical mould cavity of 100 mm size which fills a cubical mould cavity of 100 mm size
The volume flow rate (in mm3/s) is The mould filling time (in seconds) is Wherem=massofthecasting,kg
(a) 0.8 x 105 (b) 1.1 x 105 (a) 2.8 (b) 5.78 =Densityofmetal,kg/m3
t=pouringtime
p g
1 7 x 105
(c) 1.7 2 3 x 105
(d) 2.3 (c) 7.54
7 54 (d) 8.41
8 41
c=Efficiencyfactorandisthefunctionofgate
systemused
y
H=Effectiveheadofliquidmetal
=hfortopgate

Contd

H=h
H h
hm
forbottomgate
f b tt t
IES2009 IAS2011Main
2 y 2marks
h2
Sketch a mould for two hollow components to be
=h c forpartinglinegate
2hm cast. On the diagram, indicate runner, gate, riser,
core, cope, sprue, pouring basin, sprue well, drag,
parting line.
line
hC
hm
[
[10Marks]
]
hm hm

P i li
t t ti li t b tt t
topgatepartinglinegatebottomgate

C ti D f t
CastingDefects G D f t
GasDefects
IES2013 Thefollowingarethemajordefects,whicharelikelyto
Th f ll i th j d f t hi h lik l t y A condition existing in a casting caused by the
When an alloy solidifies over a range of occurinsandcastings:
g trapping of gas in the molten metal or by mold gases
evolved during the pouring of the casting.
temperature, the resulting casting structure is: y Gasdefects y The defects in this category
g y can be classified into
(a) Wholly equiaxed blowholes and pinhole porosity.
y Shrinkagecavities
y Blowholes
ow o es aaree sp
spherical
e ca oor eelongated
o gated cav
cavities
t es p
present
ese t
( ) Wholly columnar
(b) y Moldingmaterialdefects in the casting on the surface or inside the casting.
(c) Partially columnar partially equiaxed
equi axed y Pinhole porosity occurs due to the dissolution of
y Pouringmetaldefects
hydrogen gas, which gets entrapped during heating of
(d) Dendritic y Moldshift.
M ld hift molten metal.
metal
For-2015 (IES, GATE & PSUs) Page 18 of 240 Rev.0
Shrinkage Cavities
ShrinkageCavities Cutandwashes
d h
y These are caused by liquid shrinkage occurring during the
MoldingMaterialDefects
solidification of the casting. y These
Th appear as rough
h spots
t and
d areas off excess metal,
t l and
d
y Cutsandwashes, are caused by erosion of molding sand by the flowing
y To compensate for this, proper feeding of liquid metal is
metal.
metal
required. For this reason risers are placed at the
appropriate places in the mold. y Scab y This is caused by the molding sand not having enough
strength and the molten metal flowing at high velocity.
velocity
y Sprues may be too thin, too long or not attached in the y Metalpenetration,
proper location, causing shrinkage cavities. y The former can be taken care of by the proper choice of
molding sand and the latter can be overcome by the
y It is recommended to use thick sprues to avoid shrinkage y Fusion,and
proper design of the gating system.
cavities.
y Swell
S ll

Scab M t l
Metalpenetration
t ti
y This defect occurs when a portion of the face of a mould
y When molten metal enters into the gaps between sand
Fusion
lifts or breaks down and the recess thus made is filled by y This is caused by the fusion of the sand grains with
grains, the result is a rough casting surface.
metal.
y This occurs because the sand is coarse or no mold wash was th molten
the lt metal,
t l giving
i i a brittle,
b ittl glassy
l appearance
y When the metal is poured into the cavity, gas may be
applied on the surface of the mold. The coarser the sand
disengaged with such violence as to break up the sand,
grains more the metal p
g penetration. on the casting
g surface.
which
hi h is
i then
h washed
h d away and
d the
h resulting
l i cavity
i filled
fill d
with metal. y The main reason for this is that the clay or the sand
y The
Th reasons can be:b too fine
fi sand,d low
l permeability
bili off
sand, high moisture content of sand and uneven mould particles are of lower refractoriness or that the
ramming.
i pouring temperature is too high.

P i M t lD f t
PouringMetalDefects y The misrun and cold shut defects are caused either by
Swell
Under the influence of metallostatic forces, the mold The likely defects in this category are a lower fluidity of the mold or when the section
wall may move back causing a swell in the dimension y Misruns and thickness of the casting is very small. Fluidity can be
off the
th casting.
ti A proper ramming
i off the
th moldld will
ill y Cold shuts improved by changing the composition of the metal
correct this defect. and by increasing the pouring temperature of the
metal.
metal
y A misrun is caused when the metal is unable to fill
Inclusions the mold cavity completely and thus leaves unfilled
Particles of slag, refractory materials sand or cavities.
deoxidation products are trapped in the casting during
pouring solidification.
ldf The
h provision off choke
h k in the
h y A cold shut is caused when two streams while meeting
gating system and the pouring basin at the top of the in the mold cavity, do not fuse together properly thus
mold
ld can preventt this
thi defect
d f t forming a discontinuity in the casting.
casting
For-2015 (IES, GATE & PSUs) Page 19 of 240 Rev.0
Contd
GATE 2014
GATE2014 GATE2004 GATE2009
Match the casting defects (Group A) with the probable
causes (Group B): Two streams of liquid metal which are not hot
GroupA GroupB Misrun is a casting defect which occurs due to
P: Hot tears 1: Improper fusion of two streams of liquid enough
h to
t fuse
f properly
l result
lt into
i t a casting
ti defect
d f t
metal (a) Very high pouring temperature of the metal
known as
Q: Shrinkage 2: Low permeability of the sand mould (b) Insufficient fluidity of the molten metal
R: Blow holes 33: Volumetric contraction both in liquid
q and (a) Cold shut
solid stage (c) Absorption of gases by the liquid metal
(b) Swell
S: Cold Shut 4: Differential cooling rate
(d) Improper
I alignment
li off the
h mould
ld flasks
fl k
P Q R S P Q R S (c) Sand wash
(a) 1 3 2 4 (b) 4 3 2 1
(d) Scab
(c) 3 4 2 1 (d) 1 2 4 3

MoldShift
ld h f Metallurgical defects
Metallurgicaldefects
y Hot tears or hot cracking, cause of this defect is that
GATE2014
The mold shift defect occurs when cope and drag stresses and strains built up during solidification are too
high compared to the actual strength of the semisolid The hot tearing in a metal casting is due to
or molding
ldi boxes
b h
have nott been
b properly
l aligned.
li d material. This type of defects occurs in the lower part of
the solidification range, close to the solidus, when the (a) high fluidity
alloy has a wide solidification temperature range and a
(b) high melt temperature
small amount of liquid, when the solid fraction is more
than 0.9, the hot tearing is easy to occur. Proper mould (c) wide range of solidification temperature
design prevents this type of defect.
y Hot spots are areas on the surface of casting that (d) low
l coefficient
ffi i off thermal
h l expansion
i
become veryy hard because theyy cooled more q quicklyy
than the surrounding material.

IES2001 IAS2004 GATE2003


MatchListI(CastingDefects)withListII(Explanation)andselectthecorrect
MatchList I(CastingDefects)withList II(Explanation)andselectthecorrect
answerusingthecodesgivenbelowthelists: Hardnessofgreensandmouldincreaseswith
ListI ListII
Scabisa (CastingDefects) (Explanation) (a) Increaseinmoisturecontentbeyond6percent
y p
A.Metallicprojections 1.Consistofroundedorroughinternalorexposedcavities
includingblowholesandpinholes (b) Increaseinpermeability
(a) Sandcastingdefect B.Cavities 2.Formedduringmelting,solidificationandmoulding.
C.Inclusions 3.Includessinglefolds,laps,scarsadheringsandlayersand (c) Decreaseinpermeability
(b) Machiningdefect oxidescale
(d) Increaseinbothmoisturecontentand
D.Discontinuities 4.Includecracks,coldorhottearingandcoldshuts
5.Consistoffins,flashormassiveprojectionsandrough
Consistoffins flashormassi eprojectionsandrough permeability
bilit
(c) Weldingdefect surfaces
Codes:A B C D A B C D
(a) 1 5 3 2 (b) 1 5 2 4
(d) Forgingdefect
F i d f (c) 5 1 2 4 (d) 5 1 3 2

For-2015 (IES, GATE & PSUs) Page 20 of 240 Rev.0


IES1998 IES2005 IES1997
Assertion(A):Stiffeningmembers,suchaswebs
A i (A) S iff i b h b In gating system design, which one of the If the melting ratio of a cupola is 10: 1, then the
andribs,usedonacastingshouldbeliberally following is the correct sequence in which choke coke requirement for one ton melt will be
provided
provided. area, pouring time, pouring basin and sprue sizes (a) 0.1 ton
Reason(R):Theywillprovideadditionalstrength are calculated?
toacastmember.
toacastmember (b) 10 tons
(a) Chokearea Pouringtime Pouringbasin Sprue (c) 1 ton
(a) BothAandRareindividuallytrueandRisthe
correctexplanationofA (b) Pouringbasin
ou g bas Sprue
Sp ue C
Chokearea
o e a ea Pouringtime
ou g t e (d) 11 tons
t
(b) BothAandRareindividuallytruebutRisnot the (c) Chokearea Sprue Pouringbasin Pouringtime
correctexplanationofA (d) Pouringbasin
P i b i Pouringtime
P i ti Chokearea
Ch k Sprue
S
(c) AistruebutRisfalse
(d) AisfalsebutRistrue
Ai f l b tRi t

IES2009 IAS2001 IAS2004


In which one of the following furnaces most of the Whichofthefollowingpatternmaterialsareused Whichoneofthefollowinggatingsystemsisbest
nonferrous alloys are melted? inPrecisionCasting? suitedtoobtaindirectionalsolidification?
(a) Reverberatory furnace 1. PlasterofParis (a) Topgrating
(b) Induction furnace 2. Plastics (b) Part
Partlinegrating
linegrating
(c) Crucible furnace 3. AnodizedAluminium Alloy (c) Bottomgrating
(d) Pot
P t furnace
f 4. FrozenMercury
F M (d) Steppedgrating
St d ti
Selectthecorrectanswerusingthecodesgivenbelow:
(a)1and2(b) 2and4(c)3and4(d)1and3

Cast Aluminium Code


CastAluminiumCode C l i i C d
CastAluminiumCode
y Fourdigitidentificationsystem
Contd..
IES2011
y Second two digits identify the aluminium alloy or In the designation of Aluminium casting A514.0
A514 0
y Firstdigitindicatesalloygroup indicate the aluminium purity. indicates :
1 Aluminium,99%ormore
, 99 y The last digit is separating from the other three by a ( ) Aluminium
(a) Al i i purity
it
2 copper decimal point and indicates the product form; that is, (b) Aluminium content
3 Silicon,withcopperand/ormagnesium
3 Silicon withcopperand/ormagnesium castings or ingots
(c) Percentage of alloy element
4 silicon y A modification of the original alloy is indicated by a
(d) Magnesium Content
5 magnesium serial
i l letter
l tt before
b f th numerical
the i l designation.
d i ti
6 notused y Alloy A514.0 indicates an aluminium alloy casting with
magnesium as the principal alloy. One modification to A
Ans. (d)
7 zinc
the original alloy has made, as indicated by the letter A.
8 tin
8
For-2015 (IES, GATE & PSUs)
9 otherelements Page 21 of 240 Rev.0
ShellMoulding
y Can produce complex parts.
y The sand is mixed with a thermosetting resin is
allowed to come in contact with a heated metal pattern y A good
d surface
f fi i h and
finish d good
d size
i t l
tolerance

SpecialCasting (2000C).
y A skin
ki (shell)
( h ll) off about
b 3.5 mm off sand
mixture adhere to the pattern.
d and
d plastic
l i
reduce the need for machining.
g

y Materials can be cast: CI, Al and Cu alloys.


y Then the shell is removed from the pattern.
y The cope
p and drag g shells are kept
p in a flask with
necessary backup material and the molten metal is
poured into the mold.
p
BySKMondal

MoldingSandinShellMolding y Hot coating: the mixture is heated to 150oC 180oC prior

y The molding sand is a mixture of fine grained quartz sand to loading the sand. In the course of sand mixing, the

and
d powdered
d d bakelite.
b k li soluble phenol formaldehyde resin is added.
added The mixer is
allowed to cool up to 80 90o C. Hot coting gives better
y Cold coating and Hot coating methods are used for
properties to the mixtures than cold method.
coating the sand grains with bakelite.

y Cold coating: quartz sand is poured into the mixer and


th the
then th solution
l ti off powdered
d d bakelite
b k lit in
i acetone
t and
d
ethyl aldehyde are added. (mixture is 92% quartz sand,
Shellmouldingprocess
h ll ldi
5% bakelite, 3% ethylaldehyde )
Contd

Ad t
Advantages Li it ti
Limitations
y Expensive pattern
Applications
y Dimensional
Di i l accuracy.

y Smoother surface finish.


finish (Due to finer size grain used) y Small size casting
g only.
y y Cylinders and cylinder heads for air cooled IC

y Highly complicated shapes cannot be obtained.


engines
y Very
y thin sections can be cast.
y Automobile transmission parts.
y Very small amount of sand is needed. y More sophisticated equipment is needed for handling
the shell moldings. y Piston rings

For-2015 (IES, GATE & PSUs) Page 22 of 240 Rev.0


IES 2010
IES2010 IES1996
Considerthefollowingadvantagesofshell
IES2005
Consider the following ingredients used in Inshellmoulding,howcantheshellthickness
I h ll ldi h th h llthi k
mouldcasting: moulding: beaccuratelymaintained?
1.Closedimensionaltolerance.
Cl di i lt l 1. Dry silica sand ( )
(a)Bycontrollingthetimeduringwhichthepattern
2.Goodsurfacefinish. 2.Clay isincontactwithmould
(b)Bycontrollingthetimeduringwhichthepattern
3.Lowcost. 3.Phenol formaldehyde
isheated
4.Easier.
E i 4.Sodium
S di silicate
ili t
(c)Bymaintainingthetemperatureofthepatternin
Whichofthesearecorrect? Those used for shell mould casting include
therangeof175oC
C 380oC
(a) 1, 2 and 4 (b) 2, 3 and 4
(a)1,2and3only (b)2,3and4only (d)Bythetypeofbinderused
((c)) 1and 3 ((d)) 1,, 2,, 3 and 4
( )
(c)1,2and4only ( )
(d)1,2,3and4

IES2006 IES2007 IAS2007


Shellmouldingcanbeusedfor: The mould in shell moulding process is made up
(a) Producingmillingcutters
g g Which of the following are employed in shell
moulding?
ldi ? off which
hi h off the
th following?
f ll i ?
(b) Makinggoldornaments
1. Resin binder 2. Metal pattern 3. Heating coils
(c) Producingheavyandthickwalledcasting (a) Gypsum + setting agents
Select the correct answer using the code given
(d) Producingthincasting below: (b) Green sand + clayy
(a) 1 and 2 only (b) 1 and 3 only
(c) Sodium silicate + dried sand
(c) 2 and 3 only (d) 1,
1 2 and 3
(d) Dried silica + phenolic resin

IAS1999 I t t C ti
InvestmentCasting
Match
M t h List
Li t I (Moulding
(M ldi Process)
P ) with
ith List
Li t II (Binding
(Bi di Investment casting process or lost wax process
Agent) and select the correct answer using the codes Basic steps:
given below the lists:
g 1 Produce expendable wax,
1. wax plastic,
plastic or polystyrene patterns.
patterns
List I List II
2. Assemble these patterns onto a gating system
A. Green sand 1. Silicate
3 Investing or covering the pattern assembly with refractory
3.
B. Core sand 2. Organic
slurry
C. Shell moulding 3. Clay
4 Melting the pattern assembly to remove the pattern material
4.
D CO2
D. CO process 4. Plaster
Pl off Paris
P i
5. Plastic 5. Firing the mould to remove the last traces of the pattern
Codes:A B C D A B C D material
(a) 3 2 5 1 (b) 3 2 4 1 6. Pouring molten metal
(c) 2 3 5 4 (d) 2 3 4 5 7. Knockout, cutoff and finishing.
For-2015 (IES, GATE & PSUs) Page 23 of 240 Rev.0
Fig.Investmentflaskcastingprocedure
CeramicShellInvestmentCasting
IES2009
y In ceramic shell investment casting a ceramic shell is y 2marks
built around a tree assembly by repeatedly dipping a
pattern into a slurry (refractory material such as
zircon with binder).

y After each dipping and stuccoing is completed, the


assembly is allowed to thoroughly dry before the next
coating is applied.
applied

Advantages Limitations Applications


y Tight dimensional tolerances
y Costly patterns and moulds y Aerospace and rocket components.
y Excellent surface finish (1.2 3 0 m )
(1 2 to 3.0
y Labour costs can be high y Vanes and blades for gas turbines.
y Machining
g can be reduced or completely
p y
eliminated y Limited size y Surgical instruments

y High melting point alloy can be cast, almost any


metal can be cast
y Almost unlimited intricacy
y

IES2011 GATE2006 GATE2011(PI)


The proper sequence of investment casting steps is :
(a) Slurry coating pattern melt outShakeout Stucco An expendable pattern is used in Which of the following casting processes uses
coating
ti ( ) Slush
(a) l h casting
(b) Stucco coating Slurry coating Shakeout Pattern expendable pattern and expendable mould?
(b) Squeeze casting
melt out (c) Centrifugal casting (a) Shell mould casting
(c) Slurryy coating
g Stucco coating
g Pattern melt out (d) Investment casting
Shakeout ( ) Investment casting
(b)
(d) Stucco coating Shakeout Slurry coating Pattern (c) Pressure die casting
melt out
(d) Centrifugal casting
For-2015 (IES, GATE & PSUs) Page 24 of 240 Rev.0
IES1992 20 0
JWM2010
ISRO2010 Themostpreferredprocessforcastinggasturbine
g
Considerthefollowingmaterials:
1.Wax
Investment casting is used for bladesis:
2 Wood
2.Wood
(a) Shapes which are made by difficulty using complex (a) Diemoulding
3.Plastic
patterns
tt i sand
in d casting
ti (b) Shellmoulding
Whichofthesematerialscanbeusedaspatternin
(c) Investmentmoulding
(b) Mass production
p investmentcastingprocess?
(d) Sandcasting
S d ti
(a)1,2and3 (b)1and2only
(c) Shapes which are very complex and intricate and
(c)2and3only (d)1and3only
can't be cast by any other method
(d) There is nothing like investment casting

IES 2010
IES2010 IES 2007
IES2007 IES2006
( ) The investment casting
Assertion (A): g is used for Consider the following statements in respect of
precision parts such as turbine plates, sewing investment castings: Which of the following materials are used for
machines etc. 1. The pattern or patterns is/are not joined to a stalk or making patterns in investment casting method?
sprue also of wax to form a tree of patterns. 1. Wax 2. Rubber 3. Wood 4. Plastic
Reason (R): The investment castings have a good
surface finish and are exact reproductions of the 2.The prepared moulds are placed in an oven and heated Select the correct answer using the codes given below:
gently to dry off the invest and melt out the bulk of wax.
master pattern. (a) Only 1 and 3 (b) Only 2 and 3
3.The moulds are usually poured by placing the moulds in
(a) Both A and R are individually true and R is the ( ) Only
(c) O l 1, 2 andd4 (d) Only
O l 2, 3 and d4
a vacuum chamber. Which of the statements given above
correct explanation of A are correct?
(b) Both
B th A and d R are individually
i di id ll true
t b t R is
but i NOT the
th (a) 1 and 2 only (b) 1 and 3 only
correct explanation of A (c)2 and 3 onlyy (d) 1, 2 and 3
(c) A is true but R is false
(d) A is false but R is true

IAS1996 PermanentMouldCasting Advantages


Light and intricate parts with close dimensional
y The process in which we use a die to make the y Good surface finish and dimensional accuracy
tolerances of the order of 0.005 mm are
castings is called permanent mold casting or gravity y Metal
M l mold
ld gives
i rapid
id cooling
li and
d finegrain
fi i
produced by
die casting, since the metal enters the mold under structure
(a) Investment castingg gravity.
gravity
(b) Die casting y Multipleuse molds.
y Some time in diecasting we inject the molten metal
(c) Centrifugal casting with a high pressure.
pressure When we apply pressure in
(d) Shell mould casting injecting the metal it is called pressure die casting
process.
process
y Grey cast iron is used for mould material.

For-2015 (IES, GATE & PSUs) Page 25 of 240 Rev.0


IES 2013
IES2013
Disadvantages Applications Statement (I): Mould walls of a permanent mould are
kept thick.
thick
y High initial mold cost Statement (II): The thicker mould walls retain
y Pistons/cylinders/rods
y Shape,
Shape size
size, and complexity are limited maximum
i h
heat i
increasing
i flow
fl off molten
l metal.
l
y Mold life is very limited with highmeltingpoint y Gears
metals such as steel.
steel (a) Both Statement (I) and Statement (II) are individually
y Low melting point metals can be cast y Kitchenware true and Statement (II) is the correct explanation of
Aluminum
Statement (I)
Zinc (b) Both Statement (I) and Statement (II) are individually
Magnesium alloys true but Statement ((II)) is not the correct explanation
p of
Brass Statement (I)
Cast iron (c) Statement (I) is true but Statement (II) is false
(d) Statement (I) is false but Statement (II) is true

DieCasting Hotchambermachinesare
y Molten metal is injected into closed metal dies under
Die casting machines can be
Diecastingmachinescanbe
y Good for low temperature (approx. 400C)
pressures ranging from 100 to 150 MPa. y Faster than
h cold
ld chamber
h b machines
h

y Pressure is maintained during solidification y Hotchamber y Cycle times must be short to minimize metal
contamination
y After which the dies separate and the casting is ejected y Coldchamber y Metal starts in a heated cylinder
y
along with its attached sprues and runners. y A piston forces metal into the die
y The piston retracts,
retracts and draws metal in
y Cores must be simple and retractable and take the y Metal: Lead, Tin, Zinc
form of moving metal segments

Coldchambermachines
y Castshighmeltingpointmetals(>600C)

y Highpressuresused

y Metalisheatedinaseparatecrucible
l h d bl
y Metalisladledintoacoldchamber

y Themetalisrapidlyforcedintothemoldbeforeit
cools
y Copper
Copper,BrassandAluminiumcancast.
BrassandAluminiumcancast
For-2015 (IES, GATE & PSUs)
HotChamber Page 26 of 240 Rev.0
Advantages
y Extremelysmoothsurfaces(1m) Limitations Applications
y Carburettors
y Excellentdimensionalaccuracy y Highinitialdiecost
y Automotive
A t ti parts
t
y Rapidproductionrate y Limitedtohighfluiditynonferrousmetals
y Bathroom fixtures

y Bettermechanicalpropertiescomparedtosand y Partsizeislimited y Toys

casting y Porositymaybeaproblem
P it b bl
Common metals
y Somescrapinsprues,runners,andflash,butthiscan
p p , , ,
y Intricatepartspossible y Alloys
All off aluminum,
l i zinc,
i magnesium,
i and
d lead
l d
bedirectlyrecycled y Also possible with alloys of copper and tin
y Minimumfinishingoperations

y Thinsectionspossible

IES2011 IES2009 20 0
JWM2010
Consider the following advantages of die casting over Assertion (A) ( ) : In die casting g method,, small
Which of the following are the most suitable thickness can be filled with liquid metal.
sand casting :
materials for die casting?
1 Rapidity of the process
1. Reason (R) : The air in die cavity trapped inside the
(a) Zinc and its alloys casting causes problems.
2. Smooth surface
3 Strong dense metal structure
3. (b) Copper and its alloys (a) BothAandRareindividuallytrueandRisthe
Which of these advantages are correct ? (c) Aluminium and its alloys correctexplanationofA
( ) 1, 2 and
(a) d3 (d) Lead
L d andd its
it alloys
ll (b) BothAandRareindividuallytruebutRisnot
B hA dR i di id ll b Ri the
h
(b) 1 and 2 only correctexplanationofA
(c) 2 and 3 only (c) AistruebutRisfalse
(d) 1 and 3 onlyy ((d)) AisfalsebutRistrue

IES2005 IES2006 IES1995


Which one of the following processes produces a In which of the following are metal moulds used? Assertion
A i (A):
(A) An
A aluminium
l i i alloy
ll with
i h 11 % silicon
ili is
i
casting when pressure forces the molten metal used for making engine pistons by die casting
(a) Greensand mould technique.
technique
into the mould cavity? (b) Dry sand mould Reason (R): Aluminium has low density and addition
(a) Shell moulding
g (b) Investment casting
g (c) Die casting process of silicon improves
p its fluidity
y and therefore its
(c) Die casting (d) Continuous casting castability.
(d) Loam moulding
(a) Both A and R are individuallyy true and R is the correct
explanation of A
(b) Both A and R are individually true but R is not the
correct explanation
l i off A
(c) A is true but R is false
(d) A is false
f l but
b R is true
For-2015 (IES, GATE & PSUs) Page 27 of 240 Rev.0
IES1995 IAS2007 IAS1996
MatchListIwithListIIandselectthecorrectanswertakingthehelp Assertion
A i (A):
(A) Die
Di casting i yields
i ld a product
d off goodd
ofcodesgivenbelowthelists: Considerthefollowingstatements:
ListI ListII 1. Zincdiecastingshavelowstrength.
g g accuracy and finish.
(Products) (Processofmanufacture) R
Reason (R) Low
(R): L melting
li alloys
ll used
d ini diedi
A. Automobilepistoninaluminium alloy 1.Pressurediecasting 2. Inthediecastingprocess,verythinsectionsor casting.
B. Enginecrankshaftinspheroidal
complexshapescanbeobtainedeasily.
graphiteiron
hi i 2.Gravitydiecasting
G i di i ( ) Both
(a) B h A and d R are individually
i di id ll true and d R isi the
h
C. Carburettor housinginaluminium alloy 3.Sandcasting Whichofthestatementsgivenaboveis/arecorrect? correct explanation of A
D. Casttitaniumblades 4.Precisioninvestment
casting
i ( ) 1only
(a) l (b) Both
B h A and d R are individually
i di id ll true butb R is
i not theh
5.Shellmoulding correct explanation of A
Code: A B C D A B C D (b) 2only
(a) 2 3 1 5 (b) 3 2 1 5 (c) Both1and2 ( ) A is
(c) i true but
b R is i false
f l
(c) 2 1 3 4 (d) 4 1 2 3
((d)) Neither1nor2 (d) A is false but R is true

IES2011 GATE2007 IES1995


Consider the following statements : Assertion
A i (A):
(A) Aluminium
Al i i alloys
ll are cast ini hot
h
1. Hot chamber machine is used for casting zinc, tin and Which of the following engineering materials is chamber die casting machine.
other
th lowl melting
lti alloys.
ll th mostt suitable
the it bl candidate
did t for
f hot
h t chamber
h b die di Reason (R): Aluminium alloys require high melting
casting? when compared to zinc alloys.
2. Cold chamber machine is used for die casting of
(a) Both A and R are individually true and R is the correct
ferrous alloys ( ) Low carbon
(a) b steell explanation of A
33. Rapid
p cooling
g rate in die casting g p
produces high
g (b) Titanium (b) Both A and R are individually true but R is not the
strength and quality in many alloys. (c) Copper correct explanation of A
Which of these statements are correct? (d) Tin ((c)) A is true but R is false
(a) 1, 2 and 3 (b) 1 and 2 only
(d) A is false but R is true
( ) 2 and
(c) d 3 only
l (d) 1 andd 3 only
l

Centrifugal Casting
CentrifugalCasting
( )
GATE2009(PI) y Process: Molten metal is introduced into a rotating
g sand,
metal, or graphite mould, and held against the mould
Hot chamber die casting process is NOT suited for
wall by centrifugal force until it is solidified
(a) Lead and its alloy
y A mold is set up and rotated along a vertical (rpm is
(b) Zinc and its alloy
reasonable), or horizontal (2001000 rpm is reasonable)
( ) Tin
(c) Ti and
d its
it alloy
ll
axis.
((d)) Aluminum and its alloyy
y The
Th mold
ld is
i coated
d with
i h a refractory
f coating.
i

y During cooling lower density impurities will tend to rise


Fi T
Fig.Truecentrifugalcasting
if l i
For-2015 (IES, GATE & PSUs) towards the center ofPage 28 of 240
rotation. Rev.0
P
Properties
ti Advantages Li it ti
Limitations
y The mechanical properties of centrifugally cast jobs are y Fine
Fi grained
i d structure
t t att the
th outer
t surface
f off the
th y More segregation of alloy component during pouring under
better compared to other processes, because the inclusions casting free of gas and shrinkage cavities and the forces of rotation
such as slag and oxides get segregated towards the centre porosity
it
and can be easily removed by machining. Also, the y Contamination of internal surface of castings with non
pressure acting
p g on the metal throughout
g the solidification y Formation of hollow interiors in cylinders without
causes the porosity to be eliminated giving rise to dense cores metallic
lli inclusions
i l i
metal. y Can p produce a wide range g of cylindrical
y parts,
p y Inaccurate internal diameter
y No cores are required for making concentric holes in the including ones of large size.
case of true centrifugal casting. y Good dimensional accuracy, soundness, and y Shape is limited.
cleanliness y Spinning equipment can be expensive
y There is no need for gates and runners,
runners which
y Poor machinability
increases the casting yield, reaching almost 100 %.

l
Commonmetals GATE2002 GATE1993
y Iron
Centrifugally cast products have
y steel In centrifugal casting, the impurities are (a) Large
g g
grain structure with high
g pporosityy
y stainlesssteel
t i l t l ( ) Uniformly
(a) f l distributed
d b d (b) Fine grain structure with high density
y alloysofaluminium,copper,andnickel (b) Forced towards the outer surface (c) Fine grain structure with low density
(c) Trapped near the mean radius of the casting (d) Segregation of slug towards the outer skin of the
(d) Collected at the centre of the casting casting
ti

IES2008 IES2009
( )
GATE2008(PI) Which of the following casting processes does not
In hollow cylindrical parts, made by centrifugal casting, /do not require central core for producing pipe? Which one of the following casting processes is
1 Sand casting process
1. b t
best suited
it d t
to make
k bi
bigger size
i h ll
hollow
the density of the part is
2. Die casting process
3 Centrifugal casting process
3. symmetrical
y pipes?
p p
( ) maximum
(a) i at the
h outer region
i
Select the correct answer using the code given below: (a) Die casting
(b) maximum at the inner region ( ) 1 and
(a) d2
(b) 2 only (b) Investment casting
((c)) maximum at the midpoint
p between outer and inner
(c) 2 and 3 (c) Shell moulding
surfaces
(d) 3 onlyy
(d) uniform throughout (d) Centrifugal casting
For-2015 (IES, GATE & PSUs) Page 29 of 240 Rev.0
IES2007 IES1998 IES2009
Which one of the following is the correct Poormachinability ofcentrifugallycastironpipe Which of the following are the most likely
statement? isdueto characteristics in centrifugal casting?
In a centrifugal casting method (a) Chilling (a) Fine grain size and high porosity
(a) No core is used (b) Segregation (b) Coarse grain size and high porosity
(b) Core may be made of any metal (c) Densestructure (c) Fine grain size and high density
( ) Core
(c) C i made
is d off sand
d (d) Highmouldrotationspeed
Hi h ld t ti d (d) Coarse
C grain
i size
i andd high
hi h density
d it
(d) Core is made of ferrous metal

IES2007 IES2000 IAS2004


MatchListIwithListIIandselectthecorrectanswerusingthecodegiven
belowtheLists:
MatchListI(Process)withListII(Products/materials)
M t hLi tI(P ) ithLi tII(P d t / t i l )
ListI ListII andselectthecorrectanswerusingthecodesgiven MatchListI(NameoftheProcess)withListII(Advantage)andselectthecorrect
answerusingthecodesgivenbelowthelists:
(CastingProcess) (Principle) belowtheLists: List I
ListI List II
ListII
A. Diecasting 1.Themetalsolidifiesinarotatingmould ListI ListII (NameoftheProcess) (Advantage)
B. Investmentcasting 2.Thepatternclusterisrepeatedlydipped
intoaceramicslurryanddustedwith A. Diecasting 1.Phenolformaldehyde A. SandCasting 1.Largecylindricalpartswithgoodquality
refractory
f B
B. C
Ceramicmoldcasting
i ld ti 2.Excellentdimensionalaccuracyandsurface
E ll tdi i l d f
C. Shellmoulding 3.Moltenmetalisforcedbypressureinto
B. Shellmolding 2.C.I.pipes finish
ametallicmould C. CO2 molding 3.Nonferrousalloys C. Diecasting 3.Intricateshapesandclosetoleranceparts
D
D. Centrifugalcasting 4 Aftercooling theinvestisremoved
4.Aftercooling,theinvestisremoved
fromthe Castingbypressurejettingor D Centrifugalcasting
D. C if l i 4.Sodiumsilicate
S di ili D
D. C
Centrifugalcasting
if l i 4.Almostanymetaliscastandthereifnolimitto
Al li d h if li i
vibratorycleaning size,shapeandweight
Code: A B C D A B C D
Codes:A B C D A B C D 5.Gooddimensionalaccuracy,finishandlow
(a) 2 1 3 4 (b) 3 4 2 1 (a) 1 3 4 2 (b) 3 1 4 2 porosity
(c) 2 4 3 1 (c) 3 1 2 4 (c) 3 1 2 4 (d) 1 3 2 4 Codes:A B C D A B C D
(a) 2 3 5 1 (b) 4 1 2 3

(c) 2 1 5 3 (d) 4 3 2 1

SemicentrifugalCasting IAS2003
Assertion
A i (A):
(A) S Semicentrifugal
i if l casting
i process isi
y Centrifugal force assists the flow of metal from a similar to true centrifugal casting except that the
central
t l reservoir
i to
t the
th extremities
t iti off a rotating
t ti central core is used in it to form inner surface.
surface
Reason (R): In semicentrifugal casting process the
symmetrical
y mold,, which mayy be either expendable
p or p is always
axis of spin y vertical
(a) Both A and R are individually true and R is the correct
multipleuse p
explanation of A
y Rotational speeds are lower than for true centrifugal (b) Both A and R are individually true but R is not the
correct explanation of A
casting (c) A is true but R is false
(d) A is false but R is true
y Cores can be used to increase the complexity of the
For-2015 (IES, GATE & PSUs) Page 30 of 240 Rev.0
product. Fig. Semicentrifugalcasting
IES2013
Statement (I): In semi centrifugal casting a particular Centrifuging
p of the casting
shape g is p
produced byy mould, core and the
centrifugal force of molten metal. y Uses centrifuging action to force the metal from a central
Statement (II): The centrifugal force aids to proper pouring reservoir into separate mold cavities that are
feeding to produce the casting free from porosity.
offset from the axis of rotation.
(a) Both Statement (I) and Statement (II) are individually
true and Statement (II) is the correct explanation of y Low speed
Statement (I) y May used to assist in the pouring of investment casting
(b) Both Statement (I) and Statement (II) are individually
trees.
t
true b t Statement
but St t t (II) is
i nott the
th correctt explanation
l ti off
Statement (I)
( ) Statement (I)
(c) ( ) is true but
b Statement (II)
( ) is false
f l
(d) Statement (I) is false but Statement (II) is true Fig.Methodofcastingbythecentrifugingprocess

IES2000 DrySandMolding SlushCasting


MatchListI(Typeofcasting)withListII(Workingprinciples)
M t hLi tI(T f ti ) ithLi tII(W ki i i l )
andselectthecorrectanswerusingthecodesgivenbelowthe y To reduce gas forming materials air dried mould used. y Slush casting is a variation of the permanent mold process
Lists: in which the metal is permitted to remain in the mold only
Li tI
ListI Li tII
ListII Types: until a shell of the desired thickness has formed.
A. Diecasting 1.Moltenmetalisforcedintothedie
underpressure y The mold is then inverted and the remaining liquid is
B. Centrifugalcasting 2.Axisofrotationdoesnotcoincidewith 1 Skin drying and
1.Skin poured out.
axisofmould
C. Centrifuging
g g 33.Metalsolidifieswhenmouldisrotating
g 2.Complete mold drying y When the mold halves are separated, the resulting casting
D. Continuouscasting 4.Continuouslypouringmoltenmetal is a hollow shape with good surface detail but variable wall
intomould thickness.
Codes: A B C D A B C D
(a) 1 3 2 4 (b) 4 3 2 1 y Frequently used to cast lowmeltingtemperature metals
(c) 1 2 3 4 (d) 4 2 3 1 into ornamental objects such as candlesticks, lamp bases,
andd statuary.

IAS2004 IES2011 IES 2012


IES
The method of casting for producing ornamental pieces The process of making hollow castings of non circular
noncircular
Which of the following are produced by slush
are: shape and desired thickness by permanent mould
casting?
( ) Slush
(a) Sl h and d gravity
it casting
ti without the use of cores is known as
(a) Hollow castings with thick walls
(b) Pressed and slush casting (a) Die casting (b) Slush casting
(b) Hollow castings with thin walls
(c) Gravity and semi permanent mould casting ( ) Pressed
(c) P d casting
ti (d) Centrifugal
C t if l casting
ti
(c) Thin castings
(d) Thick
Thi k castings
ti (d) Semi permanent mould and pressed casting

For-2015 (IES, GATE & PSUs) Page 31 of 240 Rev.0


SqueezeCasting IAS2002 Si l C
SingleCrystalCasting
lC i
MatchListI(CastingProcess)withListII
M t hLi tI(C ti P ) ithLi tII The process is effectively:
Process:
(Applications)andselectthecorrectanswerusingthe 1. Prepare a mold so that one end is a heated oven, and
1. Molten metal is ppoured into an open
p face die. codesgivenbelowtheLists:
g
the other end chilled.
chilled The part should be oriented so
2. A punch is advanced into the die, and to the metal. ListI ListII
that the cooling happens over the longest distance.
(CastingProcess) (Applications)
3 Pressure (less than forging) is applied to the punch
3.Pressure 2. Cast
C t metalt l into
i t the
th mold ld
A. Centrifugalcasting 1. Carburetor
and die while the part solidifies. B. Squeezecasting 2. Pipes 3. Solidification will begin at the chill plate. These
4.The
Th punch h is
i retracted,
t t d and d the
th partt is
i knocked
k k d outt C DieCasting
C. Di C i 3. Wh l f
Wheelsfor dendrites will grow towards the heated end of the
with an ejector pin. automobiles
part as long dendritic crystals. The part is slowly
4
4. Gearhousings
y Overcomes problemsbl withh feeding
f d the
h die,
d and
d pulled out of the oven, past the chill plate.
Codes:A B C A B C
produces near net, highly detailed parts. 4. Remove the solidified p
4 part.
(a) 2 3 1 (b) 4 1 3
(c) 2 1 3 (d) 4 3 1

IES2009
l i
PlasterCasting
y Process: A slurry of plaster,
plaster water,
water and various additives is
y Creepandthermalshockresistanceproperties. additives is pouted over a pattern and allowed to set. The
pattern is removed and the mould is baked to remove
excess water. After pouring and solidification, the mould is
broken and the castingg is removed.
y Advantage: High dimensional accuracy and smooth
surface finish,, thin sections and intricate detail can
produce.
y Limitations: Lowertemperature
p nonferrous metals only:y
2marks
y Common metals: Primarily aluminium and copper

PitMoulding IES1996 LoamMoulding


y This method is used for very large castings and is done on Whichofthefollowingpairsarecorrectlymatched?
the foundry floor. 1. Pitmouldingg ..................Forlargejobs.
g j y Moulding
g loam is g
generallyy artificiallyy composed
p of
2. Investmentmoulding ...Lostwaxprocess. common brickclay, and sharp sand.
3 PlastermouldingMouldpreparedin
3. Plastermoulding Mouldpreparedin
gypsum. y Loam means mud.
( ) 1,2and3
(a) d (b) 1and2
d y Loam Moulding is restricted to forms which cannot be
(c) 1and3 (d) 2and3
cast conveniently in any other process.
process

y It is costly.
y
For-2015 (IES, GATE & PSUs) Page 32 of 240 Rev.0
IES1997 GATE1998 GATE1992
Which one of the following pairs is not correctly ListI
Li tI ListII
Li tII Matchthefollowingmoulding/castingprocesseswith
M h h f ll i ldi / i i h
matched? (A) Sandcasting (1) Symmetricaland theproduct:
circularshapesonly Moulding/Castingprocesses Product
(a) Aluminium alloy piston Pressure die casting (B) Plastermouldcasting (2) Partshavehardened (A) Slushcasting (P)Turbineblade
(b) Jewellery.. Lost wax process skinsandsoftinterior
(C) Shellmouldcasting (3) Minimumpost (B) Shellmoulding (Q)Machinetoolbed
(c) Large pipes ..Centrifugal casting castingprocessing (C) Drysandmoulding (R)Cylinderblock
(d) Large
L b ll Loam
bells L moulding
ldi (D) Investmentcasting (4) Partshaveatendency (D) Centrifugalcasting
C t if l ti (S)H ll ti
(S)Hollowcastings
towarp likelampshades
(5) Partshavesoftskin (T)Rainwaterpipe
andhardinterior
(U)Castironshoe
(6) Suitableonlyfornon
f
ferrousmetals
t l brake

GATE1996 IES2003 IES1993


ListI ListII MatchListI(Products)withListII(CastingProcess)andselect
M t hLi tI(P d t ) ithLi tII(C ti P ) d l t MatchtheitemsofListI(Equipment)withtheitems
M h h i fLi I(E i ) i h h i
thecorrectanswerusingthecodesgivenbelowtheLists:
ofListII(Process)andselectthecorrectanswerusing
(A) Rivetsforaircraftbody
y 1. Forging
g g ListI ListII
thegivencodes.
thegivencodes
(Products) (CastingProcess)
(B) Carburettor body 2. Coldheading A. Hollowstatues 1. CentrifugalCasting ListI(Equipment) ListII(Process)
(C) Crankshafts 3
3. Aluminiumbased B
B. Dentures 2
2. InvestmentCasting P HotChamberMachine 1. 1 Cleaning
C. Aluminium alloypistons 3. SlushCasting
alloy Q Muller 2. Coremaking
D. Rockerarms 4. ShellMoulding
(D) Nails
N il 4. P
Pressurediecasting
di ti 5. G i Di C i
GravityDieCasting R DielectricBaker 3
3. Diecasting
5. Investmentcasting Codes: A B C D A B C D S SandBlaster 4. Annealing
((a)
) 33 2 4
4 5 ((b)
) 1 33 4
4 5 5
5. Sandmixing
(c) 1 2 3 4 (d) 3 2 5 4
(a) P2,Q1,R4,S5 (b) P4,Q2,R3,S5
(c) P4,Q5,R1,S2
P 4 Q 5 R 1 S 2 (d) P3,Q5,R2,S1
P 3 Q 5 R 2 S 1

IAS2004 GATE 2007(PI)


GATE 2007 (PI)
MatchListI(NameoftheCastingProcess)withListII(ProcessDefinition)andselect
M hLi I(N f h C i P ) i hLi II(P D fi i i ) d l
Match the lists
thecorrectanswerusingthecodesgivenbelowthelists:
ListI ListII Group1 Group2
(NameoftheCastin Process)
(NameoftheCastingProcess) (ProcessDefinition)
A. Diecasting 1.Thisprocessinvolvesuseofamouldmadeof P.SandCasting 1.Turbineblades
Driedsilicasandandphenolic resinmixture
B
B. El t l casting
Electroslag ti 2.Inthisprocess,moltenmetalisforcedby
I thi lt t li f db Q CentrifugalCasting
Q.CentrifugalCasting 2 ICEnginePistons
2.ICEnginePistons
Pressureintoametalmould
C. Centrifugalcasting 3.Thisprocessemploysaconsumableelectrode R.InvestmentCasting 3.Largebells
D
D. P i i
Precisioncasting
i 4.Thisprocessinvolvesrotatingamouldwhilethe
Thi i l i ld hil h
metalsolidifies S.DieCasting 4.Pulleys
5.Thisprocessproducesverysmooth,highly
Accuratecastingsfrombothferrousandnon
ferrousalloys
(a) P 4, Q 1, R 3, S 2 (b) P 2, Q 4, R 3, S 1
Codes:A
(a) 5
B
4
C
1
D
2 (b)
A
2
B
3
C
4
D
5
((c)) P 3, Q 4, R 1,, S 2 ( ) P 3, Q 2,, R 1,, S 4
(d) BySKMondal
(c) 5 For-2015 (IES, GATE & PSUs)
3 4 2 (d) 2 4 1 5 Page 33 of 240 Rev.0
WeldingDefinition Requirementforahighqualitywelding Cl ifi ti
Classificationofweldingprocesses
f ldi
Oxy fuel gas welding (OFW)
y Welding is a process by which two materials, usually Arc
A welding
ldi (Aw)
(A )
1. A source of satisfactory heat and/or pressure,
metals, are permanently joined together by Resistance welding
coalescence, which is induced by a combination of 2. A means of protecting or cleaning the metal, and Solid
l d state welding
ld (f
(friction welding,
ld ultrasonic
l welding,
ld
temperature, pressure, and metallurgical conditions. forge welding etc.)
3 Caution to avoid,
3. avoid or compensate for,
for harmful
y The particular combination of these variables can y Unique process
g from high
range g temperature with no pressure to highg metallurgical
g effects. Thermit welding
g
pressure with no increase in temperature. Laser beam welding
y Welding (positive process) Electroslag
g welding
g
Flash welding
y Machining (negative process)
Induction welding
y Forming, casting (zero process) Electron beam welding

IES 2012
IES Weldability /FabricationProcesses CaseofAluminium
The advantage of the welding process is y The
Th weldability
ld bilit off a material
t i l will
ill depend
d d on the
th y The
Th oxide
id coating
ti on aluminum
l i alloys
ll causes some
(a) It relieves the joint from residual stresses specific welding or joining process being considered. difficulty in relation to its weldability.
(b) It helps
h l in i checking
h ki off distortion
di t ti off work k piece
i y For resistance welding of consistent quality, it is y It also
l has
h high
hi h thermal
th l conductivity
d ti it and
d a very short
h t
(c) Large number of metals and alloys, both similar and/or usually necessary to remove the oxide immediately temperature range between liquidus and solidus and when
before welding. liquid its viscosity is very low.
low
dissimilar can be joined.
y Aluminium is poor absorber of laser light.
((d)) Heat pproduced during g the welding g does not pproduce y Fabrication weldability y test is used to determine
mechanical properties required for satisfactory y D i
During f i
fusion welding,
ldi the
h aluminum
l i would
ld oxidize
idi so
metallurgical changes.
readily that special fluxes or protective inertgas
performance of welded jjoint.
p
atmospheres must be employed.
employed
y The correct sequence of the given materials in
y Friction welding and TIG welding is good for aluminium.
ascending order of their weldability is
y For aluminium
l AC current plusl high
h h frequency
f is must.
Aluminum < copper < cast iron < MS Contd

CaseofCastIron CaseofStainlessSteel CaseofStainlessSteel


y Cast iron is more difficult to weld because of its high y Stainless steel is a difficult metal to weld because it y The ferritic stainless steels are generally less weldable
carbon content and brittleness (poor ductility) contains both nickel and chromium. than the austenitic stainless steel and require both
y Massive carbon deposits have a tendency to form in y The best method for welding stainless steel is TIG preheating and postweld heat treatments.
treatments
the areas adjacent to the weld, and highcarbon welding. y Welds of ferritic stainless steel can be by
martensite tends to form in the heat
heataffected
affected zones.
zones y The electric arc is also preferred for welding stainless (i) autogenously (i.e.
(i e without the addition of filler
These microstructures are very brittle and may crack steels. A heavily coated welding rod, which produce a metal)
p
spontaneouslyy while welding g is in pprogress
g or later shielded arc,
arc is employed.
employed (ii) with an austenitic stainless steel
when load is applied to the workpiece. y You must do a better job of precleaning. (iii) using a high nickel filler alloy.
y Cast iron can be jjoined byy the oxyacetylene
y y brazingg (iv) Type 405 filler (low 11% Cr, Cr low carbon and small
y Using a low arc current setting with faster travel
process and shielded metalarc welding (stick) speeds is important when welding stainless steel, 0.2% Al)
process. because some stainless steels are subject to carbide y Welding process: TIG, MIG, Shielded
Shieldedmetal
metal arc
y Some cases preheating and/or post heating is required. precipitation. welding and Plasma arc welding
For-2015 (IES, GATE & PSUs) Page 34 of 240 Contd..
Rev.0
IES 2010
IES2010 IES2006 GATE2014
Assertion (A): ( ) It is generally
g y difficult to weld
Aluminum parts by normal arc welding process. Assertion(A):Aluminium
( ) haspoorweldability. The major difficulty during welding of aluminium is
Reason(R):Aluminium hashighthermal
g due to its
Reason (R): Hard and brittle AluminumAluminumoxide
oxide film
is formed at the welded joints. conductivityandhighaffinitytooxygen. (a) high tendency of oxidation
(a) Both A and R are individually true and R is the (a) BothAandRareindividuallytrueandRisthe (b) high thermal conductivity
correct explanation of A correctexplanationofA (c) low melting point
(b) Both
B h A and d R are individually
i di id ll true but
b R is i NOT the
h (b) BothAandRareindividuallytruebutRisnot the (d) low
l density
d it
correct explanation of A correctexplanationofA
(c) A is true but R is false ( ) AistruebutRisfalse
(c) Ai t b tRi f l
((d)) A is false but R is true (d) AisfalsebutRistrue

IES2011 IES2011 IES2006


During plasma arc welding of aluminium,
aluminium improved Considerthefollowingstatements.
Considerthefollowingstatements
Fabricationweldability testisusedtodetermine
removal of the surface oxide from the base metal is Castironisdifficulttoweld,becauseof
obtained with typical polarity of : (a) Mechanicalpropertiesrequiredforsatisfactory
ec a ca p ope t es equ ed o sat s acto y
1.Lowductility
L d tilit
performanceofweldedjoint
(a) DC Straight 2.Poorfusion
(b) Susceptibilityofweldedjointforcracking
(b) DC reverse 3.Tendencytocrackoncooling
(c) Suitabilityforjointdesign
(c) AC potential
p Whichofthesestatementsarecorrect?
(a)1,2and3 (d) Appropriatemachiningprocess
A i hi i
(d) Reverse polarity of phase of AC potential
(b)1and2only
(c)2and3only
(d)1and3only

IES1999 IES 2010


IES2010 IES 2010
IES2010
Weldability of ferritic stainless steel used in Consider the following g statements regarding
g g
Thecorrectsequenceofthegivenmaterialsin automotive exhaust system is improved by welded joints:
g
ascendingorderoftheirweldability is 1 It is a permanent type of joint.
1. joint
selecting stainless steel electrode having low
(a) MS,copper,castiron,aluminium 2. It is reliable and economical for pressure vessel
content of
(b) Castiron,MS,aluminium
Castiron MS aluminium copper construction.
construction
(a) Carbon (b) Nitrogen
(c) Copper,castiron,MS,aluminium 3. It is free from fabricational residual stresses.
(d) Aluminium,copper,castiron,MS
Al i i i S (c) Chromium (d) Carbon and Nitrogen
4. Such joints are suitable for static loading only.
55. Welding g is a versatile and flexible metal jjoining
gpprocess.
Which of the above statements are correct?
(a) 1,
1 2 and 3 only (b) 2,
2 3 and 4 only
For-2015 (IES, GATE & PSUs) Page 35 of 240 (c) 1, 2, 3, 4 and 5 Rev.0
(d) 1, 2 and 5 only
IES 2012
IES IES 2013
IES2013 GasFlameProcesses:
Whichofthefollowingfactorsimproveweldabilityof Weldability dependson Welding Cutting and Straightening
Welding,CuttingandStraightening
steel?
y Oxyfuel gas Welding (OFW): Heat source is the
1 Lowcarboncontent
1.Lowcarboncontent 1.Thermalconductivityy
flame produced
fl d d byb the
h combustion
b i off a fuel
f l gas and
d
2.Highcarboncontent 2.Surfacecondition oxygen.
3.Goodaffinitycontent
3.Changeinmicrostructure
4
4.Pooraffinitytooxygen
y yg y OFW has largely
g y been replaced
p byy other p
processes but
(a)1and3 (b)2and3 (a)1and2only (b)1and3only it is still popular because of its portability and the low
(c)1and4 (d)2and4 p
capital investment.
(c)2and3only (d)1,2and3
y Acetylene is the principal fuel gas employed.
employed

y Combustionofoxygenandacetylene(C2H2)ina Three types of flames can be obtained by varying


weldingtorchproducesatemp.inatwostagereaction. the oxygen/acetylene (or oxygen/fuel gas) ratio.
y Inthefirststage y If the ratio is about 1 : 1 to 1.15 : 1, all reactions are
C2 H2 + O2 2CO + H2 +Heat
H t carried to completion and a neutral flame is produced.
produced
Thisreactionoccursnearthetipofthetorch. y Most welding is done with a neutral flame. It is
y InthesecondstagecombustionoftheCOandH2 and
chemically
h i ll neutral t l and
d neither
ith oxidizes
idi or carburizes
b i
occursjustbeyondthefirstcombustionzone. the metal being welded.
2CO+O2 2CO2+Heat
1
2 2 H2O+Heat
H2 +O
Oxygenforsecondaryreactionsisobtainedfromthe
atmosphere
atmosphere.
Oxyacetylenegasweldingneutralflame

y Excess fuel, on the other hand, produces a carburizing


y A higher ratio, such as 1.5 : 1, produces an oxidizing
flame. Carburizing flame can carburize metal also.
flame hotter than the neutral flame (about 3300oC)
flame,
but similar in appearance. y The excess fuel decomposes to carbon and hydrogen, Metal Flame
p
and the flame temperature is not as g
great ((about MS N
y Used when
hen welding
elding copper and copper alloys
allo s but
3000oC). High carbon steel R
harmful when welding steel because the excess oxygen Grey cast iron N, slightly oxidizing
reacts with the carbon,
carbon decarburizing the region y Flames of this type are used in welding Monel (a
Alloy steel N
around the weld. nickelcopper alloy), highcarbon steels, and some Aluminium Slightly carburizing
alloy steels, and for applying some types of hard
hardfacing
facing Brass Slightly oxidizing
material. Copper, Bronze N, slightly oxidizing
Nickel alloys
y Slightly
g y carburizing g
Lead N

For-2015 (IES, GATE & PSUs)


OxyacetylenegasweldingOxidisingflame Page 36 of 240 Rev.0
OxyacetylenegasweldingCarburizingflame
U
Uses,Advantages,andLimitations
Ad t d Li it ti
y Exposer of the heated and molten metal to the various
y OFW is fusion welding.
welding
gases in the flame and atmosphere makes it difficult to
y No pressure is involved.
y Filler
Fill metal
t l can be
b added
dd d in
i the
th form
f off a wire
i or rod.
d prevent contamination.
contamination

Diagram y Fluxes may be used to clean the surfaces and remove


contaminating oxide. The gaseous shield produced by
y Heat source is not concentrated, a large area of the
metal is heated and distortion is likely to occur.
vaporizing flux can prevent oxidation during welding,
and the slag produced by solidifying flux can protect
y Flame welding is still quite common in field work, in
the weld pool. Flux can be added as a powder, the
welding rod can be dipped in a flux paste, or the rods maintenance and repairs, and in fabricating small
can be precoated.
quantities of specialized products.
products
Contd

Oxyacetyleneweldingequipment IES 2010


IES2010
y Oxygen is stored in a cylinder at a pressure ranging
PressureGasWeldingg The ratio between Oxygen and Acetylene
from 13.8 MPa to 18.2 MPa . y Pressure gas welding (PGW) or Oxyacetylene gases for neutral flame in gas welding is
Pressure Welding is a process used to make butt ( )2:1
(a) (b) 1 : 2
y Due to high explosiveness of free acetylene it is stored joints between the ends of objects such as pipe
y
in a cylinder with 8085% pporous calcium silicate and aandrailroad
d a oad rail.
a . ((c)) 1 : 1 ((d)) 4 : 1
then filled with acetone which absorb upto 420 times y The ends are heated with a gas flame to a
by its volume at a pressure 1.75 MPa . p
temperature below the melting gp
point,, and the soft
y At the time of acetylene release if acetone comes with metal is then forced together under considerable
acetylene
ace y e e thee flame
a e would
ou d g
givee a pu
purple
p e co
colour.
ou . pressure.
y Another option is acetylene generator. y This process, therefore, is actually a 'form of solid
state welding.
CaC2 + 2 H 2O C2 H 2 + Ca (OH ) 2

GATE1994 GATE2003 IES 2010


IES2010
Assertion ((A): ) Oxidizing g flame is used in gasg
InOxyacetylenegaswelding,temperatureatthe welding to join medium carbon steels having high
The ratio of acetylene to oxygen is innerconeoftheflameisaround melting gppoint.
approximately
approximately. for a neutral flames used in
(a) 3500C Reason (R): In gas welding, oxidizing flame
gas welding.
(b) 3200
3200C
C produces the maximum temperature compared to
( ) 1:1
(a)
(c) 2900C neutral and reducing flame.
(b) 1 : 2
(d) 2550C
C (a) Both A and R are individually true and R is the
(c) 1 : 3 correct explanation of A
(d) 1.5
15:1 (b) Both
B th A and d R are individually
i di id ll true
t b t R is
but i NOT the
th
correct explanation of A
(c) A is true but R is false
For-2015 (IES, GATE & PSUs) Page 37 of 240 Rev.0
(d) A is false but R is true
GATE2002 IES2009 IES1998
The temperature of a carburising flame in gas By which one of the following methods gray cast In oxyacetylene gas welding, for complete
welding is that of a neutral or an oxidising flame. iron is usually welded? combustion, the volume of oxygen
g required per
(a) Lowerthan (a) TIGwelding (b) MIGwelding unit of acetylene is
(b) Higherthan (c) Gaswelding (d) Arcwelding ((a)) 1
(c) Equalto (b) 1.5
(d) Unrelatedto
U l t dt (c) 2
(d) 2.5

IAS1994 IAS1995 IES 2012


IES
Statement ((I):
) In g
gas welding g the metal to be jjoined g
gets
In gas welding of mild steel using an oxy Assertion (A):
( ) If neutral flame is used in oxy oxidized or carburized
acetylene welding, both oxygen and acetylene
acetylene flame. the total amount of acetylene cylinders of same capacity will be emptied at the same Statement ((II):
) The neutral flame affects no chemical
consumed was 10 litre. The oxygen consumption time. change on the molten metal.
from the cylinder is Reason (R): Neutral flame uses equal amounts of ((a)) Both Statement ((I)) and Statement ((II)) are
oxygen and d acetylene.
l
(a) 5litre individually true and Statement (II) is the correct
(a) BothAandRareindividuallytrueandRisthecorrect explanation of Statement (I)
(b) 10litre explanationofA
(b) BothAandRareindividuallytruebutRisnot the (b) Both Statement (I) and Statement (II) are
(c) 15litre individually true but Statement (II) is not the correct
correctexplanationofA
(d) 20litre
li (c) AistruebutRisfalse explanation of Statement (I)
(d) AisfalsebutRistrue (c) Statement (I) is true but Statement (II) is false
(d) Statement (I) is false but Statement (II) is true

OxygenTorchCutting(GasCutting) y For thicker plates with specified contour, shearing y Larger size orifice produces kerf width wider and larger
cannot be used and oxyfuel gas cutting (OFC) is oxygen consumed.
y Iron and steel oxidize (burn)
( ) when heated to a
useful. y At kindling temperature (about 870oC), iron form iron
temperature between 8000C to 10000C.
y Gascutting
Gas cutting is similar to gas welding
elding except
e cept torch tip.
tip oxide.
oxide
y Highpressure oxygen jet (300 KPa) is directed against
y Reaction:
a heated steel p
plate, the oxygen
yg jjet burns the metal and
3Fe + 2O2 Fe3O4 +6.67
+6 67 MJ/kg of iron
blows it away causing the cut (kerf).
The other reactions:
y For
o cutt
cuttingg metallic
eta c p plates
ates sshears
ea s aaree used. These
ese aaree
2Fe + O2 2FeO + 3.18 MJ/kgk off iron
useful for straightline cuts and also for cuts up to 40
c ess.
mm thickness. 4Fe + 3O2 2Fe2O3 + 4.9 MJ/kg of iron
y All exothermic reactions preheat the steel.
Fig differencesintorchtipsforgasweldingandgascutting

For-2015 (IES, GATE & PSUs) Page 38 of 240 Rev.0 Contd


Contd Contd
y The drag lines shows the characteristics of the movement y If torch moved too rapidly, the bottom does not get
y For complete oxidation 0.287 m3 oxygen/kg of iron is
of the oxygen stream. sufficient heat and produces large drag so very rough
required
i d
and irregularshapedcut edges.
y Due to unoxidized metal blown away the actual
y If torch moved slowly a large amount of slag is
requirement is much less.
generated and produces irregular cut.
y Torch tipp held verticallyy or slightly
g y inclined in the
direction of travel.
y Torch position is about 1.5
1 5 to 3 mm vertical from plate.
plate
Fig positioningofcuttingtorchinoxy fuelgascutting
y Drag
g is the amount byy which the lower edge
g of the drag
g
line trails from the top edge.
y Good cut means negligible
g g drag.
g

Contd Contd Contd

y Gas cutting is more useful with thick plates. Application


IAS2011Main
y Useful only for materials which readily get oxidized
y For thin sheets (less than 3 mm thick) tip size should Draw a self explanatory sketch of oxyacetylene gas
be small. If small tips are not available then the tip is and
d the
th oxides
id have
h l
lower melting
lti points
i t than
th th
the
cutting torch. Briefly explain how cutting is
inclined at an angle of 15 to 20 degrees. metals.
effected.
y Widely used for ferrous materials.
[ M k ]
[20Marks]
y Cannot be used for aluminum, bronze, stainless steel
and like metals since they resist oxidation.

Fig.Recommendedtorchpositionforcuttingthinsteel

Difficulties y For high carbon steel material around the cut should IES1992
y Metal temperature goes beyond lower critical be preheated (about 250 to 300oC) and may post heat The edge of a steel plate cut by oxygen cutting will
temperature and structural transformations occur. get hardened when the carbon content is
g
also necessary.
necessary
(a) Less than 0.1 percent
y Final microstructure depends on cooling rate. y Cutting CI is difficult, since its melting temp. is lower (b) Less than 0.3
0 3 percent
than iron oxide. (c) More than 0.3 percent
y Steels
St l with
ith less
l th 0.3 % carbon
than b cause no problem.
bl (d) Anywhere
A h b
between 0.1 to 1.0 percent
y If chromium and nickel etc are present in ferrous
alloys oxidation and cutting is difficult.

For-2015 (IES, GATE & PSUs) Page 39 of 240 Rev.0


Contd
IES2007 IES2001 IES1992
Considerthefollowingstatementsinrespectofoxy Oxyacetylenereducingflameisusedwhile Thick steel plate cut with oxygen normally shows
acetylenewelding:
g g
carryingouttheweldingon g of cracking.
signs g This tendency for cracking
g can
1
1. Thejointisnotheatedtoastateoffusion
Thejointisnotheatedtoastateoffusion.
2. Nopressureisused. (a) Mildsteel (b) Highcarbonsteel be minimised by
3 Oxygenisstoredinsteelcylinderatapressureof14
3. (c) Greycastiron (d) Alloysteels ((a)) Slow speed
p cutting
g
MPa. (b) Cutting in two or more stages
4. Whenthereisanexcessofacetyleneused,thereisa
d id d h
decidedchangeintheappearance
i h (c) Preheating the plate
offlame. (d) Using oxyacetylene flame
Whichofthestatementsgivenabovearecorrect?
(a)1,2and3 (b) 2,3and4
(c) 1,3and4
1 3and4 (d) 1,2and4
1 2and4

IES2005 d C i
PowderCutting
y Cast iron,, stainless steel,, and others high
g alloyy steels are ( )
GATE2009(PI)
Considerthefollowingstatements: difficult to cut by oxyfuel cutting and we can use powder
1. Ingaswelding,thetorchshouldbeheldatanangleof g
cutting. Which of the following powders should be fed for
30 to45 fromthehorizontalplane.
f h h l l
y By injecting a finely divided 200mesh iron powder into effective oxyfuel cutting of stainless steel?
2. Ingaswelding,theSizeofthetorchdependsuponthe
thi k
thicknessofmetaltobeformed.
f t lt b f d the flame, a lower melting point eutectic oxide is formed
at the cutting interface, where additional ironoxygen (a) Steel
3. Dragingascuttingisthetimedifferencebetween
heatingoftheplateandstartingtheoxygengasfor reaction is generated and cutting proceeds in a similar
( ) Aluminum
(b)
cutting. way of oxyfuel cutting.
Whichofthestatementsgivenabovearecorrect? y The heat and the fluxing action of the burning iron (c) Copper
(a) 1,2and3 (b) 1and2 powder enable the cutting oxygen stream to oxidize the
(c) 2and3 (d) 1and3 base metal continuously,
continuously just as in cutting carbon steel.
steel (d) Ceramic

Pl C tti
PlasmaCutting El t i A W ldi
ElectricArcWelding
y Uses ionized g
gas jjet (plasma)
p to cut materials resistant to
oxyfuel cutting,
y High
g velocityy electrons g generated byy the arc impact
p gas
g
molecules, and ionize them.
y The ionized g gas is forced through
g nozzle ((upto
p 5500 m/s),
/ ), and
the jet heats the metal, and blasts the molten metal away.
ElectricArcWelding
y More economical,, more versatile and much faster (5 to 8
times) than oxyfuel cutting, produces narrow kerfs and
smooth surfaces.
y HAZ is 1/3 to th than oxyfuel cutting. Fi B i i
Fig.Basiccircuitforarcwelding
i f ldi
y Maximum plate thickness = 200 mm
For-2015 (IES, GATE & PSUs) Page 40 of 240 Rev.0
PrincipleofArc y Work is negative and electrode is positive is reverse ISRO2011
y An arc is generated between cathode and anode when polarity (RPDC).
Inarcwelding,penetrationisminimumfor
g p
th are touched
they t h d to
t establish
t bli h the
th flow
fl off currentt and
d y SPDC conditions are preferred.
then separated
p byy a small distance. (a)DCSP
y DC arcwelding
ldi maintain
i t i a stable
t bl arc and
d preferred
f d for
f
y 65% to 75% heat is generated at the anode. (b)DCRP
difficult tasks such as overhead welding.
g
y If DC is used and the work is positive (the anode of the y For a stable arc, the gap should be maintained. (c)AC
circuit), the condition is known as straight polarity (d)DCEN
(SPDC).
(SPDC)
Contd Contd

y Manual arc welding is done with shielded (covered)


Threemodesofmetaltransferduringarcwelding MajorForcestakepartinMetalTransfer
electrodes (i)gravityforce
(i) it f
y Baremetal wire used in automatic or semiautomatic
machines
machines. (ii)Surfacetension
y Non consumable electrodes (e.g tungsten) is not (iii)electromagneticinteraction
g
consumed d by
b the
h arc andd a separate metall wire is used
d
as filler. (iv)hydrodynamicactionofplasma
y There are three modes of metal transfer (globular,
spray and shortcircuit).

20 0
JWM2010 GATE1993 Arcweldingequipments
Assertion
A ti (A) : Bead
B d is i the
th metal
t l added
dd d during
d i Ind.c.welding,thestraightpolarity(electrode
( 1. Droopers: Constant current welding machines
single pass of welding. negative)resultsin Good for manual welding
g
Reason (R)( ) : Bead material is same as base metal. (a) Lowerpenetration 2. Constant voltage machines
(a) Both A and R are individuallyy true and R is the (b) Lowerdepositionrate Good for automatic welding
correct explanation of A (c) Lessheatingofworkpiece
(b) Both A and R are individually true but R is NOT the (d) Smallerweldpool
S ll ld l
correct explanation of A
(c) A is true but R is false
(d) A is false but R is true

For-2015 (IES, GATE & PSUs) Page 41 of 240 Rev.0


Contd
Formula y Requires
q g current ((150
a large 5 to 1000 A),
), voltage
g is
between 30 and 40 V, actual voltage across the arc
varying from 12 to 30 V.
Fig.Machinewithdifferentsettings y To initiate a weld,
ld the
h operator strike
k the
h electrode
l d and
d
start arc.

V I
+ =1
OCV SCC
Fig.Characteristiccurveofaconstantvoltagearcweldingmachine

IES 2010
IES2010 IES2005 IES2001
In arc welding, the arc length should be equal to Considerthefollowingstatements:
(a) 4.5 times the rod diameter 1. Inarcwelding,65%to75%heatisgeneratedatthe Inmanualarcwelding,theequipmentshould
anode.
(b) 3 times
ti th rod
the d diameter
di t havedroopingcharacteristicsinordertomaintain
2. Dutycycleincaseofarcweldingisthecycleof
(c) 1.5 times the rod diameter
completeweldingofworkpiecefromthe (a) Voltageconstantwhenarclengthchanges
(d) Rod diameter beginning.
3 ArcblowismorecommonwithDCwelding.
3. ArcblowismorecommonwithDCwelding (b) Currentconstantwhenarclengthchanges
Whichofthestatementsgivenaboveare (c) Temperatureintheareconstant
correct?
(d) Weldpoolredhot
(a) 1,2and3 (b) 1and2
(c) 2and3 (d) 1and3

IES2001 IES1998 IAS1999


Inarcwelding,d.c.reversepolarityisusedtobear The voltagecurrent characteristics of a dc Opencircuit voltage of 60 V and current of 160A
g
greateradvantagein
g generator for arc welding
g g is a straight
g line were the welding g conditions for arc welding
g of a
(a) Overheadwelding between an opencircuit voltage of 80 V and short certain class of steel strip of thickness 10 mm. For
(b) Flatweldingoflapjoints circuit current of 300 A. The generator settings for arc welding of 5mm thick strip of the same steel,
maximum arc power will be the welding voltage and current would be
(c) Edgewelding
((a)) 0 V and 150
5 A ((b)) 4
40 V and 3300 A ((a)) 60 V and 80 A
(d) Flatweldingofbuttjoints
l ldi fb j i
(c) 40 V and 150 A (d) 80 V and 300 A (b) 120 V and 160 A
(c) 60 V and 40 A
(d) 120 V and 40 A

For-2015 (IES, GATE & PSUs) Page 42 of 240 Rev.0


IAS1998 GATE2012SameQinGATE2012(PI) GATE 2007(PI)
GATE 2007 (PI)
In
I a DC arc welding ldi operation,
ti the
th voltagearc
lt
The DC power source for arc welding has the
AssumingastraightlineVIcharacteristicsfora characteristic 3V + I = 240, where V = Voltage and
gg
dcweldinggenerator,shortcircuitcurrentas400A length characteristic was obtained as Varc = 20 + 5L
where
h th arc length
the l th L was varied i d between
b t 5 mm I = Current in amp.
amp For maximum arc power at
andopencircuitvoltageas400whichoneofthe
followingisthecorrectvoltageandcurrentsetting and 7 mm. Here Varc denotes the arc voltage in Volts. the electrode, voltage should be set at
formaximumarcpower? Th arc currentt was varied
The i d from
f 400 A to t 500 A. A (a) 20 V (b) 40 V (c) 60 V (d) 80 V
Assuming linear power source characteristic, the
((a)) 4
400Aand100V ((b)) 200Aand200V
open circuit
i it voltage
lt and
d the
th short
h t circuit
i it currentt for
f
(c) 400Aand50V (d) 200Aand50V the welding operation are
( ) 45 V, 450 A
(a) (b) 75 V, 750 A
(c) 95 V, 950 A (d) 150 V, 1500 A

GATE1992 GATE 2014 (PI)


GATE2014(PI) DutyCycle
In an arc welding operation, carried out with a
A low carbon steel plate is to be welded by the manual y The percentage of time in a 5 min period that a
power source maintained at 40 volts and 400
metal arc welding process using a linear V I welding machine can be used at its rated output
characteristic DC Power source. The following data are amperes, the
h consumable
bl electrode
l d melts
l and
d just
j without overloading.
available : fills the gap between the metal plates to be butt
butt y Time is spent
p in setting
g up,
p metal chipping,
pp g cleaning g
OCV of Power source = 62 V and inspection.
welded. The heat transfer efficiency for the process
Short
S o t ccircuit
cu t cu
current
e t = 130
30 A y For
o manual
a ua we
welding
d g a 60% duty cyc
cyclee iss suggested aand
d
Arc length, L = 4 mm is 0.8, melting efficiency is 0.3 and the heat required for automatic welding 100% duty cycle.
T
Traverse speedd off welding
ldi = 15 cm/s
/ to melt
l the
h electrode
l d is
i 20 J/mm
J/ 3. If the
h travell speed
d
Efficiency of heat input = 85% of tthe
o eeelectrode
ect ode iss 4 mm/s,
/s, tthe
e ccrosssectional
oss sect o a aarea,
ea,
Voltage is given as V = 20 + 1.5 L
in mm2, of the weld joint is _______ Contd
Calculate the heat input into the workprice

Electrode
IFS2011 1. NonconsumableElectrodes
What is the maximum output current that can be
2. ConsumableElectrodes
2 drawn at 100% duty cycle from a welding power source
I
Requireddutycycle,Ta = T rated at 600A at 60% duty cycle.
Ia [3 Marks]
[3Marks] NonconsumableElectrodes
Where,T=rateddutycycle Madeofcarbon,GraphiteorTungsten.

I=ratedcurrentattherateddutycycle CarbonandGraphiteareusedforD.C.
b d h df
Io =Maximumcurrentattherateddutycycle Electrodeisnotconsumed,thearclengthremains
constant,arcisstableandeasytomaintain.

For-2015 (IES, GATE & PSUs) Page 43 of 240 Rev.0


Contd
ConsumableElectrodes Consumable electrodes are three kinds: Electrodecoatingcharacteristic
Provides
P id filler
fill materials.
t i l (a)
( ) Bare 1. Provide a protective atmosphere.
Same composition. (b) Fluxed or lightly coated 2. Stabilize the arc.
This requires that the electrode be moved toward or (c) Coated or extruded / shielded 3. Provide a protective slag coating to accumulate
away from the work to maintain the arc and y For automatic welding,
welding bare electrode is in the form of impurities, prevent oxidation, and slow the cooling of
satisfactory welding conditions. the weld metal.
continuous wire (coil).
4
4. Reduce spatter.
spatter
5. Add alloying elements.
6. Affect
ff arc penetration
7. Influence the shape of the weld bead.
8. Add additional filler metal.
Contd

GATE1994 Electrodecoatings 3.DeoxidizingIngredients. Cellulose,Calcium


carbonate,dolo
carbonate,dolo mite,starch,dextrin,woodflour,
Theelectrodesusedinarcweldingarecoated. l. Slag Forming Ingredients. asbestos, mica, silica, graphite,aluminium,ferromanganese.
Thiscoatingisnotexpectedto fluorspar, titanium dioxide, Iron oxide, magnesium
(a) Provideprotectiveatmospheretoweld carbonate, Calcium carbonate and aluminium oxide. 4.BindingMaterials Sodiumsilicate,potassiumsilicate,
(b) Stabilizetheare asbestos.
(c) Addalloyingelements 2. Arc Stabilizing Ingredients. or ionizing agents:
potassium
potass u ssilicate,
cate, TiO
O2 + ZrO
O2 (Rut
(Rutile),
e), M
Mica,
ca, 5.AlloyingConstituentstoImproveStrengthofWeld
(d) Preventselectrodefromcontamination
P t l t d f t i ti
Calcium oxide, sodium oxide, magnesium oxide,
e dspa ((KAI Si3 O8)
feldspar 6.TiO2 andpotassiumcompoundsincreasethemelting
p p g
rateofthebasemetalforbetterpenetration.

7.Ironpowderprovideshigherdepositionrate.
Contd Contd

y The slag is then easily chipped. i d


Binders
y AC arc welding
ld used
d potassium silicate
l binders.
b d
y Coatings are designed to melt more slowly than the
f ll wire.
filler y DC arc welding used sodium silicate binders.
binders

y Potassium
otass u has
as a lower
o e ionization
o at o pote
potential
t a as co
compared
pa ed
with sodium.

For-2015 (IES, GATE & PSUs) Page 44 of 240 Rev.0


Contd
IES2007 IES1997 IES2002
The coating material of an arc welding electrode Assertion (A):
( ) The electrodes of ac arc welding are MatchListIwithListIIandselectthecorrectanswer:
coated with sodium silicate, whereas electrodes used ListI(Ingredients) ListII(Welding
contains which of the following?g for dc arc welding are coated with potassium silicate
binders. f
functions)
i )
1. Deoxidising agent
Reason (R): Potassium has a lower ionization A. Silica 1. Arc stabilizer
2 Arc stabilizing agent
2. potential
i l than
h sodium.
di B. Potassium
i oxalate
l 2. Deoxidizer
idi
3. Slag forming agent (a) Both A and R are individually true and R is the correct C. Ferrosilicon 3. Fluxingagent
explanation of A
S l
Select the
h correct answer using
i the
h code
d given
i b l
below: D. Cellulose 4. Gasformingmaterial
(b) Both A and R are individually true but R is not the
(a) 1, 2 and 3 (b) 1 and 2 only correct explanation of A Codes:A B C D A B C D
(c) 2 and 3 only (d) 1 and 3 only (c) A is true but R is false (a) 3 4 2 1 (b) 2 1 3 4
(d) A is false but R is true (c) 3 1 2 4 (d) 2 4 3 1

WeldingFlux
y g
LowHydrogenElectrode IFS2011
Availableinthreeforms
y The basic coatings contain large amount of Whatismeantbylowhydrogenelectrode?
y Granular calcium
l i carbonate
b t (limestone)
(li t ) and d calcium
l i [
[2marks]
k ]
y Electrodewirecoating fluoride (fluorspar) and produce low hydrogen.
y Electrodecore y But it can absorb
b b moisture therefore
h f coated
d low
l
hydrogen electrodes are backed before use to a
temperature off 200oC to 3000C and d stored
d in an
oven at 110oC to 150oC
y Other types of electrode release large amount of
hydrogen, which can dissolve in the weld metal
and lead to embrittlement or cracking.

Welding Positions
WeldingPositions W ldi C
WeldingCurrent
t WeldingVoltage
y Weldingcurrentdependsupon:thethicknessofthe y Thearcvoltagedependsonlyuponthearclength
weldedmetal,typeofjoint,weldingspeed,positionof
theweld,thethicknessandtypeofthecoatingonthe V=k1 +k2l Volts
electrodeanditsworkinglength.
Fig.Thepositionofelectrodeforhorizontalwelding y Weldingcurrent,I=k.d,amperes;disdia.(mm)
Wherelisthearclengthinmmandk1 andk2 are
constants,
t t
k1 =10to12;andk2 =2to3

TheminimumArcvoltageisgivenby
g g y
For-2015 (IES, GATE & PSUs) Page 45 of 240 Vmin =(20+0.04l)Volt Rev.0
Fig.Positioningofelectrodeforweldinginverticallyupwardposition
ArcLength A long arc results in
y For good welds, a short arc length is necessary, y Large heat
h loss
l into
i atmosphere.
h
because: y Unstable arc.
1. Heat is concentrated. y Weld pool is not protected.
2. More stable y Weld has low strength,
strength less ductility,
ductility poor fusion and
3. More protective atmosphere. excessive spatter.

Contd Fig.ArcPowerVsArcLength

Arclengthshouldbeequaltothediameteroftheelectrodesize G 2002 C i l
GATE2002,Conventional ( )
GATE2010(PI)
Duringg a steadyy g gas metal arc welding g with direct
The
h arc lengthvoltage
l h l characteristic
h off a DC arc is given current electrode positive polarity, the welding current,
by the equation: V = 24 + 4L,
4L where V is voltage in volts voltage and weld speed are 150 A, 30 V and 6 m/min,
respectively. A metallic wire electrode of diameter 1.2
and L is arc length in mm. The static voltampere mm is being fed at a constant rate of 12 m/min. The
d it specific
density, ifi heat
h t and d melting
lti t
temperature
t off the
th
characteristic of the power source is approximated by a wire electrode are 7000 kg/m3, 500 J/kgoC and 1530oC,
Beadwidthshouldbeequaltothreediameteroftheelectrodesize straight
h line
l with
h a no load
l d voltage
l off 80 V and
d a short
h respectively Assume the ambient temperature to be 30oC
respectively.
and neglect the latent heat of melting. Further, consider
circuit current of 600A. Determine the optimum arc that two
twothird
third of the total electrical power is available for
melting of the wire electrode. The melting efficiency (in
length for maximum power. percentage)
p g of the wire electrode is
(a) 39.58 (b) 45.25 (c) 49.38 (d) 54.98

GATE2008 GATE2006
In arc welding of a butt joint, the welding speed is In an arc welding process, the voltage and current
( )
GATE2009(PI)
to be selected such that highest cooling rate is are 25 V and 300 A respectively. The arc heat Autogenous gas tungsten arc welding of a steel
achieved. Melting efficiency and heat transfer transfer efficiency is 0.85 and welding speed is 8
efficiency are 0.5 and 0.7, respectively. The area of mm/sec. The net heat input (in J/mm) is plate is carried out with welding current of 500 A,
the
h weld ld cross section is 5 mm2 and d the
h unit (a) 64 voltage of 20 V, and weld speed of 20 mm/sec.
energy required to melt the metal is 10 J/mm3. If (b) 797
the
h welding
ld power is 2 kW,
k the
h welding
ld speedd in Consider the heat transfer efficiency from the arc
mm/s is closest to (c) 1103
to the weld pool as 90%. The heat input per unit
(a) 4 (b) 14 (c) 24 (d) 34 (d) 79700
length (in KJ/mm) is

For-2015 (IES, GATE & PSUs) Page 46 of 240 (a) 0.25 (b) 0.35 (c) 0.45 (d) 0.55
Rev.0
Example ArcblowinDCarcwelding
y Arc blow occurs during
g the welding
g of magnetic
g
Calculate the melting efficiency in the case of materials with DC.
arcweldingg of steel with a p
potential of 20 V and y The effect of arc blow is maximum when welding
g
a current of 200 A. The travel speed is 5 mm/s corners where magnetic field concentration is
and .the
the cross
crosssectional
sectional area of the joint is 20 maximum.
2 y The effect is particularly noticeable when welding with
mm . Heat required to melt steel may be taken
bare electrodes or when using currents below or above
as 10 J/mm3 and the heat transfer efficiency as y Again the problem of arc blow gets magnified when
0.85. welding highly magnetic materials such as Ni alloys,
because of the strong magnetic fields set up by these
metals.
y Cause: Unbalanced magnetic forces.
Contd Contd

Effectofarcblow The effects of arc blow can be minimized with D.C. IES2001
welding by
y Low heat penetration. Arcblowismorecommonin
y Shortening the arc.
y Excessive weld spatter.
p (a) A.C.welding
.C. e d g
y Reduce
R d currentt
y Pinch effect in welding is the result of electromagnetic (b) D.C.weldingwithstraightpolarity
y Reducing weld speed.
forces (c) D.C.weldingwithbareelectrodes
D C elding ithbareelectrodes
y Balance magnetic field by placing one ground lead at
y Weld spatter occurs due to (d) A.C.weldingwithbareelectrodes
each end of the work piece.
High
Hi h welding
ldi currentt
y Wrapping the electrode cable a few turns around the
Too small an electrode arc
work piece.
p

Contd

IES 2013
IES2013
Statement (I): The deflection of Arc from its intended IES2001 ISRO2006
path is called Arc
Arc blow.
blow Too
T high
hi h welding
ldi currentt ini arc welding
ldi would ld result
lt in
i
Pincheffectinweldingistheresultof
Statement (II): The chances of Arc blow is common in (a) Excessive spatter, under cutting along edges, irregular
(a) Expansionofgasesinthearc
pa s o o gases t e a c
A C Arc
A.C. A welding.
ldi deposits, wasted electrodes
(b) Electromagneticforces
(a) Both Statement (I) and Statement (II) are individually (b) Excessive ppiling
g up
p of weld metal, ppoor p
penetration,
true and Statement (II) is the correct explanation of (c) Electricforce
wasted electrodes
Statement (I) (d) Surfacetensionofthemoltenmetal
(c) Too small bead, weak weld and wasted electrodes
(b) Both Statement (I) and Statement (II) are individually (d) Excessive piling up of weld metal, overlapping
true but Statement ((II)) is not the correct explanation
p of without penetration of edges,
edges wasted electrodes
Statement (I)
(c) Statement (I) is true but Statement (II) is false
(d) Statement For-2015
(I) is false(IES, GATE & PSUs)
but Statement (II) is true Page 47 of 240 Rev.0
Gasshields y Helium, most expensive, has a better thermal CarbonArcwelding
y An inert gas is blown into the weld zone to drive away conductivity, is useful for thicker sheets, copper and y Arc is produced between a carbon electrode and the
other
th atmospheric
t h i gases. aluminium welding,
welding higher deposition rate.
rate work.
k

y Gases are argon,


argon helium,
helium nitrogen,
nitrogen carbon dioxide and y The arc in carbon dioxide shielding
g g
gas is unstable, y Shielding is not used.
used
a mixture of the above gases. least expensive, deoxidizers needed.
y No pressure
p
y Argon ionizes easily requiring smaller arc voltages.It is y It is a heavy gas and therefore covers the weld zone
y With or without filler metal
good for welding thin sheets. very well.
ll
y May be used in "twin arc method", that is, between
two carbon (graphite) electrodes.
Contd

IES 2010
IES2010 TungstenInertGaswelding(TIG) y Very clean welds.
Assertion ((A): ) g
Straight p y is always
polarity y
y Arc is established between a nonconsumable y All metals and alloys can be welded.
welded (Al,
(Al Mg also)
recommended for Carbonelectrode welding.
tungsten electrode and the workpiece.
Reason (R): Carbon arc is stable in straight polarity. y Straight polarity is used.
y Tungsten is alloyed with thorium or zirconium for
(a) Both A and R are individually true and R is the
better currentcarrying y g and electronemission y Weld voltage 20 to 40 V and weld current 125 A for
correct explanation of A
characteristics.
(b) Both A and R are individually true but R is NOT the RPDC to 1000 A for SPDC.
y Arcc length
e gt iss coconstant,
sta t, aarcc iss stab
stablee aand
d easy to
correct explanation
l i off A
maintain. y Shielded Gas: Argon
(c) A is true but R is false
y With or without filler.
filler
(d) A is false but R is true y Torch
h is water or air cooled.
l d

Contd

GATE2011 IES 2010


IES2010
Whichoneamongthefollowingweldingprocesses In an inert g gp
gas welding process,, the commonly
y used
usednon consumableelectrode? gas is
( )G t l ldi
(a)Gasmetalarcwelding (a) Hydrogen
(b)Submergedarcwelding (b) Oxygen
(c)Gastungstenarcwelding ( ) Helium
(c) H li or Argon
A
(d)Fluxcoatedarcwelding (d) Krypton

For-2015 (IES, GATE & PSUs)


Fig.TIG Page 48 of 240 Rev.0
GATE2002 IES1994
ISRO2009 Whichofthefollowingarcweldingprocessesdoes Whichoneofthefollowingweldingprocesses
Following gases are used in tungsten inert notuseconsumableelectrodes? usesnon consumableelectrodes?
gas welding
ldi (a) GMAW (a) TIGwelding
(a) CO2 and H2 (b) GTAW (b) MIGwelding
(b) Argon and neon (c) SubmergedArcWelding (c) Manualarcwelding
(c) Argon and helium (d) Noneofthese
N fth (d) Submergedarcwelding.
S b d ldi
(d) Helium and neon

IES2013
Statement ((I):
) Non consumable electrodes,, used in arc
IES2000 welding are made of high melting point temperature GasMetalArcWelding(GMAW)orMIG
materials,, even then the length g of electrode g goes on
Whichoneofthefollowingstatementsiscorrect? decreasing with passage of time. y A consumable electrode in a gas shield.
(a) Nofluxisusedingasweldingofmildsteel
o u s used gas e d g o d stee Statement (II): The electrode material gets oxidized y Arc is between workpiece
p and an automaticallyy fed
(b) Boraxisthecommonlyusedfluxcoatingon and melts on the weld material to form a strong flux. barewire electrode.
weldingelectrodes (a) Both Statement (I) and Statement (II) are individually y Argon, helium, and mixtures of the two can be used.
(c) Laserbeamweldingemploysavacuumchamber true and Statement (II) is the correct explanation of y Any metal can be welded but are used primarily with
andthusavoidsuseofashieldingmethod Statement (I) the nonferrous metals.
metals
(d) ACcanbeusedforGTAWprocess (b) Both Statement (I) and Statement (II) are individually y When welding steel, some O2 or CO2 is usually added
true but
b Statement
S (II) is
i not the
h correct explanation
l i off t improve
to i th arc stability
the t bilit and
d reduce
d weld
ld spatter.
tt
Statement (I)
(c) Statement (I) is true but Statement (II) is false
(d) Statement (I) is false but Statement (II) is true Contd

IES2007
InMIGwelding,themetalistransferredintothe
y Fast and economical. g
formofwhichoneofthefollowing?
y A reversepolarity
l d arc is generally
dc ll used
d because
b (a) Afinesprayofmetal
of its deep penetration, spray transfer, and ability
to produce
d smoothh welds
ld withh good
d profile.
fl (b) Moltendrops
(c) Weldpool
(d) Molecules
l l

For-2015 (IES, GATE & PSUs) Page 49 of 240 Rev.0


Fig.MIG
IES1997 IES 2013
IES2013 IES 2010
IES2010
g statements:
Consider the following ( ) g
Assertion(A):Inertgasandbareelectrodeinstead
Considerthefollowingstatements: offluxcoatedelectrodeisusedinthecaseof
In metal are welding
MIGweldingprocessuses
gp gp
automaticTIGandMIGweldingprocesses.
1.Consumableelectrode2. nonconsumableelectrode 1. Utilizes a consumable electrode
Reason(R):Betterprotectionisprovidedbyacloud
3.D.C.powersupply 4.A.C.powersupply 2. A welding torch used is connected to acetylene gas ofinertgasthanthecovercreatedbytheflux.
Ofthesestatements supply (a) Both A and R are individually true and R is the
(a) 2and4arecorrect 3. The
Th electrode
l t d and d workpiece
k i are connected
t d to
t the
th correct explanation of A
(b) 2and3arecorrect welding power supply (b) Both A and R are individually true but R is NOT the
( ) 1and4arecorrect
(c) d Which of these statements are correct? correctt explanation
l ti off A
(d) 1and3arecorrect (c) A is true but R is false
(a) 1,
1 2 and 3 (b) 1 and 2 only
(d) A is false but R is true
(c) 1 and 3 only (d) 2 and 3 only

IES 2012
IES SubmergedArcwelding(SAW)
() C p y
Statement(I):DCwithreversepolarityisusedinMIGG
welding y A thick layer of granular flux is deposited just ahead of y Most suitable
bl for
f flat
fl butt
b or fillet
f ll welds
ld in low
l
( ) p y
Statement(II):UseofDCwithreversepolarityenables carbon steel (< 0.3% carbon).
a bare
b wire
i consumable
bl electrode,
l t d and d an arc is
i
deeperpenetrationandacleanSurface
((a)) Both Statement ((I)) and Statement ((II)) are maintained beneath the blanket of flux with onlyy a few y The process is not recommended for highcarbon
g
individually true and Statement (II) is the correct
small flames being visible. steels, tool steels, aluminum, magnesium,
explanation of Statement (I)
(b) Both Statement (I) and Statement (II) are y A portion of the flux melts. Molten flux and flux titanium, lead, or zinc.
individually true but Statement (II) is not the correct
explanation of Statement (I) provides thermal insulation, slows cooling rate and
(c) Statement (I) is true but Statement (II) is false produce soft,
soft ductile welds.
welds
(d) Statement (I) is false but Statement (II) is true
Contd

Characteristicofsubmergedarcwelding Advantages
y Highspeeds, y Wireelectrodesareinexpensive.

y Highdepositionrates, y Noweldspatter.

y Deeppenetration,
Deeppenetration y Nearly100%depositionefficiency.
Nearly100%depositionefficiency

y Highcleanliness(duetothefluxaction). y Lesserelectrodeconsumption.

For-2015 (IES, GATE & PSUs) Page 50 of 240 Rev.0


Limitations IES2011 IES2006
The welding process in which bare wire is used as
y Extensive flux handling, Inwhichofthefollowingweldingprocesses,flux
electrode, granular flux is used and the process is
g
isusedintheformofgranules?
y Contamination of the flux by moisture.
characterized by its high speed welding,
welding is known as:
(a) ACarcwelding
(a) Shielded arc welding
y Largegrainsize
Large grain size structures.
structures (b) Submergedarcwelding
(b) Plasma arc welding
(c) Argonarcwelding
y Welding is restricted to the horizontal position. (c) Submerged
g arc welding g
(d) DCarcwelding
C ldi
(d) Gas metal arc welding
y Chemical control is important

IES2005 IES2008 GATE1999


Whichofthefollowingarethemajor Assertion (A):( ) Submerged arc welding is not For butt welding 40 mm thick steel plates, when
characteristicsofsubmergedarcwelding? recommended for high carbon steels, tool steels, the expected quantity of such jobs is 5000 per
aluminium, magnesium etc.
1. Highweldingspeeds. Reason (R): This is because of unavailability of month over a period of 10 year, choose the best
2. Highdepositionrates. suitable fluxes, reactivity at high temperatures and suitable welding process out of the following
l
low sublimation
bli i temperatures. available
l bl alternatives.
l
3. Lowpenetration.
(a) Both A and R are true and R is the correct explanation
4. Lowcleanliness.
4 of A (a) Submerged
g arc welding
g
Selectthecorrectanswerusingthecodegivenbelow: (b) Both A and R are true but R is NOT the correct (b) Oxyacetylene welding
(a) 2and3 (b) 1,2and3
1 2and3 explanation of A
(c) Electron beam welding
(c) A is true but R is false
(c) 3and4 (d) 1and2 (d) A is false but R is true (d) MIG welding

AtomicHydrogenwelding(AHW) IES2005
y Temperature
p 3700oC.
of about 37
y An
A a.c. arc is
i formed
f d between
b two tungsten electrodes
l d Inatomichydrogenwelding,hydrogenactsas
along which streams of hydrogen are fed to the y Hydrogen acts as shielding also.
welding zone.
zone The molecules of hydrogen are (a) Aheatingagent
eat g age t
dissociated by the high heat of the arc in the gap y Used for very thin sheets or small diameter wires. (b) Oneofthegasestogeneratetheflame
between the electrodes.
electrodes The formation of atomic (c) Aneffectiveshieldinggasprotectingtheweld
Aneffecti eshieldinggasprotectingthe eld
hydrogen proceeds with the absorption of heat: y Lower thermal efficiency than Arc welding.
(d) Alubricanttoincreasetheflowcharacteristicsof
H2 = 2H 421.2
421 2 k J / mol
y Ceramics may be arc welded. weldmetal
ld l
y This atomic hydrogen recombines to form molecular
hydrogen outside the arc, particularly on the relatively y AC used.
used
cold surface of the work being welded, releasing the
heat g
gained ppreviously:
y
H2 + 421.2
2H =For-2015 k J GATE
(IES, / mol. & PSUs) Page 51 of 240 Rev.0
Contd
ResistanceWelding
y They are not officially classified as solidstate welding
Principle
y Both heat and pressure are used. by the American Welding Society.
ResistanceWelding y Heat is generated by the electrical resistance of the y Very rapid and economical.
work pieces and the interface between them.
y Pressure is supplied externally and is varied y Extremely
l well
ll suited
d to automated
d manufacturing.
f
g
throughout the weld cycle.
y
y No filler metal,
metal no flux,
flux no shielding gases.
gases
y Due to pressure, a lower temperature needed than
oxyfuel
oxy fuel or arc welding.

BySKMondal Contd Contd

y Overall resistance very low.

y Very highcurrent (up to 100,000 A)

y Very lowvoltage
l l (
(0.5 to 10 V)) is
i used.
d

Fig. The desired temperature Fig.


g Typical
yp current and
distribution across the pressure cycle for resistance
electrodes and the work welding. The cycle includes
pieces in lap resistance forging and post heating
welding. operations. Fig. The arrangement of the electrodes and the work in spot
FIG.Thefundamentalresistanceweldingcircuit welding, showing design for replaceable electrode tips.

Advantages Limitations
IES2007
1. Very rapid. 1. High initial cost.
What is the principle of resistance welding?
2. Fully automation possible. 2. Limitations to the type of joints (mostly lap joints).
Indicate where the resistance is maximum in spot
welding operation. 3 Conserve material; no filler metal,
3. metal shielding gases,
gases or 3 Skilled maintenance personne1 are required:
3.
flux is required.
q 4. special surface treatment needed.
[
[2marks]
k ]
4. Skilled operators are not required.

5.Dissimilar metals can be easily joined.

For-2015 (IES, GATE & PSUs) 6. High reliability and High


Page 52reproducibility.
of 240 Rev.0
Application Differenttypes Resistancespotwelding
y The process description given so far is called resistance
y The resistance welding processes are among the 1. Resistance spot welding
spot welding (RSW) or simply spot welding.
most common technique for high volume 2. Resistance seam welding y This is essentially done to join two sheetmetal jobs in
joining. p jjoint, forming
a lap g a small nugget
gg at the interface of
3 Projection welding
3.
the two plates.
4. Upset welding

5. Flash welding

6. Percussion welding

HeatinputandEfficiencyCalculations Electric Resistance Welding


IES2003
Inresistancewelding,heatisgeneratedduetothe
JJoules law applicable
pp resistancebetween
Q = I2 Rt, Joules (a) Electrodeandworkpiece
(b) Asperitiesbetweentouchingplates
(c) Twodissimilarmetalsbeingincontact
(d) Interatomicforces
i f

Contd

IES2001 GATE2007 GATE2009(PI)LinkedS1


Two metallic sheets,, each of 2.0 mm thickness,, are welded in a lap
p jjoint Resistance spot welding of two steel sheets is carried out in
configuration by resistance spot welding at a welding current of 10 kA
Themaximumheatinresistanceweldingisatthe and welding time of 10 millisecond. A spherical fusion zone extending lap joint configuration by using a welding current of 3 kA and
up to the full thickness of each sheet is formed. The properties of the gg of volume 20 mm3
a weld time of 0.2 S. A molten weld nugget
(a) Tipofthepositiveelectrode
p o t e pos t e e ect ode metallic sheets are given as:
(b) Tipofthenegativeelectrode ambient temperature = 293 K is obtained. The effective contact resistance is 200
melting temperature = 1793 K (microohms). The material properties of steel are given as:
(c) Topsurfaceoftheplateatthetimeofelectric l t t heat
latent h t off fusion
f i = 300 kJ/kgkJ/k
(i) latent heat of melting: 1400 kJ/kg, (ii) density: 8000
density = 7000 kg/m3
contactwiththeelectrode specific heat = 800 J/kg K kg/m3, (iii) melting temperature: 1520oC, (iv) specific heat:
(d) InterfacebetweenthetwoplatesbeingJoined
f b h l b i i d Assume: kJ/k oC.
0.5 kJ/kg C The
Th ambient
bi i 20oC.
temperature is C
(i) Contact resistance along sheetsheet interface is 500 microohm and
along electrodesheet interface is zero; Heat (in Joules) used for producing weld nugget will be
( ) No conductive heat loss through the bulk sheet materials; and
(ii) (
(assuming 100%
% heat
h transfer
f efficiency)
ff )
(iii) The complete weld fusion zone is at the melting temperature.
The meltingg efficiencyy (in %) of the p
process is (a) 324 (b) 334 (c) 344 (d) 354
(a) 50.37 (b) 60.37 (c) 70.37 (d) 80.37
For-2015 (IES, GATE & PSUs) Page 53 of 240 Rev.0
GATE2009(PI)LinkedS2 GATE2005 GATE2001
Resistance spot welding of two steel sheets is carried out in
lap joint configuration by using a welding current of 3 kA and Spot welding of two 1 mm thick sheets of steel Resistance spot welding is performed on two
gg of volume 20 mm3
a weld time of 0.2 S. A molten weld nugget (density = 8000 kg/m3) is carried out successfully plates of 1.5 mm thickness with 6 mm diameter
is obtained. The effective contact resistance is 200 by passing a certain amount of current for 0.1 electrode, using 15000 A current for a time
(microohms). The material properties of steel are given as: second through the electrodes. The resultant weld duration of 0.25 seconds. Assuming the interface
(i) latent heat of melting: 1400 kJ/kg, (ii) density: 8000 nugget formed
f d is 5 mm in diameter
d andd 1.5 mm resistance to be
b 0.0001 , the
h heat
h generated
d to
kg/m3, (iii) melting temperature: 1520oC, (iv) specific heat: thick. If the latent heat of fusion of steel is 1400 form the weld is
kJ/k oC.
0.5 kJ/kg C The
Th ambient
bi i 20oC.
temperature is C k k and
kJ/kg d the
h effective
ff resistance in the
h welding
ld (a) 5625 Wsec (b) 8437 Wsec
Heat (in Joules) dissipated to the base metal will be operation in 200 , the current passing through (c) 22500
5 Wsecsec (d) 3375
33750 Wsec
sec
(
(neglecting
l all
ll other
h heat
h l
losses)
) the
h electrodes
l d is approximately l
(a) 10 (b) 16 (c) 22 (d) 32 (a) 1480A (b) 3300 A
(c) 4060 A (d) 9400 A

GATE2004 GATE1992 GATE2010


Two 1 mm thick steel sheets are to be spot welded For resistance spot welding of 1.5 mm thick steel Two pipes of inner diameter 100 mm and outer
at a current of 5000 A. Assuming effective sheets, the current required is of the order of diameter 110 mm each joined by flash butt
resistance to be 200 microohms and current flow (a) 10 A welding using 30 V power supply. At the interface,
time of 0.2 second, heat generated during the (b) 100 A 1 mm of material melts from each pipe which has
process willll be
b a resistance off 42.4 . Iff the
h unit melt
l energy is
(c) 1000 A 64.4 MJm3, then time required for welding in
(a) 0.2 Joule (b) 1 Joule
(d) 10,000 A seconds
d is
(c) 5 Joule (d) 1000 Joules
(a) 1 (b) 5 (c) 10 (d) 20

GATE2014 IES 2007 C ti l


IES2007Conventional GATE 2008(PI)
Two steel sheets of thickness one mm are welded
For
F spott welding
ldi off two
t steel
t l sheets
h t (base
(b metal)
t l) each
h off by resistance projection welding technique. A Aluminum strips of 2 mm thickness are joined together
3 mm thickness,, welding
g current of 10000 A is applied
pp current of 30,000 A for 0005 second is made to by resistance spot welding process by applying an
flow. The effective resistance of joint can be taken electric current of 6000 A for 0.15 sec. The heat required
for 0.2 s. The heat dissipated to the base metal is 1000 J. as 100 micro ohms. The joint can be considered as for meltingg aluminum is 2.9 J/mm3. The diameter and
9 J/
Assuming that the heat required for melting 1 mm3 a cylinder of diameter 5 mm and height 15 mm.
the thickness of weld nugget are found to be 5 mm and
The density of steel is 000786 gm/mm3. The heat
volume
l off steel
t l is
i 20 J and
d interfacial
i t f i l contact
t t resistance
i t needed for welding steel is 10 J/mm3. Calculate the 2 5 mm,
2.5 mm respectively.
respectively Assuming the electrical resistance
between sheets is 0.0002,, the volume ((in mm3) of weld efficiency of welding. [20] to be 75 (micro ohms), the percentage of total
energy utilized in forming the weld nugget is
nugget is .
(a) 28 (b) 35 (c) 65 (d) 72
For-2015 (IES, GATE & PSUs) Page 54 of 240 Rev.0
IAS2003 Resistanceseamwelding y Welding current is a bit higher than spot welding, to
compensate short circuit of the adjacent weld.
Assertion (A):
( ) Spot welding is adopted to weld two
overlapped metal pieces between two electrode y Weld is made between overlapping sheets of metal. y In other process a continuous seam is produced by
points. passing a continuous current through the rotating
Th seam is
The i a series
i off overlapping
l i spott welds.
ld
Reason (R): In this process when current is switched electrodes with a speed of 1.5 m/min for thin sheet.
on, the lapped pieces of metal are heated in a
restricted
i d area. y The basic equipment is the same as for spot welding.
welding
(a) Both A and R are individually true and R is the correct except that the electrodes are now in the form of
explanation of A
(b) Both A and R are individually true but R is not the rotating disks.
correct explanation of A
(c) A is true but R is false y Timed pulses of current pass to form the overlapping
(d) A is false but R is true
welds.
welds
Contd Contd

Projectionwelding
( )
GATE 2012(PI) y Limitations of spot welding.
In resistance seam welding, the electrode is in the 1. Electrode condition must be maintained
f
form off a continually, and only one spot weld at a time.
(a) cylinder 2. For additional strength multiple welds needed.
(b) flat plate y Projection welding (RPW) overcomes above
((c)) coil of wire limitations.
limitations
(d) circular disc

Fig.Resistanceseamwelding
Contd

y Dimples are embossed on work pieces at the weld


y Projections are pressformed in any shape.
Upsetwelding
locations and then p g
placed between largearea
electrodes, and pressure and current applied like spot y Multiple welds at a time. y Made butt joint compared to lap joint.
welding.
g
y Current flows through the dimples and heats them y No indentation mark on the surface. y Pieces are held tightly and current is applied.
and pressure causes the dimples to flatten and form a y Due to pressure joints get slightly upset and hence its
y Bolts and nuts can be attached to other metal parts.
weld.
name.

Fig.Principleof y Useful for joining rods or similar pieces.


projectionwelding,
j ti ldi
(a)priortoapplicationof
currentandpressure
( )
(b)andafterformationof
For-2015 (IES, GATE &welds
PSUs) Page 55 of 240 Rev.0
Contd Contd
y This is the process used for making electric resistance FlashWelding
welded (ERW) pipes starting from a metal plate of suitable
thickness. y It is similar to upset welding except the arc rather than
y The plate is first formed into the shape of the pipe with the resistance
i t h ti
heating.
help of the three roll set as shown in Fig. above. The ends
of the p
plate would then be forming g the butt jjoint. y One pieces is clamped with cam controlled movable
y The two rotating copper disc electrodes are made to
contact the two ends of the p plate through g which the platen and other with is fixed platen.
current is passed. The ends get heated and then forge
welded under the p pressure of the rolls.
y The ends of the pieces to be upset welded must be perfectly
parallel. Anyy high
p g spots
p if p
present on the ends would g get
melted first before the two ends are completely joined.
Contd Contd

y Two pieces are brought together and the power supply is PercussionWelding
switched on. Momentarilyy the two p p
pieces are separated
to create the arc to melt the ends of the two pieces. y Similar to flash welding except arc power by a rapid
g
Then again the p
pieces are brought
g together
g and the
discharge of stored electrical energy.
energy
power switched off while the two ends are fused under
force. Most of the metal melted would flash out y The arc duration is only
y 1 to 10 ms, heat is intense and
through the joint and forms like a fin around the joint. highly concentrated.
y Faster than upset welding.
y Small weld metal is produced, little or no upsetting, and
low HAZ.
HAZ

y Application: Butt welding of bar or tube where heat


damage is a major concern.
Contd

Thermit Welding y Temp. 2750C produced in 30 seconds, superheating

y Heating and coalescence is by superheated molten the molten iron which provide both heat and filler

OtherWelding metal
t l obtained
bt i d from
f a chemical
h i l reaction
ti
metal oxide and a metallic reducing
b t
between
g agent.
g
a metal.
metal

y Runners and risers are provided like casting.


Technique
h i y Used mixture one part aluminum and three parts iron y Copper, brass, and bronze can be welded using a
oxide and ignited by a magnesium fuse. (1150C). different starting mixture.
8Al+3Fe3O4 9Fe+4Al2O3 +heat y Used to joint thick sections, in remote locations.

For-2015 (IES, GATE & PSUs) Page 56 of 240 Rev.0


Contd
IES2000 ElectroSlagWelding y A 65mm deep layer of molten slag, protect and
Considerthefollowingprocesses: y Very effective for welding thick sections. cleanse the molten metal.
1. Gaswelding
2. Thermit welding y Heat is derived from the passage of electrical current y Watercooled
W l d copper molding
ldi plates
l confined
fi d the
h
33. Arcwelding g through a liquid slag and temp.
temp 1760
1760C
C liquid and moved upward.
4. Resistancewelding
y Multiple electrodes are used to provide an adequate
Thecorrectsequenceoftheseprocessesinincreasing
orderoftheirweldingtemperaturesis supply of filler.
(a) 1,3,4,2
1 3 4 2 (b) 1,2,3,4
1 2 3 4
(c) 4,3,1,2 (d)4,1,3,2

Contd Contd

y Applications: Shipbuilding, machine manufacture, IAS2003


heavy pressure vessels, and the joining of large Whichoneofthefollowingisnotanelectric
castings and forgings.
forgings g
resistancemethodofwelding?
(a) Electroslagwelding
y Slow cooling
gpproduces a coarse g
grain structure. (b) Percussionwelding
y Large HAZ. (c) Seamwelding
(d) Flashwelding
l h ldi

Contd

IAS2000 ElectronBeamWelding
Considerthefollowingweldingprocesses: y A beam of electrons is magnetically focused on the
1.. TIGwelding
G ed g 2.. Sub
Submergedarcwelding
e ged a c e d g
work
k piece
i i a vacuum chamber.
in h b
3. Electroslagwelding4. Thermit welding
Whichofthese eldingprocessesareusedfor elding
Whichoftheseweldingprocessesareusedforwelding y Heat of fusion is produced by electrons decelerate.
decelerate
thickpiecesofmetals?
y Allows precise
p beam control and deep
p weld
( ) 1,2and3
(a) d (b) 1,2and4
d
penetration.
(c) 1,3and4 (d) 2,3and4
y No shield gas (vacuum chamber used)

For-2015 (IES, GATE & PSUs) Page 57 of 240 Rev.0


IES2004 IES2002 IES1993
Assertion (A): In electron beam welding process, Inwhichoneofthefollowingweldingtechniques Electronbeamweldingcanbecarriedoutin
vacuum is an essential process parameter isvacuumenvironmentrequired? (a) Ope
Openair
a
Reason (R): Vacuum provides a highly efficient (a) Ultrasonicwelding
shield on weld zone (b) Ashieldinggasenvironment
(b) Laserbeamwelding (c) Apressurizedinertgaschamber
Apressuri edinertgaschamber
(a) Both A and R are individually true and R is the
correct explanation of A (c) Plasmaarcwelding (d) Vacuum
(b) Both A and R are individually true but R is not the (d) Electronbeamwelding
l b ldi
correct explanation of A
(c) A is true but R is false
(d) A is false but R is true

IAS2004 LaserBeamWelding y Very thin HAZ and little thermal distortion.


Whichoneofthefollowingweldingprocesses y Used a focused laser beam provides power intensities y Filler metal and inert gas shield may or may not used.
consistsofsmallerHeatAffectedZone(HAZ)?
in kW/ 2
i excess off 10kW/cm y Deep penetration.
(a) Arcwelding (b) Electronbeamwelding
(c) MIGwelding (d) Thermit welding y The high
highintensity
intensity beam produces a very thin column y No
N vacuum needed.
d d
of vaporized metal with a surrounding liquid pool.
y No direct contact needed.
needed
y Depthtowidth ratio greater than 4: 1.

Contd Contd

y Heat input is very low, often in the range 0.1 to 10 J. IES2007 IES2006
Considerthefollowingstatementsinrespectofthe Whichoneofthefollowingweldingprocesses
y Adopted by the electronics industry.
laserbeamwelding: consistsofminimumheataffectedzone(HAZ)?
y Possible to weld wires without removing the 1. Itcanbeusedforweldinganymetalortheir
I b df ldi l h i
combinationsbecauseofveryhightemperatureofthe (a) ShieldedMetalArcWelding(SMAW)
polyurethane insulation.
insulation focalpoints.
focalpoints (b) LaserBeamWelding(LBW)
2. Heataffectedzoneisverylargebecauseofquick (c) UltrasonicWelding(USW)
heating.
(d) MetalInertGasWelding(MIG)
l G ldi ( G)
3. Highvacuumisrequiredtocarrytheprocess.
Whichofthestatementsgivenaboveis/arecorrect?
(a) 1and2only (b) 2and3only
(c) 1only (d) 1,2and3
For-2015 (IES, GATE & PSUs) Page 58 of 240 Rev.0
Contd
GATE2012(PI) IAS2007 IAS1999
Which of the following welding processes results in Consider the following welding processes: Match List I (Shielding
( method)) with List II (Welding
(
process) and select the correct answer using the codes
the smallest heat affected zone? 1.. Arcc welding
ed g 2.. MIG
G welding
ed g given below the lists:
g
(a) Shielded metal arc welding List I List II
3. Laser beam welding 4. Submerged arc
A. Flux coating 1. Gas metal arc welding
(b) Gas welding welding B
B. Fl granules
Flux l 2. S b
Submerged d arc welding
ldi
(c) Laser beam welding Select the correct sequence in increasing order of Heat C. CO2 3. Shielded metal arc welding
affected zone (HAZ) using the code D Vacuum
D. 4
4. Laser beam welding
(d) Thermit
h i welding
ldi
5. Electron beam welding
given below: Codes:A B C D A B C D
(a) 1 2 3 4 (b) 1 4 2 3 (a) 1 2 5 3 (b) 1 4 2 5
(c) 3 5 1 4 (d) 3 2 1 5
((c)) 3 2 4 1 ((d)) 4 3 2 1

ForgeWelding FrictionWelding
y Machine is similar to a centre lathe.
y Blacksmith do this. y Heat is obtained by the friction between the ends of
y Power requirements 25 kVA to 175 kVA.
y Borax is used as a flux. th two
the t parts
t to
t be
b joined.
j i d
y The axial pressure depends on the strength and
y The ends to be joined were then overlapped on the y One part is rotated at a high speed and other part is
h d
hardness off the
h metals
l being
b joined.
d
anvil and hammered to the degree
g necessaryy to axially aligned and pressed tightly against it.
y Pressure 40 MPa for lowcarbon
low carbon steels to as high as 450
produce an acceptable weld. y Friction raises the temperature of both the ends. Then
MPa for alloy steels.
y Quality depends on the skill of the worker and not rotation is stopped abruptly and the pressure is

used
d by
b industry.
i d increased to join.
join
Contd Contd

y Very efficient.
GATE2007
y Wide variety of metals or combinations of metals can Whichoneofthefollowingisasolidstatejoining
be jjoined such as aluminium to steel.
process??
y Grain size is refined
y Strength is same as base metal.
metal (a) Gastungstenarcwelding
y Only round bars or tubes of the same size, or (b) Resistancespotwelding
p g
connecting
i bars
b or tubes b to flat
fl surfaces
f can join.
j i
y One of the components must be ductile. (c) Frictionwelding
y Friction welding is a solid state welding. (d) submergedarcwelding
y A low contact pressure may be applied initially to
permit cleaning of the
For-2015 surfaces
(IES, GATEby& aPSUs)
burnishing action. Page
Fig 59 of 240
frictionweldingprocess Rev.0
Contd
GATE2013
pairs
Match the CORRECT pairs.
GATE2014 G 20 0 ( )
GATE2010(PI)
Processes Characteristics/Applications
In solidstate welding, the contamination layers P.FrictionWelding 1.Nonconsumableelectrode Two steell bars,
b each
h off diameter
d 10 mm, are coaxially
ll

b t
between th surfaces
the f t be
to b welded
ld d are removed
d by
b Q.GasMetalArc
Q GasMetalArc 2 Joiningofthickplates
2.Joiningofthickplates friction welded,
welded end to end,
end at an axial pressure of 200
Welding MPa and at a rotational speed of 4000 rpm. The
(a) alcohol R T
R.TungstenInertGas
t I tG 3.Consumableelectrodewire
C bl l t d i
Welding coefficient of friction between the mating faces of the
(b) p
plastic deformation
S.Electroslag Welding 4.Joiningofcylindrical rotating bars
b is 0.50. The
h torque is assumed
d to act at the
h
(c) water jet dissimilarmaterials 3/4th radius of the rotating bar. The power (in KW)
(d) sand blasting consumed at the interface for welding is
( ) 4 Q3
(a)P4,Q3,R1,S2 ( ) 4 Q
(b)P4,Q2,R3,S1
3
(c)P2,Q3,R4,S1 (d)P2,Q4,R1,S3 (a) 12.33 (b) 16.44 (c) 18.50 (d) 24.66

UltrasonicWelding(USW) Restricted to the lap joint


IFS2011 USW is a solidstate welding.
Weld thin materials sheet, foil, and wire
materialssheet, or the
wireor
attaching thin sheets to heavier structural members.
Discusswithfigurethevariousstepsrequiredfor Highfrequency
g q y (10 to 200, KHz) is applied.
pp Maximum thickness 2.5 2 5 mm for aluminum and 1.0 10
frictionwelding,mentioningatleasttwomethods Surfaces are held together under light normal mm for harder metals.
pressure. N b off metals
Number t l andd dissimilar
di i il metal t l combinations
bi ti
ofcontrol.
Temp. do not exceed onehalf of the melting point. and non metals can be joined such as aluminum to
[
[5marks]
k ] The
Th ultrasonic
lt i transducer
t d i same as ultrasonic
is lt i ceramics
i or glass.
l
machining. Equipment is simple and reliable.
Less surface preparation and less energy is needed.

Contd Contd

ExplosionWelding
pp
Applications Important factors are,
y Done at room temperature in air, water or vacuum.
y Joiningthedissimilarmetalsinbimetallics y Critical velocity
y
y Makingmicrocircuitelectricalcontacts.
y Surface contaminants tend to be blown off the surface. y Critical angle

y Weldingrefractoryorreactivemetals
W ldi f i l y Typical impact pressures are millions of psi.
psi y The cladding plate can be supported with tack welded
supports at the edges, or the metal inserts.
y Bondingultrathinmetal.
g y Well suited to metals that is prone to brittle joints
when heat welded, such as,
y Aluminum on steel

y Titanium on steel
For-2015 (IES, GATE & PSUs) Page 60 of 240 Rev.0
Contd Contd
y Typically the detonation velocity should not exceed High velocity explosives, 45727620 m/s.
120% of the sonic velocity in the metal. y TNT g ,
Advantages,
y RDX
y PETN
y Can bond many dissimilar, normally unweldable
y Composition
C iti B metals
y Composition C4 y The lack of heating preserves metal treatment
y Datasheet
y The
Th process isi compact, portable,
bl andd easy to contain
i
y Primacord
Medium velocity explosives, 15244572 m/s y Inexpensive
y Ammonium nitrate y No need for surface preparation
y Ammonium perchlorate
y Amatol
y Nitroguonidine
y Dynamites
y diluted PETN
Contd Contd Contd

Disadvantages, yp pp
Typicalapplications:
y The metals must have high enough impact resistance,
and ductilityy ((at least 55%)) y Verylargeplatescanbecladded.
y The cladding plate cannot be too large. y Joinsdissimilarmetals.
y Noise and blast can require worker protection,
protection vacuum
chambers, buried in sand/water. (titaniumtosteel,Altosteel,AltoCuetc.)

y Jointubetotubesheetsoflargeheatexchangers.

Contd Contd

IES2011S1Contd
MatchListIwithListIIandselectthecorrectanswer
GATE1992 usingthecodegivenbelowthelists:
IES2011FromS1
Inanexplosiveweldingprocess,the.. Codes:
ListI ListII
(maximum/minimum)velocityofimpactisfixed A.Laserbeam 1.Canbeappliedforweldingorrefractorymetals A B C D A B C D
bythevelocityofsoundinthe welding likeniobium,tantalum,molybdenumandtungsten. (a) 4 3 1 2 (b) 2 3 1 4
(flyer/target)platematerial B.Electron 2.Asoundandcleanweldedjointiscreateddueto ((c)) 4 1 3 4 ( )
(d) 2 1 3 4
(a) Maximum;target beamwelding rubbingoftwopartsagainsteachotherwith
adequatespeedandpressureproducingintenseheat
(b) M
Minimum;target
u ; ta get raisingtemperatureabovemeltingpoint.
raisingtemperatureabovemeltingpoint
(c) Maximum;flyer C.Ultrasonic 3.Cleanheatsourcecreatedmuchawayfromjob,a
(d) Minimum;flyer
Mi i fl welding narrowspotisheated workchamberoperatesina
narrowspotisheated,workchamberoperatesina
highvacuum.
D.Friction
D Friction 4.Cleanheatsourceveryquickheating,verysmall
4 Cleanheatsourceveryquickheating,verysmall
For-2015 (IES, GATE & PSUs) welding focalspot,novacuumchamberisrequired.
Page 61 of 240 Rev.0
IES2009 IAS2002
MatchListIwithListIIandselectthecorrectanswerusingthecodegiven MatchListI,(Welding)withListII(Application)andselectthecorrect
( ) ( )
IFS 2009
belowtheLists: answerusingthecodesgivenbelowtheLists:
ListI ListII ListI ListII Two plates of aluminium and stainless steel are to
(WeldingProcess) (Application) (
(Welding) ) (
(Application) )
A. Laserwelding 1. Unitinglargeareasheets
B. Frictionwelding 2. Repairinglargeparts
A. Explosive 1. Joiningthicksheets be welded back to back to create a single plate of
C Ultrasonicwelding
C. 3
3. Weldingarodtoaflatsurface B. Ultrasonic 2. Manufactureofheatexchanges g
D. Explosivewelding 4. Fabricationofnuclearreactor C. Thermit 3. Joiningthinsheetsorwiresof
similar/dissimilar metals
thickness equal to the sum of the thicknesses of
components
55. Weldingverythinmaterials
g y D. Projection 4. Joininghydraulicpistonrodsfor
Code: agricultural
l l machinery
h the two plates.
plates Suggest the suitable process and
(a) A B C D (b) A B C D 5. Joiningrails,pipesandthicksteel
5 4 3 2 1 4 2 5 sections explain it in brief.
Codes:A
d B C D A B C D
(c) A B C D (d) A B C D (a) 2 5 1 3 (b) 4 5 1 3 [10 marks]
1 3 4 2 5 3 4 1 (c) 2 3 5 1 (d) 4 3 5 1

Autogeneous Welding MicroPlasmaArcWeld(PAW) DiffusionWelding


y It is a solid state welding
g p
process which p
produces
y Autogeneous welding or fusion of the parent y Similar to GTAW except the plasma caused by the arc coalescence of the faying surfaces by the application of
material in an inert g
gas shield without the use pressure and elevated temperatures (about 50 to 80%
i constricted
is t i t d by
b a watercooled
t l d orifice
ifi of absolute melting point of the parent materials) for a
of filler metals.
time ranging from a couple of minutes to a few hours.
y Capable of high welding speeds where size permits
y Produces high quality bonds with good strength with
y Argon
g is used as the shielding
gggas. little or no distortion.
y Can join very dissimilar materials.
y A solid filler metal may or may not be inserted.
y Materials welded for aircraft and rocket industry:
Boron, Titanium, Aluminium, Ceramic, Composite,
Graphite, Magnesium etc.

JWM2010
M hLi I i hLi II d l h
MatchListIwithListIIandselectthecorrectanswer
GATE 2008(PI) IAS2001 usingthecodegivenbelowthelists:
Which
h h pair among the
h following
f ll solid
l d state welding
ld MatchListI(Weldingprocesses)withListII(Features)and
( ) ( ) ListI ListII
selectthecorrectanswerusingthecodesgivenbelowtheLists:
A.Atomic 1.Twopiecesarebroughttogetherand
processes uses heat from an external source? h d
hydrogenwelding
ldi powersupplyisswitchedon
l i i h d
ListI ListII
A. Ultrasonicwelding 1. Gasheatedtoionizedcondition
P Diffusion welding; Q Friction welding forconductionofelectriccurrent B.Plasmaarc
B Plasma arc 22.Nuggetisformedattheinterfaceof
Nuggetisformedattheinterfaceof
B. Electronbeamwelding2. Highfrequencyandhigh
intensityvibrations welding twoplates
R Ultrasonic welding S Forge welding
C
C. Plasmaarcwelding 3
3. Concentratedstreamofhigh
Concentratedstreamofhigh C Spotwelding
C.Spotwelding 3 Gasisionized
3.Gasisionized
energyelectrons
(a) P and R (b) R and S 4. Exothermalchemicalreaction D.Flashwelding 4.Inertgasshieldedarcwelding
Codes:A
C d A B C A B C
(c) Q and S (d) P and S (a) 1 2 4 (b) 4 3 1 Code:A B C D A B C D
(c) 2 1 4 (d) 2 3 1
(a) 4 3 2 1 (b) 1 3 2 4
For-2015 (IES, GATE & PSUs) Page 62 of 240 (c) 4 2 3 1 (d) 1 Rev.0
2 3 4
IES 2011 Conventional
IES2011Conventional BrazingandSoldering
Discuss the process capabilities and applications of Gas y Brazing
B i is
i the
th joining
j i i off metals
t l through
th h the
th use off heat
h t
and a filler metal whose melting temperature is above
Metal Arc Welding, Gas tungsten Arc Welding, and 450C; but below the melting
45 g p
point of the metals being g
joined.
Diffusion Bonding processes. BrazingandSoldering
g g Comparison with welding and the brazing process
1. The
Th compositionii off the
h brazing
b i alloy
ll isi significantly
i ifi l
[15Marks] different from that of the base metal.
2 The strength of the brazing alloy is substantially lower
2.
than that of the base metal.
3. The melting point of the brazing alloy is lower than that
off the
h base
b metal,
l so the
h base
b metall is not melted.
l d
4. Capillary action or capillary attraction draws the
molten filler metal into the joint,
joint even against the flow of
gravity.

Brazingprocesshasseveraldistinct
Brazing process has several distinct
advantages:
g
Brazingmetalsaretypicallyalloyssuchas,
1. All metals can be joined. y Brazingbrass(60%Cu,40%Zn)
g
2. Suited for dissimilar metals. y Manganesebronze
y Nickelsilver
3. Quick and economical.
y Coppersilicon
4. Less defects.
d f y Silveralloys(with/withoutphosphorous)
l ll ( h h h h )
y Copperphosphorous
5 Corrosion prone
5.

Contd Contd

y Extremely clean surface needed. y A popular composition is 75% borax and 25% boric
y Fluxes used are combinations of borax, boric acid, acid.
chlorides fluorides,
chlorides, fluorides tetraborates
tetra borates and other wetting y Sodium
S di cyanide
id is
i used
d in
i brazing
b i tungsten to copper.
agents.
g y Base materials not melted.
melted

For-2015 (IES, GATE & PSUs) Page 63 of 240 Rev.0


Contd
GATE2005 IES2006 S O 20 0
ISRO2010
Which is not correct statement about the function of
Thestrengthofabrazedjoint Whichoneofthefollowingisnotafusionwelding flux in brazing
(a) Decreaseswithincreaseingapbetweenthetwo
g p process? (a) To avoid thermal distortion and cracking
joiningsurfaces (a) Gaswelding (b) To dissolve surface oxide coatings which have formed
(b) Increaseswithincreaseingapbetweenthetwo (b) Arcwelding prior to brazing
joiningsurfaces (c) Brazing (c) To prevent oxides from forming during the brazing
(c) Decreasesuptocertaingapbetweenthetwo (d) Resistancewelding
i ldi operation
i on both
b h the
h base
b metall and
d the
h brazing
b i
joiningsurfacesbeyondwhichitincreases material
(d) Increasesuptocertaingapbetweenthetwo
I t t i b t th t (d) To facilitate the wetting process by reducing the
joiningsurfacesbeyondwhichitdecreases viscosity of the melt

BrazeWelding y Done with an oxyacetylene torch. Soldering


y Capillary action is not required. y By definition, soldering is a brazing type of operation

y Edge preparation needed. where


h th filler
the fill metal
t l has
h a melting
lti t
temperature
t

y Can join cast iron.


iron below 450C.
45

y Strength of the filler metal is low.

y Soldering is used for a neat leakproof joint or a low


resistance electrical joint.

y Not
N suitable
i bl for
f hightemp.
hi h application.
li i
Fig.BrazeWelding
Contd Contd

Effective soldering generally involves six important


S ld M t l
SolderMetals S ld l
SolderFlux
steps: y Ammonium
A i chloride
hl id or rosin
i for
f soldering
ld i tinti
y Most solders are alloys of lead and tin.
(1) Design of an acceptable solder joint,
y Hydrochloric acid and zinc chloride for soldering
( ) Selection
(2) l off the
h correct solder
ld for
f the
h job,
b y Three commonly used alloys contain 60, 50, and 40%
(3) Selection of the proper type of flux, galvanized iron
tin and all melt below 240
240C
C.
(4) Cleaning the surfaces to be joined, y Some fluxes are corrosive and should be removed after
(5) Application of flux,
flux solder,
solder and sufficient heat to
allow the molten solder to fill the joint by capillary use
action and solidify,
solidify and
(6) Removal of the flux residue, if necessary.

For-2015 (IES, GATE & PSUs) Page 64 of 240 Rev.0


Contd
GATE2014(PI)
y Silver solders uses for highertemperature
g p service,,
BrazingandSolderingare
d ld
y
DifficultieswithGreyCastIron
Electrical and Electronic purpose.
Soldering and brazing are difficult of grey cast Iron due
(a)plasticjoiningmethods
to surface contamination with graphite having a very low
(b) o oge eous jo
(b)homogeneousjoiningmethods
g et ods
surface energy.
(c)autogenous joiningmethods

(d)heterogeneousjoiningmethods

IES1994 IAS1996 W ldi d i


Weldingdesignanddefect
dd f
MatchList IwithList IIandselectthecorrect MatchListIwithListIIandselectthecorrectanswerusing Welding
W ldi Problem
P bl Causes
C
answerusingthecodesgivenbelowtheLists: thecodesgivenbelowthelists Cracking of weld metal High joint rigidity
List I(Filler)
List List II(Joiningprocess)
List ListII
List ListII
List II Cracking of base metal Excessive stresses
A. Cu,Zn,Agalloy 1. Brazewelding. (Fillerrodmaterial) (Joiningprocess) Spatter Arc blow
B Cu,Sn,alloy
B. Cu Sn alloy 2
2. Brazing A. Mildsteel 1. MIGwelding Distortion Poor joint selection
B. Bronze 2. Soldering
C. Pb,Sb,alloy 3. Soldering Slag inclusion Improper cleaning in multi-
C. Brass 3. Brazing
D.Iron oxideandaluminium p powder4.
4 TIGweldingof
g pass welding
aluminium D Leadandtinalloy
D. L d dti ll 4. Th
Thermitit welding
ldi
5. Brazewelding Porosity Excessive H2, O2, N2, in the
Codes:A B C D A B C D Codes:A B C D A B C D welding atmosphere or Damp
( ) 2
(a) 1 3 (b) 1 2 4 (a) 1 5 3 2 (b) 4 3 2 5 electrodes
(c) 2 1 3 4 (d) 2 3 4 (c) 4 3 5 2 (d) 1 3 5 4 LamellarTearing inclusionssuchasMn FeandS
inthebasemetaland/or
h b l d
residualstress

IES2004 IES2003,ISRO2011 C k
Cracks
y Cracks may be of micro or macro size and may appear in
MatchListI(Weldingproblems)withListII(Causes)andselect
( ) ( ) MatchListI(WeldingDefects)withListII(Causes)and
( ) ( ) the weld metal or base metal or base metal and weld
thecorrectanswerusingthecodesgivenbelowtheLists: selectthecorrectanswerusingthecodesgivenbelowthe
ListI ListII Lists: metal boundary.
A. Crackingofweldmetal 1. Excessivestresses ListI ListII y Different categories of cracks are longitudinal cracks,
B. Crackingofbasemetal 2. Highjointrigidity (WeldingDefects) (Causes)
C
C. Porosity 3
3. Failuretoremoveslag
g/
transverse cracks or radiating/star cracks and cracks in
A Spatter
A. S 1. D
Dampelectrodes
l d
frompreviousdeposit
B. Distortion 2. Arcblow
the weld crater.
D. Inclusions 4. Oxidation
5. E
ExcessiveH
i H2,O
O2,N
N2,in
i C Slaginclusion
C. 3
3. Impropercleaningin y Cracks occur when localized stresses exceed the ultimate
theweldingatmosphere multipasswelding tensile strength of material.
Codes:A B C D A B C D D. Porosity 4. Poorjointselection
(a) 2 1 5 3 (b) 3 4 2 1 Codes:A B C D A B C D y These stresses are developed due to shrinkage during
(c) 2 4 5 3 (d) 3 1 4 2 (a) 4 2 3 1 (b) 4 2 1 3 solidification of weld metal.
(c) 2 4 1 3 (d) 2 4 3 1
For-2015 (IES, GATE & PSUs) Page 65 of 240 Rev.0
HAZ Cracking
HAZCracking Hydrogen Induced Cracking
HydrogenInducedCracking
Cracks may be developed due to poor ductility of base y Duetothepresenceofmoisture,grease,rustetc.,
metal,
metal high sulphur and carbon contents,
contents high arc travel y Crackinginheataffectedzonemaybecausedby:
g y y
hydrogenmayentertheweldpoolandgetdissolvedin
h d h ld l d di l di
speeds i.e. fast cooling rates, too concave or convex weld (i)Hydrogeninweldingatmosphere theweldmetal.
bead and high hydrogen contents in the weld metal.
metal
y DuringcoolinghydrogendiffusestotheHAZ.
(ii)hotcracking
y Crackingmaydevelopduetoresidualstressesassistedby
g y p y
(iii)lowductility hydrogencoalesence.
y Thefactorsthatdeterminetheprobabilityofhydrogen
(iv)highresidualstresses
inducedembrittlementandcrackingofweldare:
(v)brittlephaseinthemicrostructure (a)Hydrogencontent
(b)fracturetoughnessofweldandHAZ
Fig.VariousTypesofCracksinWelds
f k ld (c)stresstowhichthejointisexposedasaresultof
theweldthermalcycle.

Residualstress Porosity
y The residual stresses result from the restrained expansion y Porosity results when the gases are entrapped in the
and contraction that occur during localized heating and solidifying weld metal.
cooling in the region of weld deposit. y These gases are generated from the flux or coating
y The magnitude of residual stresses depends on the weldment constituents of the electrode or shielding gases used
design support and clamping of the components being
design, during welding or from absorbed moisture in the
welded, their materials, welding process used, part coating.
dimensions,, welding g sequence,
q ,p
post weld treatment,, size of
y Porosity
P it can alsol b controlled
be t ll d if excessively
i l high
hi h
the deposited weld beads, etc.
welding currents, faster welding speeds and long arc
y Residual stresses should not have a harmful effect on the
l
lengths
th are avoidedid d flux
fl and
d coated
t d electrodes
l t d are
strength performance of weldments, reduces fatigue
strength,
g Mayy cause distortion. This residual stress mayy properly baked.
result in the cracking of a brittle material and is not
important as far as a ductile material.

Solid Inclusion
SolidInclusion
y Solid inclusions may be in the form of slag or any other
nonmetallic material entrapped in the weld metal as
these may not able to float on the surface of the
solidifying weld metal.
metal
y During arc welding flux either in the form of granules or
coating after melting,
melting reacts with the molten weld metal
removing oxides and other impurities in the form of slag
and it floats on the surface of weld metal due to its low
density.
y Slag
Sl i l i
inclusion can be
b prevented d if proper groove isi
selected, all the slag from the previously deposited bead
Fig DifferentFormsofPorosities
Fig.DifferentFormsofPorosities i removed,
is d too high
hi h or too low
l welding
ldi currents and
d Fig SlagInclusioninWeldments
Fig.SlagInclusioninWeldments
For-2015 (IES, GATE & PSUs) long arcs are avoided.Page 66 of 240 Rev.0
Lack of Fusion
LackofFusion ImperfectShape,Distortions
p p
I l t P t ti
IncompletePenetration y Imperfect shape means the variation from the desired shape and
y Lack of fusion is the failure to fuse together either the size of the weld bead.
y Incomplete penetration means that the weld depth is not
base
b metall and
d weld
ld metall or subsequent
b beads
b d ini y During undercutting a notch is formed either on one side of the
upto the desired level or root faces have not reached to weld bead or both sides in which stresses tend to concentrate and
multipass welding because of failure to raise the
melting point in a groove joint. it can result in the early failure of the joint. Main reasons for
temperature off base
b metall or previously
i l deposited
d i d weld
ld undercutting are the excessive welding currents, long arc lengths
layer to melting point during welding. y If either low currents or larger arc lengths or large root and fast travel speeds.
face or small root gap or too narrow groove angles are y Underfilling may be due to low currents, fast travel speeds and
y Lack of fusion can be avoided by properly cleaning of
used then it results into poor penetration. small size of electrodes. Overlap may occur due to low currents,
surfaces to be welded, selecting proper current, proper longer arc lengths and slower welding speeds.
speeds
welding technique and correct size of electrode. y Excessive reinforcement is formed if high currents, low voltages,
slow travel speeds and large size electrodes are used. Excessive
root penetration and sag occur if excessive high currents and slow
travel speeds are used for relatively thinner members.
y Distortion is caused because of shrinkage occurring due to large
heat input during welding.

IES 2011 C ti l
IES2011Conventional
y Enumeratefourdefectscausedduetoresidualstressesin
weldedjoints.
[2Marks]

Ans.
1 Distortion
1.

2. Crackinginthebasemetal
g

3. LamellarTearing

4. Reductionoffatiguestrength

IES2004 GATE2003 IES2004


Consider the following statements: Matchthefollowing
M h h f ll i
Considerthefollowingstatements:
Workmaterial Typeofjoining
The magnitude of residual stresses in welding Thesizeoftheheataffectedzone(HAZ)willincreasewith
P Aluminium
P.Aluminium 1
1. SubmergedArcWelding
d
dependsd upon
Q.DieSteel 2. Soldering 1. Increasedstartingtemperature
1. Designofweldment R.CopperWire 3. Thermit Welding 2. Increasedweldingspeed
2. Supportandclampingofcomponents
S d l i f S.Titaniumsheet 4. AtomicHydrogenWelding
3. weldingprocessused 5. GasTungstenArcWelding
3. Increasedthermalconductivityofthebasemetal
4. Amountofmetalmelted/deposited 6
6. L
LaserBeamWelding
B W ldi 4 Increaseinbasemetalthickness
4.
7. Brazing Whichofthestatementsgivenabovearecorrect?
Whichofthestatementsgivenabovearecorrect?
(a)P 2
(a)P Q 5
Q R 1
R S 3
S
(a) 1,2and4 (b)1,2and3 ( ) 1,2and3
(a) d (b) 1and3
d
(b)P 6 Q 3 R 4 S 4
(c) 1and3 (d)2and3 (c)P 4 Q 1 R 6 S 2 (c) 1and4 (d) 2and3
(d)P 5 Q 4 R 2 S 6
For-2015 (IES, GATE & PSUs) Page 67 of 240 Rev.0
IES1992 20 0
JWM2010 IES1998
Assertion ((A)) : Spatter
p g defects.
is one of the welding
Weld spatter occurs due to any of the following Reason (R) : In submerged arc welding process, An arc welded joint is shown in the above figure.
except there is no spatter of molten metal. The part labelled 'B' in the figure
g is known as
(a) High welding current (a) Both A and R are individually true and R is the (a) Weld preparation
(b) Too small an electrode correct explanation of A (b) Penetration
(c) Arc (b) Both A and R are individually true but R is not the (c) Reinforcement
(d) Wrong polarity
l i correct explanation
l i off A (d) Slag
Sl
(c) A is true but R is false
(d) A is false but R is true

IES2004 IAS2003 GATE1996


Assertion (A): A sound welded joint should not only Toolmaterialnotsuitedtoresistanceweldingis Preheatingbeforeweldingisdoneto
be strong enough but should also exhibits a good (a) Makethesteelsofter
amount of ductility
Reason (R): Welding process is used for fabricating (a) Aluminium oxide (b) Stellite (b) Bumawayoil,grease,etc,fromtheplatesurface
mild steel components only (c) Highspeedsteel (d) Masonite (c) Preventcoldcracks
(a) Both A and R are individually true and R is the correct (d) Preventplatedistortion
explanation of A
(b) Both A and R are individually true but R is not the
p
correct explanation of A
(c) A is true but R is false
((d)) A is false but R is true

IES2011 GATE2001 IES 2012


IES
Coldcrackinginsteelweldments
Cold crackinginsteelweldments dependson Brittle welds are mainly obtained due to
Two plates of the same metal having equal
1.Carbonequivalent thickness are to be butt welded with electric arc. (a) Wrong electrode, faulty preheating and metal
2.Heatinput When the plate thickness changes, welding is hardened by air
3
3.Effectivethickness achieved by (b) Faulty welds, faulty sequence and rigid joints
3.Hydrogencontentinweldpool (a) Adjusting the current (c) Wrong speed, current improperly adjusted and faulty
(b) Adjusting
djust g tthee du
duration
at o oof cu
current
e t preparation
(a)1 2and3only
(a)1,2and3only
(c) Changing the electrode size (d) Uneven heat, improper sequence and deposited
(b)1,2and4only
metal shrinks
( )
(c)2,3and4only (d) Changing
Ch i the
th electrode
l t d coating
ti
3
(d)1,2,3and4
For-2015 (IES, GATE & PSUs) Page 68 of 240 Rev.0
IES 2012
IES GATE 2014
GATE2014 IES 2012
IES
Which of the following are associated with Heat Within the Heat Affected Zone (HAZ) in a fusion Statement ((I):) Hydrogen
y g induced cracking g occurs in the
Affected Zone? welding process, the work material undergoes heat effected zone adjacent to fusion zone and
classified as solid state cracking
1 Coldcracking
1.Coldcracking (a) microstructural changes but does not melt Statement (II):Hydrogen from burning of flux coating
2.Notchtoughness (b) neither melting nor microstructural changes penetrates martensitic micro cracks preventing healing
3.Hydrogenembrittlement (c) both melting and microstructural changes after as well as enlarging them.
them
solidification (a) Both Statement (I) and Statement (II) are individually
4
4.Stresscorrosioncracking
g true and Statement (II) is the correct explanation of
(a)1,2and3only (d) melting and retains the original microstructure after Statement (I)
(b)1 3and4only
(b)1,3and4only solidification ((b)) Both Statement ((I)) and Statement ((II)) are individuallyy
true but Statement (II) is not the correct explanation of
(c)2,3and4only Statement (I)
(d)1,2,3and4 (c) Statement (I) is true but Statement (II) is false
(d) Statement (I) is false but Statement (II) is true

For-2015 (IES, GATE & PSUs) Page 69 of 240 Rev.0


Lathe
h
B SKM d l
BySKMondal

L th
Lathe L th
Lathe Generalclassificationsusedwhendescribinglathes
y A lathe is a large
g machine that rotates the work,, and y Bed this is a bottom pan on the lathe that catches chips,
chips y Swing the largest diameter of work that can be rotated.
rotated
cutting is done with a nonrotating cutting tool. The cutting fluids, etc. y Distance Between Centres the longest length of
shapes cut are generally round, or helical. The tool is
typically moved parallel to the axis of rotation during y carriage this part of the lathe carries the cutting tool and workpiece
cutting. moves based on the rotation of the lead screw or rod. y Length of Bed Related to the Distance Between
y headstock thisendofthelathecontainsthedriving y Lead
L d screw A large
l screw with
ith a few
f threads
th d per inch
i h used
d C t
Centres
motorandgears.Powertorotatethepartisdelivered for cutting threads. It has ACME threads with included angle y Power The range of speeds and feeds, and the
f
fromhere.Thistypicallyhasleversthatletthespeeds
h Thi t i ll h l th tl tth d of 29o for easy engagement and disengagement of half nut.
nut
horsepower available
andfeedsbeset. y Lead rod a rod with a shaft down the side used for driving
y ways thesearehardenedrailsthatthecarriagerides
th h d d il th tth i id normal cutting feeds.
feeds
on. y The critical parameters on the lathe are speed of rotation
y tailstock
t il t k thiscanbeusedtoholdtheotherendofthe
thi b dt h ldth th d fth (speed in RPM) and how far the tool moves across the work
part. for each rotation (feed in IPR)

NumberofSpindleSpeed IES 2001


IES IES 1992
IES
y Number of spindle speed is in a geometric progression.
progression Thespindlespeedrangeinageneralpurposelathe Feedgearboxforascrewcuttinglatheisdesigned
y If n number of spindle speed is required with N1 is the isdividedintostepswhichapproximatelyfollow onthebasisof
minimum speed then (a) Arithmeticprogression (a) Geometricprogression
N1 , N1r, N1r 2 , N1r 3 ,.............N1r n1 (b) Geometricprogression (b) Arithmeticprogression
N1 = N min and N1r n1 = N max (c) Harmonicprogression (c) Harmonicprogression
1 ((d)) Logarithmicprogression
g p g ((d)) None.
N n1
Therefore, Step Ratio ( r ) = max
N min
y The values of step ratios are 1.06, 1.12, 1.26, 1.41, 1.58 and 2

For-2015 (IES, GATE & PSUs) Page 70 of 240 Rev.0


T i
Turning Threading
y Turning
Turning producesasmoothandstraightoutsideradius y Threading
Threading Thecuttingtoolismovedquicklycutting
onapart. threads.

h di
Threading IES 1998
IES IES 1993,ISRO2009
IES 1993 ISRO 2009
y Inonerevolutionofthespindle,carriagemusttravel A single start thread of pitch 2 mm is to be produced It is required to cut screw threads of 2 mm pitch on
thepitchofthescrewthreadtobecut. on a lathe having a lead screw with a double start a lathe. The lead screw has a pitch of 6 mm. If the
N s Pz s = N L Lz L thread of pitch 4 mm. The ratio of speeds between spindle speed is 60 rpm, then the speed of the lead
the spindle and lead screw for this operation is screw will be
P = Pitch of the screw thread to be cut
(a) 1 : 2 (b) 2: 1 (a) 10 rpm (b) 20 rpm
L = Pitch of the lead screw
(c) 1: 4 (d) 4: 1 (c) 120 rpm (d) 180 rpm
z s = Number of start of the screw thread to be cut
z L = Number of start of the lead screw
icg = gear ratio i dl ( N s ) to
ti off spindle i ( N L ) gear train
t carriage t i

Facing Tapering P ti /Sl tti /G i


Parting/Slotting/Grooving
y Facing The end of the part is turned to be square.
square y Tapering
Tapering thetoolismovessoastocutataper(cone y A tool is moved in/out of the work.
work shallow cut will leave
shape). a formed cut, a deep cut will cut off the unsupported
part.

For-2015 (IES, GATE & PSUs) Page 71 of 240 Rev.0


D illi /B i
Drilling/Boring K li
Knurling S i i
Spinning
y Drilling/Boring a cutter or drill bit is pushed into the y Knurling is a manufacturing process whereby a y Metal Spinning is a process by which circles of metal are
end to create an internal feature. visuallyattractive diamondshaped (crisscross) shaped over mandrels (also called forms) while mounted
pattern is cut or rolled into metal. on a spinning lathe by the application of levered force
y This pattern allows human hands or fingers to get a with various tools.
better grip on the knurled object than would be
provided by the originallysmooth metal surface.

ISRO2007 Reaming Tapping


y A tap enters the workpiece axially through the end and
y A reamer enters the workpiece axially through the end cuts internal threads into an existing hole. The
Spinning operation is carried out on
and enlarges an existing hole to the diameter of the existing hole is typically drilled by the required tap
(a) Hydraulic press tool. Reaming removes a minimal amount of material drill size that will accommodate the desired tap.
and is often performed after drilling to obtain both a
(b) Mechanical press more accurate diameter and a smoother internal
finish.
(c) Lathe

(d) Milling
Milli machine
hi

W k h ldi D i f L th
WorkholdingDevicesforLathes L th h k
Lathechucks
y Held between centers y Lathe chucks are used to support
pp a wider varietyy of
y 3 jaw self centering chuck (Disc type jobs being held
workpiece shapes and to permit more operations to be
performed than can be accomplished when the work is
in chucks ) held between centers.
y 4 jaw independently adjusted chuck y Threejaw, selfcentering chucks are used for work that
y Held in a collet (Slender rod like jobs being held in has a round or hexagonal cross section. 3JawChuck 4JawChuck
collets ) y Each jaw in a fourjaw independent chuck can be moved
y Mounted on a face plate (Odd shape jobs, being held inward and outward independent of the others by means
in face plate)
p ) of a chuck wrench. Thus they can be used to support a
wide
id variety
i t off work
k shapes.
h
y Mounted on the carriage
y Combination fourjaw chucks are available in which each
y Mandrels j
jaw can beb moved d independently
i d d tl or can be
b moved d
y MagneticFor-2015 (IES,
chuck for GATE
thin job & PSUs) Page of
simultaneously by means 72 aofspiral
240 cam. Rev.0
T i
Turning F l f T i
FormulaforTurning
D1 D2
cut d = DOC =
y Depth of cut, mm
2
y Average diameter of workpiece D1 + D2
Davgg = mm
Collets Magnetic Chuck
MagneticChuck 2

Time CT = L + A + O
y Cutting Time,
fN

y Metal Removal Rate


M RR =
(D 2
1 D 22 )= D a v g d fN
4 / fN
D1N
Face Plate
FacePlate y Cutting Speed, V = ,m / min
1000

Example IES 2010


IES2010 IES 2003
IES
How much
h machining
h time will
ll be
b required
d to reduce
d
In turning a solid round bar, if the travel The time taken to face a workpiece of 72 mm
of the cutting tool in the direction of diameter, if the spindle speed is 80 r.p.m. and cross
the diameter of a cast iron rod from 120 mm to 116 mm feed is 0.3 mm/rev, is
f d motion
feed i i 1000 mm, rotational
is i l
over a length of 100 mm by turning using a carbide (a) 1.5 minutes (b) 3.0 minutes
speed
p of the workpiece
p is 5500 rpm,
p , and ( ) 5.4 minutes
(c) i t (d) 8.58 minutes
i t
insert. Cutting velocity is 100 m/min and feed rate = 0.2 rate of feed is 0.2 mm/revolution, then
mm/rev. th machining
the hi i time
ti will
ill be
b
(a) 10 seconds (b) 100 seconds
(c) 5 minutes (d) 10 minutes

GATE 2013 (PI) C D


GATE2013(PI)CommonData IAS 2002
IAS IES 2004
IES
A disc of 200 mm outer and 80 mm inner diameter is A 150 mm long, 12 mm diameter 304 stainless steel A medium carbon steel workpiece is turned on a
faced of 0.1 mm/rev with a depth of cut of 1 mm. The rod is being reduced in diameter to 115 mm by lathe at 50 m/min. cutting speed 0.8 mm/rev feed
facing operation is undertaken at a constant cutting turning on a lathe. The spindle rotates at N = 400 and 1.5 mm depth of cut. What is the rate of metal
speed of 90 m/min in a CNC lathe. The main rpm and the tool is travelling at an axial speed of removal?
(tangential) cutting force is 200 N. 200 mm/min. The time taken for cutting is given by (a) 1000 mm3/min
Assuming approach and overtravel of the cutting (a) 30 s (b) 36 s (b) 60,000 mm3/min
tool to be zero,
zero the machining time in min is ( ) 1 minute
(c) i t (d) 45 s (c) 20,000 mm3/min
(a) 2.93 (b) 5.86 (c) 6.66 (d) 13.33 ((d)) Can not be calculated with the g
given data

For-2015 (IES, GATE & PSUs) Page 73 of 240 Rev.0


T i T L th
TurningTapersonLathes Using a Compound Slide
UsingaCompoundSlide UsingaCompoundSlidecontd..
y Limited movement of the compound slide
y The angle is determined by
y Usingacompoundslide,
d ld y Feeding is by hand and is nonuniform. This is
Dd
responsible for lowproductivity and poor surface tan =
y Usingformtools, finish. 2l
= Half taper angle
y Can be employed
p y for turning g short internal and
D = Diameter of stock
y Offsettingthetailstock,and external tapers with a large angle of (steep) taper.
d = smaller diameter
l = length of the taper
y Usingtaperturningattachment.

IES 2006
IES E l
Example Off tti th t il t k
Offsettingthetailstock
For taper turning on centre lathes, the method of Find the angle at which the compound rest should y It is necessary to measure the tailstock offset when using
swiveling the compound rest is preferred for: be set up to turn taper on the workpiece having a this method.
(a) Long jobs with small taper angles length of 200 mm, larger diameter 45 mm and the y This method is limited to small tapers (Not exceeding 8o
(b) Long jobs with steep taper angles smaller 30 mm. ) over long lengths.
(c) Short jobs with small taper angles y By
B offsetting
ff tti the
th tailstock,
t il t k the
th axisi off rotation
t ti off the
th job
j b
((d)) Short jjobs with steep
p taper
p angles
g is inclined by the half angle of taper.

Off tti th t il t k Contd..


Offsettingthetailstock IES 1992
IES IAS 2002
IAS
y Tailstock offset (h) can be determined by Tailstocksetovermethodoftaperturningis The amount of offset of tail stock for turning taper
L(D d ) preferredfor on full length of a job 300 mm long which is to have
h= or h = L tan (a) Internaltapers its two diameters at 50 mm and 38 mm respectively
2l is
(b) Smalltapers
(c) Longslendertapers (a) 6 mm (b) 12 mm
((d)) Steeptapers
p p (c) 25 mm (d) 44 mm

For-2015 (IES, GATE & PSUs) Page 74 of 240 Rev.0


IES 1998
IES F t l
Formtool Taper Turning Attachment
TaperTurningAttachment
A 400 mm long shaft has a 100 mm tapered step at y Special form tool for generating the tapers is used.
used The y Additional equipment is attached at the rear of the lathe.
lathe
the middle with 4 included angle. The tailstock feed is given by plunging the tool directly into the work. y The cross slide is disconnected from the cross feed nut.
offset required to produce this taper on a lathe This method is useful for short external tapers, where y The
Th cross slide
lid is
i then
th connected
t d to
t the
th attachment.
tt h t
would be the steepness is of no consequence, such as for
y As the carriage is engaged, and travels along the bed, the
(a) 400 sin 4
4 (b) 400 sin 22 chamfering.
attachment will cause the cutter to move in/out to cut
(c) 100 sin 4 (d) 100 sin 2 the taper.
y For turning tapers over a comprehensive range is the use
p turning
of taper g attachment.

E i t l tti
Errorsintoolsettings IES 2010
IES2010
The effect of centering error
when the tool is set above the
center line as shown in the figure
results
lt effectively
ff ti l ini
1. Increase in rake angle.
2. Reduction
R d ti in i rake
k angle.
l
3. Increase in clearance angle.
y Setting the tool below the centre decrease actual rake angle, 4. Reduction
R d i in i clearance
l angle.
l
while clearance angle increases by the same amount. Thus Which of these statements is/are
cutting force
f increased.
d correct?
t?
y Setting the tool above the centre causes the rake angle to (a) 1 only (b) 1 and 4 only
increase, while clearance angle reduces. More rubbing with ( ) 2 and
(c) d 4 only
l (d) 1, 2, 3 and
d4
flank.

TurretLathe CapstanLathe
p
T t L th
TurretLathe
A turret lathe, a number of tools can be set up on the
machine and then quickly be brought successively into
working position so that a complete part can be
machined without the necessity for further adjusting,
changing tools, or making measurements.

For-2015 (IES, GATE & PSUs) Page 75 of 240 Rev.0


Capstan lathe Turret lathe
slide since the saddle is Saddle moves along the bed,
Short slide, bed
clamped on the bed in position. thus allowing the turret to be of IES 2012
IES i d i h i
Turretindexingmechanism
g size.
large Lathe machine with turret can turn a work piece of
y The
h hexagonal
h l turret is rotated
d (for
(f indexing)
d ) by
b a
Light duty machine, generally for Heavy duty machine, generally limited length only because,
components
p whose diameter is for components
p with large
g (a) Cross slide motion is obstructed by turret Geneva mechanism where a Geneva disc having six
less than 50 mm. diameters, such as 200 mm.
(b) Turret cannot work on a long job radial slots is driven by a revolving pin. Before starting
Too much overhang of the turret Since the turret slides on the
when it is nearing cut. bed, there is no such difference. (c) Chuck cannot be replaced by a face plate
rotation, the locking pin is withdrawn by a cam lever
Ram type turret lathe,
Ramtype lathe the ram and Saddle type lathes,
Saddletype lathes the main ((d)) Turret replaces
p the loose centre
the turret are moved up to the turret is mounted directly on the
mechanism.
h The
h single
l rotation off the
h disc
d holding
h ld the
h
cutting position by means of the saddle, and the entire saddle indexing pin is derived from the auxiliary shaft with the
capstan Wheel. As the ram is and turret assembly
moved toward the headstock, the reciprocates. help of another single revolution clutch as indicated.
t
turret
t is
i automatically
t ti ll locked
l k d into
i t
position. y For automatic lathe: Ratchet and Pawl mechanism

A t ti L th
AutomaticLathe Swiss type Automatic Lathe Or Sliding Headstock Automatics
SwisstypeAutomaticLatheOrSlidingHeadstockAutomatics

y The term automatic is somewhat loosely applied, but is y Headstock travels enabling axial feed of the bar stock
normally restricted to those machine tools capable of against the cutting tools.
producing identical pieces without the attention of an y There is no tailstock or turret
operator, after each piece is completed. Thus, after y High spindle speed (2000 10,000 rpm) for small job
setting up and providing an initial supply of material, diameter
further attention beyond replenishing the material y The cutting tools (upto five in number including two on
supply is not required until the dimensions of the work the rocker arm) are fed radially
pieces change owing to tool wear.
y Used for lot or mass production of thin slender rod or
y A number of types of automatic lathes are developed tubular
b l jobs,
j b like
lik components off small
ll clocks
l k and d wrist
i
that can be used for large volume manufacture watches, by precision machining.
application such as single spindle automatics,
application, automatics Swiss type
automatics, and multispindle automatics.

Norton type Tumbler gear quick change Gear box


NortontypeTumblergearquickchangeGearbox N t t T bl i k h G b
NortontypeTumblergearquickchangeGearbox
l i S i dl i h
MultiSpindleAutomaticLathe
y For increase in rate of production of jobs usually of y It comprises
p a cone of g
gears 1 to 8 mounted on shaft S2.

smaller size and simpler geometry. y The tumbler gear can slide on shaft S1. It can mesh with any
gear on shaft S2 through an intermediate gear which is
y Having four to eight parallel spindles are preferably used.
located
ocated o
on a sswinging
g g aand
d ssliding
d g lever
e e so tthat
at itt ca
can eengage
gage
y Multiple spindle automats also may be parallel action or gears 1 to 8 of different diameters, on shaft S2.
progressively working type. y The lever can be fixed in any desired ratio position with the
help of a stop pin.
y The drive is usually from the driving shaft S1 to the driven
shaft S2.
For-2015 (IES, GATE & PSUs) Page 76 of 240 Rev.0
GATE 2002
GATE GATE 2008
GATE 2008 GATE 2008
GATE2008Contd.

A leadscrew
l d with
ith half
h lf nuts
t in
i a lathe,
l th free
f to
t rotate
t t The figure shows an incomplete schematic of a
conventional lathe to be used for cutting threads
in both directions has with different pitches. The speed gear box Uv, is
shown and the feed gear box Us, is to be placed. P, Q.
(a) Vthreads
R and S denote locations and have no other
(b) Whitworth threads significance. Changes in Uv, should NOT affect the
pitch of the thread being cut and changes in Us, ThecorrectconnectionsandthecorrectplacementofUsare
(c) Buttress threads should NOT affect the cutting speed. givenby
((a)) QQandEareconnected. Us,,isplacedbetweenPandQ.
p Q
(d) ACME threads (b) SandEareconnected.Us isplacedbetweenRandS.
((c)) Q
QandEareconnected.Us,,isplacedbetweenQandE.
p Q
Contd.. (d) SandEareconnected.Us,isplacedbetweenSandE.

IES 2004
IES G 99
GATE1994 IES 1996
IES
Match List I (Cutting tools) with List II (Features) To get good surface finish on a turned job,
job Inturningofslenderrods,itisnecessarytokeep
and select the correct answer using the codes given one should use a sharp tool with a ..feed thetransverseforceminimummainlyto
below the Lists: and
d speed
d off rotation
t ti off the
th job.
j b (a) Improvethesurfacefinish
List I List II (b) Increaseproductivity
((a)) Minimum, minimum
A Turning
A. T i toolt l 1. Chi l edge
Chisel d (c) Improvecuttingefficiency
B. Reamer 2. Flutes
(b) Minimum, maximum
((d)) Reducevibrationsandchatter.
C. Milling cutter 3. Axial relief ( ) Maximum,
(c) M i maximum
i
4. Side relief ((d)) Maximum,, minimum
Codes: A B C A B C
( ) 1
(a) 2 3 (b) 4 3 2
(c) 4 2 3 (d) 1 3 2

IES 2009
IES IES 1999
IES IES 2009
IES
Whatisthenumberofjawsinself centred chuck?
Whatisthenumberofjawsinselfcentred Which one of the following sets of forces are Whichoneofthefollowingmethodsshouldbeused
(a) Eight encountered by a lathe parting tool while groove forturninginternaltaperonly?
(b) Six
Si cutting? (a) Tailstockoffset
(c) Four (a) Tangential, radial and axial (b) Taperattachment
(d) Three (b) Tangential
T ti l and
d radial
di l (c) Formtool
(c) Tangential and axial ((d)) Compoundrest
p
(d) Radial and axial

For-2015 (IES, GATE & PSUs) Page 77 of 240 Rev.0


IES 1992
IES IES 2006
IES IES 1997
IES
Whichofthefollowingstatementisincorrectwith It is required to cut screw threads with double start Consider the following operations:
referenceoflathecuttingtools? and 2 mm pitch on a lathe having lead screw pitch 1. Under cutting 2. Plain turning
(a) Theflankofthetoolisthesurfacebelowand of 6 mm. What is the speed ratio between lathe 3. Taper
T t
turning
i 4. Th d cutting
Thread tti
adjacenttothecuttingedges spindle and lead screw?
The correct sequence of these operations in machining a
(b) Thenoseisthecorner,orchamferjoiningtheside
Th i th h f j i i th id (a) 1 : 3 (b) 3: 1 product is
cuttingandtheendcuttingedges (c) 2 : 3 (d) 3: 2 ((a)) 2, 33, 4
4, 1 ((b)) 33, 2, 4
4, 1
(c) Theheelisthatpartofthewhichisshapedto (c) 2, 3, 1, 4 (d) 3, 2, 1, 4
producethecuttingedgesandface
(d) Thebaseisthatsurfaceoftheshankwhichagainst
pp g
thesupportandtakestangent

IES 2009
IES IES 2007
IES
A capstan lathe is used to mass produce, in batches
massproduce, Assertion (A): In a multi spindle automatic lathe, the
multispindle
of 200, a particular component. The direct material turret tool holder is indexed to engage the cutting tools
cost is Rs 4 per piece, the direct labour cost is Rs 3 one by y one for successive machining g operations.
p
per piece and the overhead costs are 400% of the Reason (R): Turret is a multiple tool holder so that for
labour costs. What is the production cost per piece? successive machining g operation,
p , the tools need not be
changed.
(a) Rs 19 (b) Rs 23
((a)) Both A and R are individuallyy true and R is the correct
( ) Rs
(c) R 166 (d) RsR 15 explanation of A
((b)) Both A and R are individuallyy true but R is not the
correct explanation of A
(c) A is true but R is false
(d) A is false but R is true

IES 1995
IES IES 1996
IES IES 2003
IES
C
Consider the following g characteristics: Assertion (A): Special purpose machine tools and Which one of the following mechanisms is
1. Multiple operations can be performed automatic machine tools are quite useful for job employed for indexing of turret in an automatic
2 Operator
2. Operator'ss fatigue is greatly reduced.
reduced shops lathe?
3. Ideally suited for batch production Reason (R): Special purpose machine tools can do (a) Whitworth (b) Rack and pinion
4 A breakdown
4. break down in one machine does not affect the special types of machining work automatically ( ) Ratchet
(c) R t h t and
d pawll (d) Geneva
G wheel
h l
flow of products. (a) Both A and R are individually true and R is the
5 Can accommodate modifications in design of
5. correctt explanation
l ti off A
components, within certain limits. (b) Both A and R are individually true but R is not the
The characteristics which can be attributed to special correct explanation of A
purpose machines would include
(c) A is true but R is false
(a) 1,
1 3 and 4 (b) 1, 1 2 and 4
(c) 2, 3 and For-2015
5 (d) (IES, GATE
1, 2 and 5 & PSUs) (d) A is false but R isPage
true78 of 240 Rev.0
IES 2009
IES IES 2001
IES IES 1995
IES
For the manufacture of screw fasteners on a mass The indexing of the turret in a single spindle
singlespindle Assertion ((A):) In a Swiss type
yp automatic lathe,, the
scale, which is the most suitable machine tool? automatic lathe is done using turret is given longitudinal feed for each tool in a
specific order with suitable indexing.
(a) Capstan lathe (a) Geneva mechanism
Reason (R): A turret is a multiple tool holder to
(b) Singlespindle automatic lathe (b) Ratchet and Pawl mechanism facilitate machining with each tool by indexing
(c) CNC turning centre (lathe) (c) Rack and pinion mechanism without the need to change the tools.
((d)) CNC machiningg centre ((d)) Whitworth mechanism (a) Both A and R are individually true and R is the
correct explanation of A
(b) Both A and R are individually true but R is not the
correct explanation of A
(c) A is true but R is false
(d) A is false but R is true

IES 1992
IES IAS 2007
IAS IAS 2002
IAS
Maximum production of small and slender parts is Which one of the following is the characteristic for Consider the following statements related to Turret
done by capstan lathe? lathe:
(a) Watch maker
maker'ss lathe (a) Rate of production is low 1 Turret is mounted directly on the saddle.
1. saddle
(b) Sliding head stock automatic lathe (b) Labour cost is high 2. Turret is mounted on an auxiliary slide.
(c) Multispindle automatic lathe (c) Used for handling jobs of varying shapes and sizes 3. Much heavier and larger jobs than Capstan lathe can
((d)) Capstan
p lathe ((d)) Capstan
p head is mounted on a slide be produced.
Which of the above statements is/are correct?
(a) 1 and 3 (b) 2 and 3
(c) 1 only (d) 2 only

IAS 1996
IAS IAS 2004
IAS IAS 2001
IAS
Apart from hexagonal turret, the elements (s) in a Swiss type screw machines have Consider the following operations and time
turret lathe include (s) (a) Turrets (b) Radial slides required on a multi spindle automatic machine to
(a) Crossslide
Cross slide tool post ( ) Spindle
(c) S i dl carriers
i (d) Tool
T l postst produce a particular job
(b) Crossslide tool post and rear tool post 1. Turning 1.2 minutes
(c) Crossslide tool post and tail stock 2. Drilling
D illi 1.6
6 minutes
i t
((d)) Teal tool p
post and tail stock 3. Forming 0.2 minute
4. Parting 0.6 minute
The time required to make one piece (cycle time) will be
(a) 0.6 minutes (b) 1.6 minutes
( ) 3.6
(c) 6 minutes
i t (d) 0.9 minute
i t
For-2015 (IES, GATE & PSUs) Page 79 of 240 Rev.0
IAS 1995
IAS IAS 1994
IAS IAS 1998
IAS
Assertion ((A):) In a multispindle
p automat,, the turret A multi spindle automat performs four operations
multispindle Assertion (A): For thread cutting, the spindle speed
is indexed to engage each of the cutting tool with times 50, 60, 65 and 75 seconds at each of its selected on a lathe, is very low.
mounted on it. work centers. The cycle time (time required to Reason (R): The required feed rate is low in
Reason(R): Turret is a multiple tool holder so that manufacture one work piece) in seconds will be threading operation.
the machining can be continued with each tool
without the need to change the tool. (a) 50 + 60 + 65 + 75 ( ) Both
(a) B th A and d R are individually
i di id ll true
t and
d R is
i the
th
(a) Both A and R are individually true and R is the (b) (50 + 60 + 65 + 75) /4 correct explanation of A
correct explanation of A (c) 75/4 (b) Both A and R are individually true but R is not the
(b) Both A and R are individually true but R is not the ((d)) 75 correct explanation of A
correct explanation of A (c) A is true but R is false
(c) A is true but R is false (d) A is false but R is true
(d) A is false but R is true

IAS 1998
IAS IES2011
Consider the following statements associated with In Norton type feed gearbox for cutting Whitworth
the lathe accessories: standard threads with a standard TPI Leadscrew, power
1 Steady rest is used for supporting a long job in
1. flows from:
between head stock and tail stock. (a) Spindle to Tumbler gear to Norton cone to Meander
drive to Leadscrew
2. Mandrel
M d l is i usedd for
f turning
t i small ll cylindrical
li d i l job.
j b
(b) Spindle to Norton cone to Tumbler geat to Meander
3. Collects are used for turning discshaped job. drive to Leadscrew
Of these statements: (c) Spindle t o Tumbler gear to Meander drive to Norton
(a) 1 and 2 are correct (b) 2 and 3 are correct cone to Leadscrew
(c) 3 alone is correct (d) 1 alone is correct (d) Spindle to Norton cone to Meander drive to Tumbler
gear to Leadscrew
g

IAS 2000
IAS Drilling D illi
Drilling
Consider the following features: y Drilling is a operation that cuts cylindrical holes.
holes
1. All spindles operate simultaneously,
2. One
O piece
i i completed
is l t d each
h time
ti th tools
the t l are
withdrawn and the spindles are indexed
3. The tool slide indexes or revolves with the spindle
carrier
Which of these features are characteristics of a multi
p
spindle automatic machine used for bar work?
(a) 1, 2 and 3 (b) 1 and 2 BySKMondal
(c) 2 and 3 (d) 1 and 3
For-2015 (IES, GATE & PSUs) Page 80 of 240 Rev.0
TYPES OF DRILL PRESSES
TYPESOFDRILLPRESSES D illi O ti
DrillingOperations Chip formation
of a drill
y Verticalorpillartype
V ti l ill t

y RadialArmtype

y Gangdrill
g

y MultiSpindledrill

y NumericalControldrill

Drill D ill
Drill IES 2004
IES
y The twist drill does most of the cutting with the tip of
the bit. Consider the following statements:
There are flutes The helical flute in a twist drill provides the necessary
to carry the chips 1. Clearance
Cl angle
l for
f the
th cutting
tti edge
d
up from the
2. Rake angle for the cutting edge
cutting edges to
the top of the 3. Space for the chip to come out during drilling
hole where they 4. Guidance for the drill to enter into the workpiece
are cast off. Which of the statements given above are correct?
( ) 1 and
(a) d2 (b) 2 and d3
(c) 3 and 4 (d) 1 and 4

IES 2003
IES D ill
Drill D ill
Drill
The purpose of helical grooves in a twist drill is to y Axial rake angle is the angle between the face and the line y Drill sizes
si es are typically
t picall measured across the drill points with
ith
1. Improve the stiffness parallel to the drill axis. At the periphery of the drill, it is a micrometer
2. Save
S a tool
t l material
t i l equivalent to the helix angle.
3. Provide space for chip removal y Most widely used material is High Speed Steel
y The lip clearance angle is the angle formed by the portion of
4. Provide rake angle for the cutting edge y The drill blanks are made by forging and then are twisted to
the flank adjacent to the land and a plane at right angles to
Select the correct answer using the codes given below: provide the torsional rigidity.
rigidity Then the flutes are machined
Codes: the drill axis measured at the periphery of the drill.
and hardened before the final grinding of the geometry.
( ) 1 and
(a) d2 (b) 2 and d3 y Lead
L d off the
th helix
h li is
i the
th distance
di t measured
d parallel
ll l to
t the
th drill
d ill
y Deep hole drilling requires special precautions to take care of
(c) 3 and 4 (d) 1 and 4 axis, between corresponding point on the leading edge of the
the removal of large volume of chips.
For-2015 (IES, GATE & PSUs) land in one complete revolution.
Page 81 of 240 Rev.0
GATE 1996
GATE IES 1997
IES P i t A l (2)
PointAngle(2)
y The point angle is selected to suit the hardness and brittleness of
The rake angle in a drill The rake angle in a twist drill the material being drilled.
drilled
(a) Increases from centre to periphery (a) Varies from minimum near the dead centre to a y Harder materials have higher point angles, soft materials have
maximum value at the periphery lower point angles.
(b) decreases
d f
from centre
t tot periphery
i h
y An increase in the drill point angle leads to an increase in the
(c) Remains constant (b) Is maximum at the dead centre and zero at the thrust force and a decrease in the torque due to increase of the
(d) Is irrelevant to the drilling operation periphery
i h orthogonal
h l rake
k angle.
l
(c) Is constant at every point of the cutting edge y This angle (half) refers to side cutting edge angle of a single point
tool.
tool
(d) Is a function of the size of the chisel edge. y Standard Point Angle is 118
y It is 116 to 118 for medium hard steel and cast iron
y It is 125 for hardened steel
y It is 130
3 to 1404 for brass and bronze
y It is only 60 for wood and plastics

H li A l ()
HelixAngle() IES 1992
IES GATE 1997
GATE
y Helix angle is the angle between the leading edge of the A drill for drilling deep holes in aluminum should Helix angle of fast helix drill is normally
land and the axis of the drill. Sometimes it is also called have (a) 35o
as spiral angle.
(a) High helix angle (b) Taper shank 6 o
(b) 60
y The helix results in a positive cutting rake
(c) Small point angle (d) No lip (c) 90o
y This angle is equivalent to back rake angle of a single
point cutting tool. (d) 5o
y Usual 20
20 to 35
35 most common
y Large helix : 45 to 60 suitable for deep holes and softer
workk materials
i l
y Small helix : for harder / stronger materials
y Zero helix : spade drills for high production drilling
microdrilling and hard work materials

IES 1992
IES Cutting Speed in Drilling
CuttingSpeedinDrilling
Low helix angle drills are preferred for drilling IFS2011 y Thecuttingspeedindrillingisthesurfacespeedofthe
holes in twistdrill.
Discuss deephole drilling keeping in mind speed and DN
(a) Plastics (b) Copper
feed, mentioning the technique of applying coolant.
V= m / min
i
(c) Cast steel (d) Carbon steel 1000
[5marks]

For-2015 (IES, GATE & PSUs) Page 82 of 240 Rev.0


D illi Ti
DrillingTime MRR i D illi
MRRinDrilling E l
Example
y Time for drilling the hole A hole
h l with
ith 40mm diameter
di t and
d 50mm depth
d th is
i to
t
D2
L MRR = 3
fN , mm / min be drilled in mild steel component.
p The cutting
g
T= , min
i 4
fN speed can be taken as 65 m/min and the feed rate as
0.25 mm/rev. Calculate the machining time and the
material
t i l removall rate.
t

Some Formulae for Drilling


SomeFormulaeforDrilling GATE 2002
GATE GATE 2004
GATE
D
Cone height (h) = The time taken to drill a hole through a 25 mm thick Through holes of 10 mm diameter are to be drilled
2 tan plate with the drill rotating at 300 r.p.m. and in a steel plate of 20 mm thickness. Drill spindle
f moving at a feed rate of 0.25 mm/revolution is speed is 300 rpm, feed 0.2 mm/ rev and drill point
U t chip
Uncut hi thickness
thi k (t ) = i
sin
2 (a) 10 sec (b) 20 sec angle is 120. Assuming drill over travel of 2 mm, the
D time for producing a hole will be
Width of cut (b) = ( ) 60
(c) 6 sec (d) 100 sec
2sin (a) 4 seconds (b) 25 seconds
( 2r / D ) tan
t ( ) 100 seconds
(c) d (d) 110 secondsd
Orthogonal rake angle ( ) = tan 1
sin

GATE 2012
GATE IES 2002
IES IES 1994
IES
In
I a single
i l pass drilling
d illi operation,
ti a through
th h hole
h l off The arm of a radial drilling machine is being raised The ratio between two consecutive spindle speeds
at a speed of 3.9 m/min by single start square for a sixspeed drilling machine using drills of
155 mm diameter is to be drilled in a steel p
plate of 550 threads of 6 mm pitch and 30 mm diameter. The diameter 6.25 to 25 mm size and at a cutting velocity
mm thickness. Drill spindle speed is 500 rpm, feed speed of the screw of 18 m/min is
(a) Is 650 rpm (a) 1.02
1 02 (b) 1.32
1 32
is 0.2 mm/rev and drill point angle is 118. Assuming
(b) Is 180 rpm (c) 1.62 (d) 1.82
2 mm clearance
l att approach
h and
d exit,
it the
th total
t t l drill
d ill (c) Is 130 rpm
time ((in seconds)) is ((d)) Cannot be determined as the data is insufficient

(a) 35.1 (b) 32.4

(c) 31.2 For-2015 (IES, GATE & PSUs)


(d) 30.1 Page 83 of 240 Rev.0
IES 2009
IES IES 2002
IES GATE 2014
GATE
What is the drilling time for producing a hole in an A 31.8 mm H.S.S. drill is used to drill a hole in a cast A hole
h l off 20 mm diameter
di t isi to
t be
b drilled
d ill d in
i a steel
t l block
bl k
MS sheet of 25 mm thickness using an HSS drill of iron block 100 mm thick at a cutting speed 20
20 mm diameter? The cutting speed and feed for m/min and feed 0.3 mm/rev. If the over travel of of 4
40 mm thickness. The drilling
g is p
performed at
drill are 20 m/min and 0.25 mm/revolution drill is 4 mm and approach 9 mm, the time required rotational speed of 400 rpm and feed rate of 0.1 mm/rev.
respectively, Neglect time taken for setting up, to drill the hole is
approaching and travelling of tools. (a) 1 min 40 s (b) 1 min 44 s The required approach and over run of the drill together
(a) 0.314
0 314 min (b) 0.236
0 236 min ( ) 1 min
(c) i 49 s (d) 1 mini 53 s i equall to
is t the
th radius
di off drill.
d ill The
Th drilling
d illi ti
time (i
(in
(c) 0.438 min (d) 0.443 min
minute)) is

(a) 1.00 (b) 1.25 (c) 1.50 (d) 1.75

GATE2014(PI) IAS 1999


IAS GATE 2007(PI)LinkedS1
GATE 2007 (PI) Li k d S 1
To drill a 10 mm diameter hole through a 20 mm Blind holes 10 mm diameter, 50 mm deep are
An HSS drill of 20 mm diameter with 5 mm cone thick M.S. plate with a drill bit running at 300 rpm being drilled in steel block. Drilling spindle
height is used to drill a through hole in a steel work
work and a feed of 0.25 mm per revolution, time taken speed is 600 rpm,
rpm feed 0.2
0 2 mm/rev,
mm/rev point angle of
will be drill is 120o.
piece of 50 mm thickness. Cutting speed of 10
(a) 8 s (b) 16 s
m/min and feed rate of 0.3 mm/rev are used. The
Machining time (in minutes) per hole will be
(c) 24 s (d) 32 s
(a) 0.08
0 08 (b) 0.31
0 31 (c) 0.44
0 44 (d) 0.86
0 86
drilling time, in seconds, neglecting the approach
and over travel,
travel is _______

GATE 2007(PI)LinkedS2
GATE 2007 (PI) Li k d S 2 IAS 1994
IAS IES 1999
IES
Blind holes 10 mm diameter, 50 mm deep are The time (in minutes) for drilling a hole is given by pp
Match ListI (Drill bits) with ListII (Applications) and select the correct
answer using the codes given below the Lists:
being drilled in steel block. Drilling spindle
Depth of the hole + h ListI ListII
speed is 600 rpm,
rpm feed 0.2
0 2 mm/rev,
mm/rev point angle of t= A Core
A. C d ill
drill 1. T enlarge
To l a hole
h l to t a certain
t i depth
d th so as to
t
Feed RPM
drill is 120o. where 'h' is the
accommodate the bolt head of a screw
B. Reamer 2. To drill and enlargeg an alreadyy existing
g hole in a
During the above operation, the drill wears out (a) Length of the drill casting
after p producingg 200 holes. Taylors
y tool life (b) Drill diameter C. Counter bore drill 3. To drill a hole before making internal
thread
h d
equation is of the form VT0.3 = C, where V = (c) Flute length of the drill D. Tap drill 4. To improve the surface finish and dimensional
cutting speed in m/minute and T = tool life in (d) Cone
C h i ht off the
height th drill.
d ill accuracy of the already drilled hole
Code:A B C D A B C D
minutes. Taylors constant C will be (a) 1 3 2 4 (b) 2 3 1 4
( ) 15
(a) ( ) 72
(b) ( ) 93
(c) ( ) 490
(d) (c) 2 4 1 3 (d) 3 2 4 1
For-2015 (IES, GATE & PSUs) Page 84 of 240 Rev.0
R i
Reaming Reamer
y Reaming
g removes a small amount of material from the
surface of holes.
y It is done for two purposes: to bring holes to a more exact
size and to improve the finish of an existing hole.
Reaming,Boring,Broaching y Multiage cutting tools that has many flutes, which may be
straight
i h or in
i a helix
h li are used.
d
y No special machines are built for reaming. The same
machine that was employed for drilling the hole can be used
for reaming by changing the cutting tool.
y Only a minimum amount of materials should be left for
removal by reaming. As little as 0.1 mm is desirable, and in
no case should the amount exceed 0.4 mm.
B SKM d l
BySKMondal y A properly reamed hole will be within 0.025 mm of the
correct size and have a fine finish.

Reamer Flutes
ReamerFlutes T fR
TypesofReamers
y The reamer flutes are either straight or helical.
y The helical flutes promote smoother cutting and should be Theprincipaltypesofreamersare:
used specifically for holes that are not continuous, such as 1. Handreamers
y y p
those with keyways parallel to the axis of the hole.
a. St i ht
Straight
y The cutting action of the helical flutes is smoother and helps
in preventing chatter. b. Taper
y The reamers are termed as left hand or right hand, 2. Machineorchuckingreamers
depending upon the direction in which they are moved,
l ki from
looking f th shank
the h k to
t the
th cutting
tti portion.
ti a. Rose
y The righthand reamer with righthand helix is used for b. Fluted
roughing cuts,
cuts since the tool tends to go into the workpiece 3. Shellreamers
Sh ll
more efficiently and thereby promotes the material removal.
4. Expansionreamers
y A right
righthand
hand reamer with left lefthand
hand flutes is used for
finishing cuts. 5. Adjustablereamers

R i
Reaming R i
Reaming
y To meet quality requirements, including both finish and y Reamers,, like drills,, should not be allowed to become dull. RoseReamer
accuracy (tolerances on diameter, roundness, The chamfer must be reground long before it exhibits
excessive wear. Sharpening is usually restricted to the Rose chucking reamers
straightness, and absence of bell bellmouth
mouth at ends of starting
t ti taper
t or chamfer.
h f Each E h flute
fl t mustt be
b groundd exactly
tl are ground d cylindrical
li d i l
holes). Reamers must have adequate support for the evenly or the tool will cut oversize. and have no relief
cutting edges, and reamer deflection must be minimal. y Reamers tend to chatter when not held securely,
securely when the b hi d the
behind th outer
t edges
d
y Reaming speed is usually twothirds the speed for work or work holder is loose, or when the reamer is not of the teeth. All cutting
drilling the same materials.
materials However,
However for close tolerances properly
p p yg ground.
is done on the beveled
be eled
and fine finish, speeds should be slower. y Irregularly spaced teeth may help reduce chatter. Other cures
ends of the teeth
for chatter in reaming are to reduce the speed, vary the feed
y Feeds
F d are usually ll much h higher
hi h than
th th
those f drilling
for d illi rate, chamfer the hole opening, use a piloted reamer, reduce
and depend upon material. the relief angle on the chamfer, or change the cutting fluid.
y Recommended cutting fluids are the same as those for y Any
A misalignment
i li b
between the
h work k piece
i and
d the
h reamer
For-2015 (IES, GATE & PSUs) will cause chatter and Page 85 ofreaming.
improper 240 Rev.0
drilling.
g
ChuckingReamer ShellReamer IFS2011
Fluted chucking Shell reamers often are What is the main difference between rose reamer
reamers have h relief
li f usedd for
f sizes
i over 20
behind the edges of the mm to save cuttingtool and chucking reamer ? Write in short about shell
t th as well
teeth ll as beveled
b l d material.
t i l Th
The shell,
h ll reamer.
ends. They can cut on made of HSS for smaller
all portions of the teeth.
teeth si es and with
sizes ith carbide [
[5marks]
k ]
Their flutes are edges for larger sizes or
relatively short and they for mass production
massproduction
are intended for light work.
finishing cuts.
cuts

Trepanning
y Trepanning is a annular groove producing operation IES 1999
IES IES 1999
IES
which leaves a solid cylindrical core in the centre. In
Which one of the following processes results in the Consider the following statements regarding
trepanning a cutter consisting of one or more cutting
best accuracy of the hole made? reaming process:
edges placed along the circumference of a circle is used
to produce the annular groove. (a) Drilling (b) Reaming 1 Reaming generally produces a hole larger than its
1.
(c) Broaching (d) Boring own diameter
2. Generally
G ll rake
k angles
l are nott provided
id d on reamers.
3. Even numbers of teeth are preferred in reamer
design.
Which of these statements are correct?
(a) 1 and 2 (b) 2 and 3
(c) 1 and 3 (d) 1,
1 2 and 3
TrepanningTool

IES 1998
IES 1998 IES 1994
IES GATE 2007(PI)
GATE 2007 (PI)
Match List
ListII with List II and select the correct answer
ListII In reaming process Reaming is primarily used for achieving
using the codes given below the lists: (a) Metal removal rate is high (a) Higher MRR
ListII
List ListII
List II
(b) High
Hi h surface
f fi i h is
finish i obtained.
bt i d (b) Improved
I d dimensional
di i l tolerance
t l
A. Reaming 1. Smoothing and squaring surface
(c) High form accuracy is obtained (c) Fine surface finish
around the hole for proper seating
B. Counterboring 2.Sizing and finishing the hole (d) High dimensional accuracy is obtained. (d) Improved positional tolerance
C Countersinking
C. Counter sinking 3.3 Enlarging the end of the hole
D. Spot facing 4. Making a conical enlargement at the
end of the hole
Code:A B C D A B C D
( ) 3
(a) 2 4 1 ( ) 2
(b) 3 1 4
For-2015 (IES, GATE & PSUs) Page 86 of 240 Rev.0
(c) 3 2 1 4 (d) 2 3 4 1
GATE 2014(PI)
GATE 2014 (PI) IES 1993
IES IES 1998
IES
A hole of 30 mm diameter is to be produced by reaming. A component requires a hole which must be within
Reamingisaprocessusedfor
R i i df
The minimum diameter permissible is 30.00 mm while the two limits of 25.03 and 25.04 mm diameter.
(a)creatingacircularholeinmetals the maximum diameter p permissible is 330.055 mm. In this Which of the following statements about the
regard, consider the following statements about the reamer size are correct?
(b)cuttingaslotontheexistingholesurface
g g reamer size:
1 Reamer size cannot be below 25.03
1. 25 03 mm.
mm
1. The minimum diameter of the reamer can be less than 30 mm.
(c)finishinganexistingholesurface 2. The minimum diameter of the reamer cannot be less than 30 mm. 2. Reamer size cannot be above 25.04 mm.
3. The maximum diameter of the reamer can be more than 30.05 mm. 3. Reamer size can be 25.04 mm.
(d)makingnoncircularholesinmetals 4.The maximum diameter of the reamer must be less than 30.05 mm.
4. Reamer size can be 25.03
4 5 3 mm.
Of these statements
Select the correct answer using the codes given below:
(a) 1 and 4 are correct (b) 1 and 3 are correct
(a) 1 and 3 (b) 1 and 2
(c) 2 and 3 are correct (d) 2 and 4 are correct
(c) 3 and 4 (d) 2 and 4

IAS 1999
IAS IAS 2003
IAS IES 1992
IES
For reaming operation of blind hole, the type of Match List I ((Operation)
p ) with List II ((Application)
pp ) and select Shell reamers are mounted on
the correct answer using the codes given below the lists:
reamer required is (a) Tool holders (b) Amour plates
ListI ListII
(a) Straight flute reamer (
(Operation) ) (
(Application) ) ( ) Arbor
(c) Ab (d) Shanks
Sh k
(b) Right hand spiral fluted reamer (A) Reaming 1. Used for enlarging the end of a hole to give it a
(c) Left hand spiral fluted reamer conical
i l shape
h f a short
for h distance
di
(B) Boring 2. Used for enlarging only a limited portion of the
((d)) None of the above
hole
(C) Counter boring 3. Used for finishing a hole
(D) Counter sinking 4
4. Used for enlarging a hole
Codes:A B C D A B C D
(a) 3 2 4 1 (b) 1 4 2 3
(c) 3 4 2 1 (d) 1 2 4 3

Boring
Boring
y Boring always involves the enlarging of an existing hole,
which may have been made by a drill or may be the result of a
core in a casting.
g
y An equally important and concurrent purpose of boring may
be to make the hole concentric with the axis of rotation of
the workpiece and thus correct any eccentricity that may
have resulted from the drill drifting off the centerline.
Concentricity is an important attribute of bored holes.
y When boring is done in a lathe, the work usually is held in a
chuck or on a faceplate. Holes may be bored straight,
tapered, or to irregular contours.
y Boring is essentially internal turning while feeding the tool
For-2015 (IES, GATE & PSUs) Page 87 of 240 Rev.0
parallel to the rotation axis of the workpiece.
B i
Boring B i
Boring
y The same principles are used for boring as for turning.
turning y Because the tool overhang will be greater, feeds and IES2009
y The tool should be set exactly at the same height as the depths of cut may be somewhat less than for turning to
axis of rotation.
rotation Slightly larger end clearance angles prevent tool vibration and chatter.
sometimes have to be used to prevent the heel of the tool y In some cases, the boring bar may be made of tungsten
from rubbing on the inner surface of the hole.
hole carbide because of this material
material'ss greater stiffness.
stiffness
y The boring tool is a singlepoint cutting tool.
y Hole quality, finish boring can typically achieve holes
within tolerances of IT9.
y Surface finishes better than Ra 1 micron can be achieved.

F l f B i
FormulaforBoring IES 1993
IES IES 1994,ISRO2008
IES 1994 ISRO 2008
The main purpose of boring operation, as compared Enlarging an existing circular hole with a rotating
D1 + D2 to drilling is to: single point tool is called
y Average diameter of workpiece Davg = mm
2 (a) Drill a hole (a) Boring (b) Drilling
(b) Finish the drilled hole (c) Reaming (d) Internal turning.
Time CT = L + A + O
y Cutting Time, (c) Correct the hole
fN
((d)) Enlarge
g the existing
g hole
y Metal Removal Rate

M RR =
(D 2
1 D 22 )= D a v g d fN
4 / fN

IES 1992,ISRO2010
IES 1992 ISRO 2010 IES 2000
IES IES 1996
IES
Which of the machine tools can be used for boring Which one of the following sets of tools or tools and Which of the following statements are correct?
1. Lathe processes are normally employed for making large 1. A boring machine is suitable for a job shop.
2. Drilling
D illi machine
hi diameter holes? 2. A jig ji boring
b i machine
hi isi designed
d i d specially
i ll for
f doing
d i
3. Vertical milling machine (a) Boring tool more accurate work when compared to a vertical
4. Horizontal milling machine (b) BTA tools
t l (Boring
(B i and d trepanning
t i association)
i ti ) and
d milling
illi machine.
hi
gun drill 3. A vertical precision boring machine is suitable for
(a) 1, 2, 3 (b) 1, 3, 4
(c) Gun drill and boring tool boring holes in cylinder blocks and liners.
(c) 2 and 4 (d) 1, 2, 3, 4
((d)) Boringg tools and trepanning
p g ((a)) 1, 2 and 3 ((b)) 1 and 2
(c) 2 and 3 (d) 1 and 3.

For-2015 (IES, GATE & PSUs) Page 88 of 240 Rev.0


IES 1995
IES JWM2010
The effects of setting a boring tool above centre Considerthefollowingoperationsregardingboring
height leads to a/an. machines:
(a) Increase in the effective rake angle and a decrease in 1.Counterboring
C t b i
the effective clearance angle. 2.Countersinking
(b) Increase
I i both
in b th effective
ff ti rakek anglel andd effective
ff ti 3.Trepanning
Broaching
clearance angle.
Whichoftheaboveoperationsis/arecorrect?
(c) Decrease in the effective rake angle and an increase
(a)1,2and3 (b)1and2only
in the effective clearance angle.
( ) d l (d)1only
(c)2and3only (d) l
(d) Decrease in both effective rank angle and effective
g
clearance angle.

Broaching B hi
Broaching B h C t ti
BroachConstruction
y Broaching
g is a multipletooth
p g operation
cutting p with the y The material removal using the broach teeth is shown
tool reciprocating. schematically in Fig. shown in below. The dotted line in
y Since in broaching g the machining g operation
p is the figure indicates the amount of material being
completed in a singlestroke as the teeth on the cutting removed by successive individual teeth.
tool, called broach, are at gradually increasing height
corresponding to the feed per tooth of a milling cutter.
y The shape of the broach determines the shape of the
machined part.
y Broaching was originally developed for machining
internal keyways, but looking at the advantages, it has
been extensively used in the mass production of
automobile
t bil componentt manufacture
f t f various
for i other
th
surfaces as well.

B h C t ti
BroachConstruction B h C t ti
BroachConstruction B h C t ti
BroachConstruction
y The broach is composed of a series of teeth, each tooth y The last set of teeth is called the finishing or sizing teeth.
teeth y The rear pilot helps to keep the broach to remain square
standing slightly higher than the previous one. This rise Very little material will be removed by these teeth. with the workpiece as it leaves the workpiece after
per tooth is the feed per tooth and determines the y The necessary size will be achieved by these teeth and broaching.
material removed by the tooth. hence all the teeth will be of the same size as that y Broaching speeds are relatively low, of the order of 6 to 15
y There are basically three sets of teeth present in a broach required finally.
finally With the progress of time,
time when the m/min However,
m/min. However the production rate is high with the
as shown in Fig. shown above. first set of teeth wear out, the next set of teeth will be cycle times being about 5 to 30 seconds, including the
y The
Th roughing
hi teeth
t th that
th t have
h th highest
the hi h t rise
i per tooth
t th able to provide the sizing function.
function workpiece and tool handling times.
times The low cutting
remove bulk of the material. y The pull end of the broach (Fig. shown in above) is speeds are conducive to very high tool life with very
y The semifinishing teeth, whose rise per tooth is smaller, attached
tt h d tot the
th pulling
lli mechanism
h i off the
th broaching
b hi small tool wear rates.
rates
remove relatively smaller amounts of material compared machine with the front pilot aligning the broach
to the roughing teeth. properlyl with
ith respectt to
t the
th workpiece
k i axis
i before
b f th
the
For-2015 (IES, GATE & PSUs) actual cutting starts.Page 89 of 240 Rev.0
B h C t ti
BroachConstruction B h C t ti
BroachConstruction Ad t fb hi
Advantagesofbroaching
y Broaches are generally made of high speed steel in view y For smooth operation, it is essential that at least two or 1. It is the fastest wayy of finishingg an operation
p g
with a single
stroke.
of its high impact strength. Sometimes, the titanium three teeth be simultaneously engaged.
2. Since all the machining parameters are built into the
nitride coating helps to improve the tool life further. spacing s =1.75
y The thumb rule for tooth spacing, 1 75 l , mm broach very little skill is required from the operator.
broach, operator
Also, the carbide inserttype broaches are used more for y The cut per tooth f is kept in the range 0.05 mm 0.09 3. Broaching machine is simple since only a single
surface broaching of cast iron for very large volume reciprocating
p g motion is required
q for cutting.
g
mm. 4. Final cost of the machining operation is one of the lowest
production to reduce the frequent resharpening of the
y In the normal speed BUE may be a problem. To avoid for mass production.
broach, which is a very difficult operation.
this a copious supply of the cutting fluid is provided. 5. Any
A type off surface,
f i
internall or external,
l can be
b generated d
y Standard broaches are available for common and more with broaching.
often used forms,
forms such as round and square holes,holes 6 Many surfaces,
6. surfaces which are very difficult or impossible by
keyways, etc. other means, can be done by broaching. For example, square
hole and internal splines.
7. Good surface finish and fine dimensional tolerances can be
achieved by broaching, often better than boring or reaming

Li it ti fb hi
Limitationsofbroaching IES 2007
IES IES 1993
IES
1. C
Custom made broaches are veryy expensive
p and can Among the following machining processes, which Assertion (A): Soluble oils are employed with
therefore be justified only for very large volume can be used for machining flat surfaces? broaching machine.
production.
1 Shaping
1. 2
2. Milling 3
3. Broaching Reason (R): Soluble oils have excellent cooling
2. A broach has to be designed for a specific application effect.
and can be used only for that application. Hence, the Select the correct answer using the code given below:
lead time for manufacture is more for custom designed (a) 1 and 2 only (b) 1 and 3 only ( ) Both
(a) B th A and d R are individually
i di id ll true
t and
d R is
i the
th
broaches. ((c)) 2 and 3 onlyy ((d)) 1, 2 and 3 correct explanation of A
3. Broaching, being a very heavy metal removal (b) Both A and R are individually true but R is not the
operation, requires that the workpiece is rigid and correct explanation of A
capable
bl off withstanding
ith t di theth large
l f
forces. (c) A is true but R is false
4. Broaching can only be carried out on the workpiece
whose
h geometryt is
i such
h that
th t there
th i no interference
is i t f f
for (d) A is false but R is true
the broach movement for the cutting.

IES 1993,2001
IES 1993 2001 IES 2001
IES IAS 2004
IAS
Assertion (A): No separate feed motion is required The screw and nut in a broaching machine are Which one of the following is true for the last few
during broaching. changed from square thread to ACME thread. The teeth of a broach which are meant for fine
Reason (R): The broaching machines are generally power requirement of the machine at the same finishing?
hydraulically operated. r.p.m. will (a) They have equal diameter
( ) Both
(a) B th A and d R are individually
i di id ll true
t and
d R is
i the
th (a) Remain same (b) They
Th have
h i
increasing
i diameter
di t
correct explanation of A (b) Decrease (c) They have decreasing diameter
(b) Both A and R are individually true but R is not the (c) Increase (d) They have alternately increasing and decreasing
correct explanation of A ((d)) Depend
p on the operator
p diameter.
(c) A is true but R is false
(d) A is false but R is true
For-2015 (IES, GATE & PSUs) Page 90 of 240 Rev.0
IES 2005
IES 2005 IES 2002
IES Milling
(
Match List I (Tool) ) with List II (Element
( of Tool)) and Match List I with List II and select the correct answer:
select the correct answer using the code given below the List I (Machine tool) List II (Features)
Lists:
List I List II A Lathe
A. 1
1. Push or pull tool
A Broach 1. Tang B. Drilling machine 2. Rachet and pawl
B. Reamer 2. Pilot mechanism
C. Drill 3. Front taper C. Shaper 3. Dividing head
D. Carbide insert face mill 4. Bond D Broaching
D. B hi machine
hi 4. H ll tapered
Hollow d spindle
i dl
5. Sweeper tooth 5. Face plate
Codes:A B C D A B C D Codes:A B C D A B C D B SKM d l
BySKMondal
(a) 2 5 1 3 (b) 1 3 4 5 (a) 2 4 5 1 (b) 5 3 2 4
(c) 2 3 1 5 (d) 1 5 4 3 (c) 2 3 5 4 (d) 5 4 2 1

Milli
Milling Milli
Milling U illi dd illi
Upmillinganddownmilling
Milling machines of various types are widely used y 2D
D contouring
t i likelik cam profiles,
fil clutches
l t h etc
t and
d 3D
D
for the following purposes using proper cutting
tools called milling cutters: contouring
g like die or mould cavities
y Flat surface in vertical, horizontal and inclined planes y Cutting teeth in piece or batch production of spur gears,
y Making
M ki slotsl t or ribs
ib off various
i sections
ti
straight toothed bevel gears, worm wheels, sprockets,
y Slitting or parting
y Often producing surfaces of revolution clutches
l h etc.
y Making helical grooves like flutes of the drills y Producing some salient features like grooves,
grooves flutes,
flutes
y Long thread milling on large lead screws, power screws,
gushing and profiles in various cutting tools, e.g., drills,
worms etc and short thread milling for small size
fastening screws, bolts etc. taps, reamers, hobs, gear shaping cutters etc.

U illi dd illi
Upmillinganddownmilling Ad t fD Milli
AdvantagesofDownMilling Di d t fD Milli
DisadvantagesofDownMilling
y In down milling, though the cut starts with a full chip 1.
1 Suited to machine thin and hard to hold parts since
hardtohold
thickness, the cut gradually reduces to zero. This helps in the workpiece is forced against the table or holding 1. It cannot be used unless the machine has a backlash
eliminating the feed marks present in the case of up device by the cutter.
milling and consequently better surface finish. eliminator and the table jibs have been tightened.
2. Work need not be clamped as tightly.
y Climb milling also allows greater feeds per tooth and 3. Consistent
C i t t parallelism
ll li and
d size
i may be b maintained,
i t i d
longer cutting life between regrinds than the 2. It cannot be used for machining castings or hot rolled
particularly on thin parts.
conventional milling.
milling 4. It may be used where breakout at the edge of the steel, since the hard outer scale will damage the cutter.
y Up milling needs stronger holding of the job and down workpiece could not be tolerated.
milling
illi needs
d backlash
b kl h freef screwnutt systems
t f
for 5. It requires upto 20% less power to cut by this method.
feeding.
6. It may be used when cutting off stock or when milling
For-2015 (IES, GATE & PSUs) deep, thin slots. Page 91 of 240 Rev.0
IES 2007
IES IES 1997
IES IES 2010
IES2010
What is the process of removing metal by a milling Consider the following g statements: Assertion (A): Climb or down milling operation ensures
In Up milling process, smoother operation of the machine tool and longer tool life
cutter which is rotated against the direction of
as compared to the conventional up milling operation.
travel of the work piece, called? 1. The cutter starts the cut from the machined surface and
proceeds upwards. Reason (R):( ) In climb or down milling operation, the
(a) Down milling (b) Up milling rotational motion of the cutter as well as the feed motion of
2. The cutter starts the cut from the top p surface and
( ) End
(c) E d milling
illi (d) Face
F milling
illi the workpiece
work piece are in the same direction,
direction and the depth of
proceeds downwards.
cut is maximum at the entry point as the cutter engages the
3. The job is fed in a direction opposite to that of cutter workpiece.
p
rotation.
i
(a) Both A and R are individually true and R is the correct
4. The job is fed in the same direction as that of cutter explanation of A
rotation.
rotation
(b) Both A and R are individually true but R is NOT the correct
Of these statements correct are: explanation of A
( ) 1 and
(a) d3 (b) 1 and d4 (c) A is true but R is false
(c) 2 and 3 (d) 2 and 4 (d) A is false but R is true

Cl ifi ti f illi hi
Classificationofmillingmachines Cl ifi ti f illi hi
Classificationofmillingmachines
IAS2009main (a) According to nature of purposes of use: ((c)) According g to the orientation of the spindle(s).
p ( )
y General purpose y Plain horizontal knee type
Definethetermfeedinmilling
Definetheterm feedinmilling.[2Marks]
[2Marks] y Horizontal axis ((spindle)
p ) and swiveling
g bed type
yp
y Si l purpose
Single
y Vertical spindle type
y Special purpose y Universal head milling machine
(b) According to configuration and motion of the (d) According to mechanization / automation and
workholding g table / bed production rate
p
y Knee type y Hand mill (milling machine)
y Planer and rotary y table type
yp vertical axis milling
g machines
y Bed type
y Tracer controlled copy milling machine,
y Planer type
y Milling
g machines for short thread milling g
y Rotary table type y Computer Numerical Controlled (CNC) milling machine

Cl ifi ti f illi tt
Classificationsofmillingcutters Cl ifi ti f illi tt
Classificationsofmillingcutters Sl b Pl i illi tt
SlaborPlainmillingcutters
(a) Profile sharpened cutters where the geometry of (b) Form relieved cutters where the job profile
the machined surfaces are not related with the tool becomes the replica of the
shape, viz; Tool form e.g.,
Toolform, e g viz.;
viz ;
i. Slab or plain milling cutter: straight or helical i. Form cutters
fluted ii. Gear (teeth) milling cutters
ii. Side milling cutters single side or both sided type iii. Spline
p shaft cutters
iii. Slotting cutter iv. Tool form cutters
iv. Slittingg or p
parting
g tools v Tslotcutters
v. T slotcutters
v. End milling cutters with straight or taper shank vi. Threadmillingcutter
vi Face milling cutters.
vi. cutters
For-2015 (IES, GATE & PSUs) Page 92 of 240 Rev.0
Sid d l t illi tt
Sideandslotmillingcutters Slitti ti t l
Slittingsaworpartingtool E d illi tt E d ill
EndmillingcuttersorEndmills

F illi tt
Facemillingcutters U ff li d ( illi )
Useofformrelievedcutters(milling)
Toolformcutters

T slotcutter
T l t tt G t th illi tt
Gearteethmillingcutters S li shaftcutters
Spline h ft tt

For-2015 (IES, GATE & PSUs) Page 93 of 240 Rev.0


St ddl illi
Straddlemilling IES 1995,ISRO2010
IES 1995 ISRO 2010 G illi
Gangmilling
In a milling operation two side milling cutters are
mounted with a desired distance between them so
that both sides of a work piece can be milled
simultaneously. This set up is called.
(a) Gang milling (b) Straddle milling
(c) String milling (d) Side milling.

IES 2006
IES IES 2009
IES
IAS2009Main Gang milling is a For machining, which one of the following gang
(a) Milling process for generating hexagonal surfaces milling operations is employed?
With a sketch, explain the principle of working
(b) Process
P off cutting
tti gears (a) Threads
and variations of bedtype milling machine. (b) Bores
(c) Process in which two or more cutters are used
[9marks] simultaneously (c) Grooves
((d)) Milling
g operation
p combined with turning
g ((d)) Steps
p on p
prismatic p
parts

T i b l ( illi )
Turningbyrotarytools(millingcutters) I d i
Indexing Si l Pl i I d i
SimpleorPlainIndexing
y Plain indexing is the name given to the indexing method
carried out using any of the indexing plates in
conjunction with the worm.

For-2015 (IES, GATE & PSUs) Page 94 of 240 Rev.0


IES 2004,ISRO2011
IES 2004 ISRO 2011 IES 2000
IES IAS 1994
IAS
One brand of milling machine has the following two One of the index plates of a milling machine A standard dividing head is equipped with the
index plates supplied along with the indexing head: dividing head has the following hole circles: 15; 16; following index plates
Plate 1: 15, 16, 17, 18, 19, 20 hole circles 17; 18; 19; 20 1 Plate with 12,
1. 12 16,
16 17,
17 18,
18 19,
19 20 holes circles
Plate 2: 21, 23, 27, 29, 31, 33 hole circles A gear wheel of 34 teeth has to be milled by simple 2. Plate with 21, 23, 27, 29, 31, 33 holes circles
It is proposed to mill a spur gear of 28 teeth using simple indexing method.
method To machine each tooth,tooth the index 3. Plate with 37, 39, 41,43,47,49 holes circles
indexing method. Which one of the following combinations crank has to be rotated through
of index plate and number of revolutions is correct? For obtainingg 244 divisions on a work p piece byy simple
p
( ) 17 holes
(a) h l in i the
th 20hole
h l circle
i l indexing
(a) Plate 1: 1 revolution and 9 holes in 18 hole circles
(b) 18 holes in the 20hole circle (a) Hole plate 2 alone can be used
(b) Plate 2:2 1 revolution
re olution and 9 holes in 21 hole circles
(c) 1 revolution and 3 holes in 17hole circle (b) Hole plates 1 and 2 can be used
(c) Plate 2: 1 revolution and 9 holes In 33 hole circles
(d) 1 revolution and 2 holes in 18
18hole
hole circle ( ) Hole
(c) H l plates
l t 1 and d 3 can be
b used d
( ) Plate 1: 1 revolution and 9 holes In 15 hole circles
(d)
(d) Any of the three hole plates can be used

Milli V l it
MillingVelocity Milli Ti
MillingTime Example
y The cutting speed in milling is the surface speed of the AC50steelflatsurfaceofdimensions100mm 250
milling cutter. y Time for one pass =
L + 2 A minutes mmistobeproducedonahorizontalaxismilling
DN
DN fZN machine.AnHSSslabmillwitha100mmdiameter
V= y Approach distance,
2
D D
2

A = d = d (D d )
and150mmwidthistobeusedforthepurpose.The
1000 2 2 millingcutterhas8teeth.
Calculatethemachiningtimeassumingthatentire
stockcanberemovedinonedepthof2mm.
stockcanberemovedinonedepthof2mm
Given,
Feed,f=0.13mm/tooth,
Cuttingspeed,V=20m/min.
g p

MRR i Milli
MRRinMilling Some Formulae for Milling
SomeFormulaeforMilling GATE 2014
GATE
Consideringtheparametersdefinedinthediscussionof 2f d Two
T separate
t slab
l b milling
illi operations,
ti 1 and
d 2, are
speedsandfeeds,etc,theMRRisgivenbelow, Maximum uncut chip thickness (t max ) =
NZ D performed with identical milling
p g cutters. The depth
p of
Where,
Where
f d
Average uncut chip thickness (t a vg ) = cut in operation 2 is twice that in operation 1. The other
MRR = wd F NZ D
f2
cutting parameters are identical. The ratio of maximum
where,w=widthofcut, d=depthofcut
p Peak to valley surface roughness (h max ) = uncutt chip
hi thicknesses
thi k i operations
in ti 1 and
d 2 is
i
4DN 2 Z 2

For-2015 (IES, GATE & PSUs) Page 95 of 240 Rev.0


GATE 1995
GATE GATE 1993
GATE IES 2003
IES
List
ListII List
List II A milling cutter having 8 teeth is rotating at 150 In milling machine, the cutting tool is held in
(Manufacturing Processes) (Condition) rpm. If the feed per tooth is 0.1 mm, the table speed position by
(A) Finish
Fi i h turning
t i 1. B kl h eliminator
Backlash li i t in mm per minute is (a) Chuck (b) Spindle
(B) Forming 2. Zero rake (a) 120 (b) 187 (c) Arbor (d) Tool holder
(C) Thread cutting 3. Nose radius ( ) 125 (d) 70
(c)
(D) Down milling 4. Low speed
Codes:A B C D A B C D
( ) 2
(a) 3 4 1 (b) 3 4 1 2
(c) 1 2 3 4 (d) 4 1 2 3

IES 2009
IES IES 1994
IES IES 1992
IES
The arbor of a milling machine is used to hold Consider the following operations: A set of eight form relieved milling cutters for each
which one of the following? 1. Cutting key ways on shafts module is provided to enable cutting of gears of
(a) Spindle (b) Overarm
Over arm 2. Cutting
C tti external
t l screw threads.
th d different
(c) Cutting tool (d) Mandrel 3. Cutting teeth of spur gears (a) Materials
4. Cutting external splines. (b) Types
T e.g. spur, helical,
h li l etc.
t
Those which can be performed with milling cutters (c) Number of teeth
would include (d) Width of gears
(a) 1 and 2 (b) 2,3
2 3 and 4
(c) 1 and 3 (d) 1,2,3 and 4 .

GATE 1992
GATE IES 1995
IES IES 2005
IES
In horizontal milling process. (up/down) Assertion (A): Up milling or climb milling is Which one of the following statements is correct?
milling provides better surface finish and.. commonly used for machining castings and In upmilling operation, the undeformed chip thickness,
(updown)
(up down) milling provides longer tool life. forgings. a)) Is
I zero att the
th start
t t off the
th cutt andd increases
i t a
to
Reason (R): Up milling can be done on universal maximum value just before the tooth disengages the
milling machines.
machines workpiece.
k i
(a) Both A and R are individually true and R is the b) Increases to the maximum value at the centre of the
correctt explanation
l ti off A travel and decreases towards the end of tooth
(b) Both A and R are individually true but R is not the engagement.
correct explanation of A c) Has a maximum value just after the cut is started and
(c) A is true but R is false p to zero at the end of the cut.
drops
For-2015 (IES, GATE & PSUs) (d) A is false but R isPage
true96 of 240 d) Remains unchanged. Rev.0
IES 1993
IES IES 2002
IES IES 2004
IES
Climb milling is chosen while machining because Assertion ((A): ) Virtually y all modern milling
g machines The cutting speed of a milling cutter while cutting
are capable of doing downmilling. brass is:
(a) The chip thickness increases gradually
Reason (R): In downmilling the cutter tends to push
(b) It enables
bl the
th cutter
tt tot dig
di in
i andd depth
d th off cutt the work along and lift it upward from the table. This (a) 45 to 60 m/min (b) 30 to 40 m/min
(c) The specific power consumption is reduced action tends to eliminate any effect in looseness in the (c) 25 to 35 m/min (d) 15 to 20 m/min
feed screw and nut of the milling machine table and
(d) Better surface finish can be obtained results in smooth cut.
(a) Both A and R are individually true and R is the correct
explanation of A
((b)) Both A and R are individuallyy true but R is not the
correct explanation of A
(c) A is true but R is false
(d) A is false but R is true

IES 1999
IES IES 2002
IES GATE 2012(PI)CommonDataS1
A straight teeth slab milling cutter of 100 mm A side and face cutter 125 mm diameter has 10 teeth. Data for a plain milling operation are given below.
below
diameter and 10 teeth rotating at 200 r.p.m. is used It operates at a cutting speed of 14 m/min with a Length of workpiece 200 mm
to remove a layer of 3 mm thickness from a steel bar. table traverse 100 mm/min. The feed per tooth of
Cutter diameter 100 mm
If the table feed is 400 mm/minute, the feed per the cutter is
tooth in this operation will be No. of teeth 4
(a) 10 mm (b) 2.86
2 86 mm
(a) 0.2 mm (b) 0.4 mm Cutter speed 100 rpm
(c) 0.286 mm (d) 0.8 mm
( ) 0.5 mm
(c) (d) 0.66 mm Feed 200 mm/min
Depth of cut 2 mm
Total clearance (entry
( and exit)) 5 mm
Mean undeformed chip p thickness (in microns) is
(a) 142 (b) 100 (c) 71 (d) 50

GATE 2012(PI)CommonDataS2 IES 2004


IES IAS 2001
IAS
(
Match List I (Milling g pproblem)) with List II ((Probable Which one of the following statements are correct in respect of
Data for a plain milling operation are given below.
below upmilling
illi and d downmilling?
d illi ?
causes) and select the correct answer using the codes
Length of workpiece 200 mm 1. In upmilling the cutter rotates in a direction opposite to that of
given below the Lists: workpiece travel whereas in downmilling the cutter rotates in a
Cutter diameter 100 mm List I List II di
direction
i similar
i il to that
h off workpiece
k i travel.
l
2. In downmilling chip will be thin at the beginning and increase to a
No. of teeth 4 A. Chatter 1. Too high feed maximum at the end of the cut and reverse will be the case for a chip p
B. Poor surface finish 2. Lack of rigidity in machine f
formed d by
b upmilling.
ll
Cutter speed 100 rpm 3. Downmilling is desirable with milling cutters having a high radial
fixtures, bar or workpiece
g when compared
rake angle p to upmilling.
p g
Feed 200 mm/min C Loss
C. L off accuracy 3. Hi h cutting
High i load
l d 4. Downmilling forces the workpiece against the milling table to
Depth of cut 2 mm D. Cutter burrs 4. Radial relief too great exert more pressure while upmilling tends to lift the workpiece from the
table.
Total clearance (entry
( and exit)) 5 mm 5. Not enough h lubricant
l b Select the correct answer using the codes given below:
g g p
Machiningtimeforasinglepass(inseconds)is Codes:A B C D A B C D Codes:
( ) 2
(a) 1 5 3 ( ) 2
(b) 1 3 5 (a) 1,1 2 and 3 (b) 1 2 and 4
1,
(a)60 (b)66 (c)126
For-2015 (IES, GATE &(d)150
PSUs) 2 Page
3 97(d)of 2404 Rev.0
(c) 3 and 4 (d) 1, 3 and 4
(c) 4 5 2 3 5
IAS 1998
IAS IAS 2001
IAS IAS 2000
IAS
Which of the following g statements are true of face Which of the following mechanisms are suitable for Consider the following mechanisms:
milling? indexing the table of rotary transfer line? 1. Geneva gearing
1. Face milling g cutter is held on an arbor. 1 Rack and pinion
1. 2
2. Ratchet and pawl 2. Rack
R k and d pinion
i i
2. It has two rake angles axial rake and radial rake. 3. Lead screw 4. Geneva mechanism 3. Ratchet and pawl
3 The maximum chip thickness equals the feed per
3.
tooth. Select the correct answer by using the codes given below: Which of these mechanisms are used to index the work
4 The chip thickness varies from a minimum at the
4. Codes: table on a transfer machine?
start of cut to a maximum at the end of cut. (a) 1, 2 and 3 (b) 2, 3 and 4 (a) 1 and 2 (b) 2 and 3
Select the correct answer using the codes given below: (c) 1,
1 3 and 4 (d) 1, 1 2 and 4 (c) 1 and 3 (d) 1,
1 2 and 3
Codes :
(a) 1 and 2 (b) 2 and 3
(c) 2 and 4 (d) 3 and 4

IAS 2003
IAS S 99
IES1994 IES 2012
IES
A milling cutter of 70 mm diameter with 12 teeth is Whichoneofthefollowingoperationsiscarriedout Statement ((I):
) Vibrations in milling g are induced due to
operating at a cutting speed of 22 m/min and a feed attheminimumcuttingvelocityifthemachinesare interrupted cutting operation.
of 0.05 mm/tooth. The feed per minute is equallyrigidandthetoolworkmaterialsarethe Statement (II):Vibrations can be suppressed to a large extent
by using equal spacing of teeth along the periphery of the
(a) 110 m/min (b) 35 mm/min same? cutters.
( ) 6 mm/min
(c) / i (d) 60 6 mm/min
/ i (a) Turning ( ) Both
(a) B h Statement
S (I) and
d Statement
S (II) are individually
i di id ll
(b) Grinding true and Statement (II) is the correct explanation of
Statement (I)
(c) Boring
(b) Both Statement (I) and Statement (II) are individually
((d)) Milling
g true but Statement ((II)) is not the correct explanation
p of
Statement (I)
(c) Statement (I) is true but Statement (II) is false
(d) Statement (I) is false but Statement (II) is true

IES 2011
IES2011 IES 2002
IES
MatchListIwithListIIandselectthecorrectanswerusing
Match List I with List II and select the correct
thecodegivenbelowthelists:

ListI ListII
answer: GearManufacturing
G M f t i
List I (Machine tools) List II (Machine tool parts)
A.Lathe 1.Flute A. Lathe 1. Lead strew
B.Shaper 2.Universalindexing B. Milling machine 2. Rocker arm
C. Shaper
p 33. Universal indexing
g
C D illi
C.Drillingmachine
hi 3.Leadscrew
L d
D. Drilling machine 4. Flute
D.Millingmachine
C d
Codes
g 4.Rockerarm
4 Codes:A B C D A B C D
A B C D A B C D (a) 4 2 3 1 (b) 1 3 2 4 BySKMondal
((a)) 2 4 1 3 (b) 3 4 1 2 (c) 4 3 2 1 (d) 1 2 3 4
(c) 2 1 For-2015
4 (IES,
3 GATE
(d) &3PSUs)
1 4 2 Page 98 of 240 Rev.0
M f t fG
ManufactureofGears F i dG ti
FormingandGeneration Sunderlandmethodusingracktypecutter
Manufacture of gears needs several processing operations in
sequentiall stages depending
d d upon theh materiall and d type off the
h Gear teeth are produced by machining based on y The rack type HSS cutter (having rake and
gears and quality desired. Those stages generally are: clearance angles) reciprocates to accomplish the
y Preforming the blank without or with teeth Forming
g where the p
profile of the teeth are obtained as
machining
hi i ( tti ) action
(cutting) ti while
hil rolling
lli t
type
y Annealing of the blank, if required, as in case of forged or
cast steels the replica of the form of the cutting tool (edge); e.g., interaction with the gear blank like a pair of rack
y Preparation of the gear blank to the required dimensions milling, broaching etc. and pinion.
by machining
y Producing teeth or finishing the preformed teeth by b Generation where the complicated tooth profile are
machining
y Full or surface hardening of the machined gear (teeth), if provided by much simpler form cutting tool (edges)
required
y Finishing teeth, if required, by shaving, grinding etc through rolling type, tool work motions, e.g., hobbing,
y Inspection of the finished gears
gear shaping etc. External gear teeth generation by rack type cutter (Sunderland method)

Sunderlandmethodusingracktypecutter G h i
Gearshaping G h i
Gearshaping
y Gear shaping is similar to the rack type cutting process, y Generation method is characterised by
y automatic indexing
g
y Applicationsofthismethod(andmachine)include:
A li ti fthi th d( d hi )i l d and ability of a single cutter to cover the entire range of
excepting that, the linear type rack cutter is replaced by a
number of teeth for a given combination of module and
y Moderatesizestraightandhelicaltoothedexternal circular cutter where both the cutter and the blank pressure anglel and d hence
h provides
id high
hi h productivity
d ti it and d
rotate as a pair of spur gears in addition to the economy.
spurgearswithhighaccuracyandfinish
reciprocation of the cutter. y The gear type cutter is made of HSS and possesses proper
y Cuttingtheteethofdoublehelicalorherringbone rake and clearance angles.
y The additional advantages of gear shaping over rack type
gearswithacentralrecess(groove) cutting are:
Separate
p indexing g is not required
q at all
y Cuttingteethofstraightorhelicalflutedclustergears
C i h f i h h li lfl d l
Straight or helical teeth of both external and internal

y Howeverthismethodneeds,thoughautomatic,few
Howeverthismethodneeds thoughautomatic few p g
spur gears can be p produced with high g accuracyy and
finish
indexingoperations. Productivity is also higher.

G H bbi
GearHobbing G H bbi
GearHobbing Ad t fG H bbi
AdvantagesofGearHobbing
y The HSS or carbide cutter having
g teeth like g g
gear milling (a) The method is versatile and can generate spur,
cutter and the gear blank apparently interact like a pair y Having
H i lesser
l number
b (only
( l three)
th ) off tool
t l work
k
helical, worm and worm wheels.
of worm and worm wheel.
motions,, hobbing
g machines are much more rigid,
g , strong
g (b) Since gear hobbing is a continuous process,
process it is
y The
Th hob
h b (cutter)
( ) looks
l k and d behaves
b h lik a single
like i l or
multiple start worms. and productive than gear shaping machine. rapid; economical and highly productive.
( ) The
(c) Th method
th d produces
d accurate
t gears and d is
i suitable
it bl
y But hobbing provides lesser accuracy and finish and is for medium and large batch production.
used
d only
l for
f cutting straight
h or helical
h l l teeth
h (single)
( l ) off (d) The cutter is universal, because it can cut all gears of
same module, irrespective of number of teeth on the
external spur gears and worm wheels.
wheels
gear.

(a)Straight(b)helicaltoothand(c)wormwheel
For-2015 (IES, GATE & PSUs) Page 99 of 240 Rev.0
Di d t f H bbi
DisadvantagesofgearHobbing Milli
Milling Milli
Milling
(a) Gear hobbing cannot generate internal gears and y Gear teeth can be p
produced byy both disc and end mill type
yp g
Production of gear teeth byy form milling
g are characterised
form milling cutter. by:
bevel gears. y Use of HSS form milling cutters
(b) Enough h space has
h to be
b there
h in component y Use of ordinary milling machines
configuration for hob approach. y Low p
production rate for
Need of indexing after machining each tooth gap
ApplicationsofHobbing
pp g Slow speed and feed
y Low accuracy and surface finish
y The gears produced by gear hobbing are used in y Inventory problem due to need of a set of eight cutters for
automobiles, machine tools, various instruments, clocks Fig. (a) disc type and end mill type for each module pressure angle combination
( ) single
(b) g helical and y End mill type
yp cutters are used for teeth of large
g ggears and / or
and other equipments. (c) double helical teeth module.

Sh i Pl i d Sl tti
Shaping,PlanningandSlotting F d i f h f
Fastproductionofteethofspurgears
y Straight toothed spur gear can be produced in shaping Parallel multiple teeth
machine. shaping
y Both productivity and product quality are very low in y It is similar to ordinary
this process which therefore, is used, if at all, for making shaping but all the tooth gaps
one or few teeth on one or two pieces of gears as and are made simultaneously,
simultaneously
when required for repair and maintenance purpose. without requiring indexing,
y Planning
Pl i andd slotting
l tti machines
hi work k on the th same by a set of radially in feeding
principle. Planning machine is used for making teeth of single point form tools.
l
large gears whereas
h slotting
l tti for
f internal
i t l gears. y This
Thi oldld process was highly
hi hl
productive but became almost
obsolete
b l t for
f very high
hi h initial
i iti l
Fig gearteethcuttinginordinaryshapingmachine
and running costs.

F d i f h f
Fastproductionofteethofspurgears M f t f b lli
Manufactureofgearsbyrolling
Broaching y The straight and helical teeth of disc or rod type external
y Teeth of small internal and external spur gears; straight steel gears of small to medium diameter and module are
or single helical,
helical of relatively softer materials are generated by cold rolling by either flat dies or circular
produced in large quantity by broaching. dies.
y This
Thi method
th d leads
l d tot very high
hi h productivity
d ti it and d quality
lit y Such rolling imparts high accuracy and surface integrity
but cost of machine and broach are very high. of the teeth which are formed by material flow unlike
cutting.
cutting
y Gear rolling is reasonably employed for high productivity
andd high
hi h quality
lit though
th h initial
i iti l machinery
hi costs
t are
relatively high.
y Larger size gears are formed by hot rolling and then
For-2015 (IES, GATE & PSUs) Page 100 of 240 Rev.0
finished by machining.
Powder Metallurgy
PowderMetallurgy Wire EDM
WireEDM Casting
y Small size high quality external or internal spur, bevel or y Geometrically accurate but moderately finished straight y Sandcasting
spiral gears are also produced by powder metallurgy toothed metallic spur gears, both external and internal y Metalmouldcasting
process. type, can be produced by wire type Electro
Electrodischarge
discharge y Diecasting
Di ti
y Large size gears are rolled after briquetting and sintering Machining (EDM).
y Investmentcasting
for more strength and life.
life
y Shellmouldcasting
y Powder metallurgically produced gears hardly require
y Centrifugalcasting
any further
f th finishing
fi i hi work. k

G fi i hi
Gearfinishingprocess G h i
Gearshaving
yO
One of the g
goals of the g gp
gear finishing process in g
gears is y A micro finishing film is affixed to the mold and the yG g is a g
Gear shaving g operation
gear finishing p g
with high
to obtain a certain level of toughness in the gear teeth to mold is placed relative to a gear tooth so that the micro efficiency and high precision.
reduce and/or eliminate bending and contact fatigue finishing film rests against a tooth surface having the y When a work g
gear has been shaved byy a shaving
g cutter
failures. undulation error. with a true involute profile, the ''midconcave''
y Reduction of index undulation errors associated with phenomena inevitably exist around the pitch points of
y The grit size of the micro finishing film is such as to
helical gear teeth caused by the grinding process during the work gear tooth flanks.
the manufacture of the gears without degrading other remove approximately 2 to 3 millionths of gear material
y Aiming at this problem, a newstyle shaving cutter with
gear accuracies
i (e.g.
( profile,
fil tooth
t th spacing)
i ) below
b l l l
levels with each pass through the teeth by the mold.
mold Multiple unequal depth gashes is designed and manufactured.
required for precision (AGMA16 or DIN1) gears. passes are made by hand until the undulation error is
y This paper analyses the forming of the gash on the basis
y A mold ld off the
th space between
b t severall gear teeth
t th is i reduced to an acceptable value.
value During the process the of the slotting principle, and proposes a gashdesigning
obtained, with the mold having a length equal to or micro finishing film is replaced after approximately 3 or method.
greater than the wavelength of the undulation error to be 4 passes and the process is repeated for each tooth of the y Experiment has proven that the shaved gear has a better
reduced. gear. surface finish that achieves the anticipated effect.

G b i hi
Gearburnishing G L i
GearLapping IES 1992
IES
y Gear lapping is used to finish hardened gears by Gear lapping
y It is designed
d d to remove or reduce
d gear tooth
h nicks
k and
d
(a) An operation after heat treatment
correcting small errors in spacing, profile, helix
burrs along with improving the smoothness of the
burrs, (b) An
A operation
ti prior
i tot heat
h t treatment
t t t
angle, and eccentricity.
tooth's active p
profile finish. (c) An independent operation for gear reconditioning
y The operation is performed with all forms of gears (d) None of the above
y The action of the burnishing
g dies on the tooth surface
running
i together
t th with
ith mating
ti gears, and
d castt iron
i
allows the machine to accomplish these quality toothed laps,
p , under a flow of fine oil mixed with
improvements without altering the tooth profile or lead. an abrasive compound.

y Both internalFor-2015 (IES, gears


and external GATEare
& PSUs)
possible to burnish. Page 101 of 240 Rev.0
IES 1999
IES IES 2006
IES IES 2005
IES
Consider the following processes for the Which of the following is/are used for cutting In helical milling, the ratio of the circumference of
manufacture of gears: internal gears? the gear blank to the lead of the helix determines
1 Casting
1. 1 Gear hobber
1. 2
2. Gear shaper the:
2. Powder metallurgy 3. Rack cutter 4. Jig borer (a) Proper speed to use
3. Machining from bar stock Select the correct answer using the codes given below: (b) Proper
P f d and
feed d depth
d th off cutt required
i d
4. Closed die forging
4 g g ((a)) Onlyy 1 and 2 ((b)) Onlyy 2 and 3 (c) Angle setting of the machine table
The correct sequence in increasing order of bending (c) Only 1 and 4 (d) Only 2 (d) Gear ratio for table screw and dividing head
strength of gear teeth is
(a) 1, 2, 3, 4 (b) 1, 2, 4, 3
( ) 2, 1, 4, 3
(c) (d) 2, 1, 3, 4

IES 2010
IES2010 IES 1996
IES IES 2000
IES 2000
Match List I with List II and select the correct answer using Gear cutting on a milling machine using an involute Which one of the following processes of gear
the code given below the lists:
profile cutter is a manufacture results in best accuracy of the involute
List I List II
(a) Gear forming process gear tooth profile?
(Type of work) (Manufacturing)
(b) Gear generating process. (a) Milling
A. High rate production of worm Gears and 1. Gear shaving
worm wheel (c) Gear shaping process (b) Hobbing
H bbi
B. Generating internal gears and Cluster gears 2. Gear milling ((d)) Highly
g y accurate g
gear p
producing
gpprocess. (c) Rotary gear shaper
C. Finishing of gear tooth profiles 3. Gear hobbing (d) Rack type gear shaper
D. Repair and piece production of gears 4. Gear shaping
A B C D A B C D
(a) 2 1 4 3 (b) 3 1 4 2
(c) 2 4 1 3 (d) 3 4 1 2

IES 2009
IES IES 1996
IES IES 2009
IES
Assertion ((A): ) Gears p produced by y employing
p y g form Consider the following processes of gear By which one of the following machines the teeth of
cutting principle using gearmilling cutter on a milling manufacture: an internal spur gear can be cut accurately?
machine are not very accurate.
Reason (R): Production of the correct gear tooth profile 1 Milling with form cutter
1. (a) Milling machine
employing formcutting principle would require a 2. Rack type gear shaper (gear planer) (b) Slotting machine
separate cutter for cutting different numbers of teeth 3. Rotary gear shaper (gear shaper) (c) Hobbing machine
even for the same module and also errors are associated
with inaccurate operation
p of indexing
g mechanism. 4. Gear hobbing
4 g ((d)) Gearshaping
p g machine
(a) Both A and R are true and R is the correct explanation of The correct sequence of these processes in increasing
A order of accuracy of involute profile of the gear
(b) Both A and R are true but R is NOT the correct
explanation of A
(a) 3, 2, 4, 1 (b) 2, 3, 4, 1
(c) A is true but R is false ( ) 3, 2, 1, 4
(c) (d) 2, 3, 1, 4
For-2015 (IES, GATE & PSUs) Page 102 of 240 Rev.0
(d) A is false but R is true
IES 2004
IES IES 1992
IES IES 2003
IES
Gear shaping is a process of manufacturing gears. In gear hobbing A spur gear of 40 teeth is machined in a gear
Which one of the following principles is employed by it? (a) Only hob rotates hobbing machine using a double start hob cutter.
( ) Form
(a) F cutting
tti withith cutter
tt (b) Only
O l gear blank
bl k rotates
t t The speed ratio between the hob and the blank is
(b) Generating tooth form with a reciprocating cutter (c) Both hob and gear blank rotate (a) 1:20 (b) 1:40
(c) Generating tooth form by a rotating cutter (d) Neither hob nor gear blank rotates ( ) 40: 1 (d) 20: 1
(c)
(d) Generating form with a reciprocating and revolving
cutter

IES 2008
IES IES 1999
IES IES 1997
IES
Which machining processes are used for gear A 60 teeth gear when hobbed on a differential
60teeth Which of the following motions are not needed for
manufacture? hobber with a twostart hob, the index change gear spur gear cutting with a hob?
1 Form milling
1. 2
2. Broaching ratio is governed by which one of the following 1 Rotary motion of hob
1.
3. Roll forming 4. Hobbing kinematic balance equations? 2. Linear axial reciprocator motion of hob
Select the correct answer using the code given below: (a) 1 revolution of gear blank = 1/60 of hob revolutions 3. Rotary motion of gear blank
((a)) 1, 2 and 3 ((b)) 1, 3 and 4 (b) 1 revolution of gear blank = 2/60 of hob revolutions 4. Radial advancement of hob.
4
(c) 1, 2 and 4 (d) 2, 3 and 4 (c) 1 revolution of hob = 2/60 of blank revolutions Select the correct answer using the codes given below:
((d)) 1 revolution of hob = 1/60 of blank revolutions (a) 1,
1 2 and 3 (b) 1, 1 3 and 4
(c) 1, 2 and 4 (d) 2, 3 and 4

IES 2007
IES GATE 2007(PI)
GATE 2007 (PI) IES 1993
IES 1993
Which of the following methods are gear generating Which one of the following gear manufacturing Internal gear cutting operation can be performed by
processes? processes is NOT based on generation principle? (a) Milling
1 Gear shaping
1. ( ) Gear
(a) G H bbi
Hobbing (b) Gear
G Sh i
Shaping (b) Shaping
Sh i with ith rack
k cutter
tt
2. Gear hobbing (c) Shaping with pinion cutter
((c)) Gear Milling
g ((d)) Gear Shaving
g
3. Gear milling (d) Hobbing
Select the correct answer using
g the code g
given below:
(a) 1, 2 and 3 (b) 1 and 2 only
(c) 2 and 3 only (d) 1 and 3 only

For-2015 (IES, GATE & PSUs) Page 103 of 240 Rev.0


IAS 1998
IAS IES 2006
IES IES 1996
IES
Assertion (A): Internal gears are cut on a gear Which of the following cannot be cut by hobbing For the manufacture of full depth spur gear by
shaper. process? hobbing process, the number of teeth to be cut = 30,
Reason (R): Hobbing is not suitable for cutting (a) Helical gears (b) Bevel gears module = 3 mm and pressure angle = 20
20.. The radial
internal gear. (c) Worm gears (d) Spur gears depth of cut to be employed should be equal to
( ) Both
(a) B th A and d R are individually
i di id ll true
t and
d R is
i the
th (a) 3.75
3 75 mm (b) 4.50
4 50 mm
correct explanation of A (c) 6.00 mm (d) 6.75 mm
(b) Both A and R are individually true but R is not the
correct explanation of A
(c) A is true but R is false
(d) A is false but R is true

IES 1995
IES IES 1992
IES IAS 2003
IAS
While cutting helical gears on a non differential
nondifferential Gear burnishing process for Which one of the following is not a feature of gear
gear hobber, the feed change gear ratio is (a) Removing residual stresses from teeth roots hobbing process?
(a) Independent of index change gear ratio (b) Surface
S f fi i hi
finishing (a) High rate of production
(b) dependent on speed change gear ratio (c) Undercut gears (b) Generation of helical gears
(c) Interrelated to index change gear ratio (d) Cycloidal gears (c) Very accurate tooth profile
((d)) Independent
p of speed
p and index changeg g
gear ratio. ((d)) Generation of internal g
gears

IAS 2001
IAS IES 1994
IES
Consider the following motions and setting in a Consider the following machine tools:
hobbing machine: 1. Hobbing machine
1 Hob rotation
1.
2. Job rotation
2. Gear
G shaping
h i machine
3. Broaching machine.
hi
ScrewThread
S Th d
3. Axial reciprocating hob rotation
4. Tilting
4 g of hob to its helix angle
g
The teeth of internal spur gears can be cut in
(a) 1, 2 and 3 (b) 1 and 2
Manufacturing
f i
Which of these motions and setting in a hobbing (c) 1and 3 (d) 2 and 3
machine are required to machine a spur gear?
(a) 1, 2 and 3 (b) 2, 3 and 4
( ) 1, 2 and
(c) d 4 (d) 1, 3 and d4
For-2015 (IES, GATE & PSUs) Page 104 of 240 Rev.0
BySKMondal
Thread Cutting
ThreadCutting Thread Cutting on Lathe
ThreadCuttingonLathe
Processes,MachinesandTools External Internal y Can cut both external and
UsedForProducingScrewThreads Threading on a lathe Threading (on a lathe or Internal thread
Threading g on a NC lathe NC lathe)) y Thread cutting g is a form
(a)Machining With a die held in a stock With a tap and holder cutting operation an
((manual)) ((manual NC,, machine,, accuratelyy shaped
p tool is
(b)Rolling With an automatic die semiautomatic, or used (with zero rake)
((turret lathe or screw automatic)) y The lead screw and the
( )G i di
(c)Grinding machine) or NC lathe With a collapsible tap split nut, which provide
y milling
By g ((turret lathe,, screw positive motion of the
By Grinding machine, or special carriage relative to the
threadingg machine)) rotation of the spindle.
spindle
By milling

Th d T i
ThreadTapping Thread Milling
ThreadMilling
C i h d ih i
CuttingThreadswithDies y Highly accurate threads,
y Straight
g and tapered
p external threads can be cut q
quicklyy y Cutting
g internal thread byy a multiplepoint
p p tool is called
particularly in larger
manually by means of threading dies. thread tapping, and the tool is called a tap.
sizes, are often form
y Dies are made of carbon or high
highspeed
speed tool steel y A hole of diameter slightly larger than the minor milled Either a single or
milled.
diameter of the thread must already exist. a multipleform Cutter
Th flutes
The fl t on tap
t create t cutting
tti may be used.
used
edges on the thread profile and y The milling cutter is
provide
d space for
f theh chips
h andd tilted
il d at an angle l equall
the passage of cutting fluid. to the helix angle of the
Taps are made of either carbon thread
h d and d is
i fed
f d inward
i d
g p
or highspeed steel and coated radially to full depth
(a)Solidthreadingdie;(b)solidadjustablethreadingdie while
hil the
h work k is
i
with TiN.
stationary.

Th d G i di
ThreadGrinding Th d R lli
ThreadRolling GATE 2003
GATE
y Grinding can produce y Thread rolling
g is used to p
produce threads in substantial Qualityscrewthreadsareproducedby
very accurate threads,
h d and d quantities.
it also permits threads to (a) Threadmilling
be produced in hardened y Cold
Coldforming
forming process operation in which the threads are (b) Threadchasing
Th d h i
materials. formed by rolling a thread blank between hardened dies
(c) Threadcuttingwithsinglepointtool
y A singleribbed
single ribbed grinding that cause the metal to flow radially into the desired
wheel is employed, but shape. (d) Threadcasting
multipleribbed
multiple ribbed wheels y Chip less process,
process
are used occasionally.
fast and economical.
y Centerless thread
grinding is used for y Mechanical properties
making g headless sets are good.
g
screws.
For-2015 (IES, GATE & PSUs) Page 105 of 240 Rev.0
IES2011 IES 2010
IES2010 IES 2007
IES
External threads can be produced by : For producing both internal and external Screw threads are produced on solid rods by using
1. Rolling screw threads, the method used is which of the following?
2. Grinding ( ) Thread
(a) Th d chasing
h i with ith multiplerib
lti l ib chasers
h (a) Dies (b) Punch
(c) Mandrel (d) Boring bar
33. Milling
g ((b)) Thread milling
g and multiplethread
p cutters
(a) 1 and 3 only (c) Thread tapping with taps
(b) 1 and 2 only (d) Die
Di threading
h di with i h selfopening
lf i die
di heads
h d
(c) 2 and 3only
( ) 1, 2 and 3
(d)

IES 2012
IES
ISRO2011 ISRO2010 The differential screw is used in a
(a) Turnbuckle
Whichofthefollowingscrewthreadisadaptedfor Internal and external threads can be produced
(b) Micrometer
Mi t
powertransmissioninonedirection on tapered surfaces conveniently by (c) Vernier Caliper
(a)Acmethreads (a) Universal milling machine (d) Coupler

( )
(b)Buttressthreads (b) Plano
l miller
ll
(c)Squarethreads (c) Planetary milling machine
(d)Multiplethreads (d) lathe

IES 2012
IES IES 2012
IES
Multistart threads are used to get Which of the following screw threads is adopted for
(a) Smaller linear displacement power transmission in either direction
(b) Larger
L li
linear di l
displacement
t with
ith assured
d self
lf locking
l ki (a) ACME threads
(c) Larger linear displacement with no guarantee of self
locking
(b) Square threads
(c) Buttress threads
Shaper,Planner,Slotter
((d)) None of the above ((d)) Multiple
p threads

B SKM d l
BySKMondal

For-2015 (IES, GATE & PSUs) Page 106 of 240 Rev.0


Sh
Shaper Sh
Shaper Quick return motion Mechanism
QuickreturnmotionMechanism
y The relative motions between the tool and the workpiece,
shaping and planing use a straightline cutting motion with a
singlepoint
g p cuttingg tool to g
generate a flat surface.
y In shaping, the workpiece is fed at right angles to the cutting
motion between successive strokes of the tool.
y For either shaping or planing, the tool is held in a clapper box
which pprevents the cutting g edge
g from being g damaged
g on the
return stroke of the tool.
y Relatively
y skilled workers are required
q to operate
p shapers
p and
planers, and most of the shapes that can be produced on
them also can be made byy much more p productive p processes,
such as milling, broaching, or grinding.

Q i k t ti M h i
QuickreturnmotionMechanism
y In shaping, the cutting tool is held in the tool post RamDrive FeedMechanism
located in the ram, which reciprocates over the work y Themechanicalramdriveisaslottedarmquickreturn y Table feed is intermittent and is accomplished on the
with a forward stroke, cutting at velocity V and a quick motionmechanism,
motionmechanism
return stroke at velocity VR. return (non cutting) stroke when the tool has cleared
y The rpm rate of the drive crank (Ns) drives the ram and th workpiece.
the k i
determines the velocity of the operation.
y The cross feed is given to the table with the help of a
cutting stroke angle
y The stroke ratio, Rs = cross feed screw which is actuated by a pawl which
3600 engages a notched wheel (ratchet) keyed to the screw.

Cl ifi ti f Sh M hi
ClassificationofShaperMachine F l
Formula HydraulicShaper
Shapers,asmachinetoolsusuallyareclassified NL(1 + m)
accordingtotheirgeneraldesignfeaturesasfollows, y Cuttingspeed, V =
1000
1 Horizontal
1. w
y Numberofstrokes, N s =
a. Pushcut f
b. Pullcutordrawcutshaper L(1 + m)
y Timeofonestroke, t = min
2. Vertical 1000V
a. Regularorslotters L(1 + m) Lw(1 + m)
y Totaltime,T = Ns = min
b
b. Keyseaters 1000v 1000vf
3. Specialpurpose

For-2015 (IES, GATE & PSUs) Page 107 of 240 Rev.0


Advantagesofhydraulicshaping
Planer Slotter
y Planing can be used to produce horizontal, vertical, or y Slotting machine is basically a vertical axis shaper.
shaper Thus
y 1. Cutting speed remains constant throughout most of the cutting inclined flat surfaces on workpieces that are too large to the workpieces, which cannot be conveniently held in
stroke, unlike the crank shaper where the speed changes continuously.
be accommodated on shapers. shaper, can be machined in a slotter.
y 2. Since the power available remains constant throughout, it is possible y Planing is much less efficient than other basic y Generally, keyways, splines, serrations, rectangular
to utilise the full capacity of the cutting tool during the cutting stroke.
machining processes,
processes such as milling,
milling that will produce grooves and similar shapes are machined in a slotting
y 3. The ram reverses quickly without any shock due the hydraulic such surfaces. machine.
cylinder utilised. The inertia of the moving parts is relatively small.
y Planing
Pl i and d planers
l h
have l
largely
l been
b replaced
l d byb planer
l y The
Th stroke
t k off the
th ram isi smaller
ll ini slotting
l tti machines
hi
y 4. The range and number of cutting strokes possible are relatively large
in hydraulic shaper. milling machines or machines that can do both milling than in shapers to account for the type of the work that
and
d planing.
l i i handled
is h dl d in
i them.
th
y 5. More strokes per minute can be achieved by consuming less time for
reversal and return strokes.

Sl tt
Slotter Sl tt
Slotter
y The types of tools used in a slotter are very similar to
those in a shaper, except that the cutting actually takes
place in the direction of cutting.
y However, in view of the type of surfaces that are possible
in the case of slotter,
slotter a large variety of boring bars or
singlepoint tools with long shanks are used.

IAS 1994
IAS GATE 2012 (PI)
GATE2012(PI) GATE 2005
GATE
Stroke of a shaping machine is 250 mm. It makes 30 In
I a shaping
h i process, the
th number
b off double
d bl strokes
t k per A 600 mm x 30 mm flat surface of a plate is to be
double strokes per minute. Overall average speed of finish machined on a shaper. The plate has been
operation is minute is 330 and the q
quick return ratio is 0.6. If the fixed with the 600 mm side along the tool travel
(a) 3.75 m/min (b) 5.0 m/min length of the stroke is 250 mm, the average cutting direction. If the tool overtravel at each end of the
( ) 7.5 m/min
(c) / i (d) 15 m/min
/ i plate is 20 mm, average cutting speed is 8 m/min,
velocity in m/min is feed rate is 0.3 mm/stroke and the ratio of return
time to cutting time of the tool is 1:2, the time
( ) 3.0
(a) (b) 4.5 ( ) 7.5
(c) (d) 12.0
required for machining will be
(a) 8 minutes (b) 12 minutes
(c) 16 minutes (d) 20 minutes

For-2015 (IES, GATE & PSUs) Page 108 of 240 Rev.0


IES 1994,ISRO2008
IES 1994 ISRO 2008 GATE 2014
GATE2014 IES 2004
IES
Given that, average cutting speed = 9 m/min, the A castt iron
i block
bl k off 200 mm length
l th is
i being
b i shaped
h d in
i a Consider the following alignment tests on machine
return time to cutting time ratio is = 1 : 2, the feed tools
rate = 0.3 mm/stroke, the clearance at each end of shaping
p g machine with a depth
p of cut of 4 mm,, feed of 1 Straightness
1. 2
2. Flatness
cut = 25 mm and that the plate is fixed with 700 mm 0.25 mm/stroke and the tool principal cutting edge angle 3. Run out 4. Parallelism
side along the direction of tool travel, the time
required for finishing one flat surface of a plate of of 30o. Number of cutting strokes per minute is 60. Which of the above alignment tests on machine tools are
size 700 x 30 mm in a shaper, will be common to both lathe and shaper?
Ui
Using specific
ifi energy for
f cutting
tti J/mm3 the
as 1.49 J/ th
(a) 10 min (b) 12.5 min (a) 1 and 2 (b) 2 and 3
average
g ppower consumption
p ((in watt)) is . (c) 3 and 4 (d) 1 and 4
( ) 15 min
(c) i (d) 20 mini

IES 2001
IES IES 2010
IES2010 IES 1997
IES
Assertion ((A):) Longitudinal
g g motion of the
cutting Which of the following are the advantages of a
In
I a shaper
h machine,
hi the
th mechanism
h i for
f tool
t l feed
f d is
i
tool and crosswise feed motion of the job generates hydraulic shaper over a mechanically driven shaper?
(a) Geneva mechanism flat surfaces in p planning gp
process. 1 More strokes per minute can be obtained at a given
1.
Reason (R): Jobs used in planning machines are cutting speed.
(b) Whitworth mechanism generally long and heavy compared to shaping. 2. The
Th cutting
tti stroke
t k has
h a definite
d fi it stopping
t i point.
i t
(c) Ratchet and Pawl mechanism (a) Both A and R are individually true and R is the 3. It is simpler in construction.
correct explanation of A
(d) Ward Leonard system 4. Cutting speed is constant throughout most of the
(b) Both A and R are individually true but R is NOT the cuttingg stroke.
correctt explanation
l ti off A
Select the correct answer using the codes given below:
(c) A is true but R is false
(a) 1 and 2 (b) 1 and 4
(d) A is false but R is true
(c) 2 and 4 (d) 1, 3 and 4

IES 1995
IES IAS 1995
IAS
In a mechanical shaper, the length of stroke is Size
Si off a shaper
h is
i given
i by
b
ISRO2010
increased by The cutting speed of the tool in a mechanical
(a) Increasing the centre distance of bull gear and crank (a) Stroke length (b) Motor power shaper
h i
is
pin (a) Maximum at the beginning of the cutting stroke
(c) Weight
g of the machine (d) Table size.
(b) Decreasing
D i th centre
the t distance
di t off bull
b ll gear and d (b) Maximum at the end of the cutting stroke
crank pin
((c)) Maximum at the middle of the cutting
g stroke
(c) Increasing the length of the ram
(d) Minimum at the middle of the cutting stroke
((d)) Decreasing
g the length
g of the slot in the slotted lever

For-2015 (IES, GATE & PSUs) Page 109 of 240 Rev.0


AbrasiveMachiningProcesses
GATE2014 (PI)
GATE2014(PI) Process Features
Matchthefollowing Grinding Useswheels,accuratesizing,finishing,lowMRR;
canbedoneathighspeeds.
GroupI(Mechanism) GroupII(Machines)
Creepfeed Useswheelswithlongcuttingarc,veryslowfeed
PQuickreturn 1Lathe grinding
d rateandlargedepthofcut
dl d h f
QApron 2Shaping Abrasive HighMRR,toobtaindesiredshapesand
RIntermittentindexing 3Gearhobbing Grinding&Finishing machining
Abrasivewater
approximatesizes
Waterjetswithvelocitiesupto1000m/seccarry
SDifferentialmechanism
S e e t a ec a s 4Milling
4 g
jetMachining abrasiveparticles(silicaandgarnet)
Honing "Stones"containingfineabrasives;primarilya
(a)P1 Q2 R4 S3
(a)P1Q2R4S3 (b)P2 Q1 R4 S3
(b)P2Q1R4S3 h l finishingprocess
hole fi i hi
(c)P4Q1R2S3 (d)P2Q3R1S4 Lapping Fineparticlesembeddedinsoftmetalorcloth;
BySKMondal primarilyasurfacefinishingprocess
i il f fi i hi

Grinding Whyishighvelocitydesiredingrinding?
yG g is the most common form of abrasive
Grinding y It is desired to off set the adverse effect of very high
machining. negative rake angle of the working grit, to reduce the
y It is a material cutting
gpprocess which engages
g g an abrasive force per grit as well as the overall grinding force.
tool whose cutting elements are grains of abrasive
material known as grit.
y These grits are characterized by sharp cutting points,
high hot hardness, and chemical stability and wear
resistance.
y The grits are held together by a suitable bonding
material to give shape of an abrasive tool. Fig- cutting action of abrasive grains
y Grinding can be compared with milling with an infinite
number of cutting edge.

Advantages of Grinding
AdvantagesofGrinding Applications of Grinding
ApplicationsofGrinding Onwhichfactorsdoesthetransverseroughness
p p gg
ofworkpiecedependduringgrinding?g
y Dimensionalaccuracy
Di i l y Surfacefinishing
S f fi i hi

y Goodsurfacefinish y Slittingandparting y It mainly depends on the shape of the grits and overlap
cuts made by the grits in the transverse direction. Lateral
y Goodformandlocational accuracy
y y Descaling,deburring
g g plastic flow of the material as a result of ploughing also
influences the surface roughness.
y Applicabletobothhardenedandunhardenedmaterial y Stockremoval(abrasivemilling)

y Finishingofflataswellascylindricalsurface

y Grindingoftoolsandcuttersandresharpening ofthe
same
For-2015 (IES, GATE & PSUs) Page 110 of 240 Rev.0
G i di
Grinding Interactionofthegritwiththeworkpiece Interactionofthegritwiththeworkpiece
y If each abrasive grain is viewed as a cutting tool then in y Shape of grit is very important because it determines the y Grit with favourable geometry can produce chip in shear
grinding operation. grit geometry e.g. rake and clearance angle. mode.
High y The grits do not have definite geometry unlike a cutting y However,
However grits having large negative rake angle or
y Rake angle can be positive, zero, or negative ranging from tool. rounded cutting edge do not form chips but may rub or
+45o to 60
60o, dull,
dull rounded grits has large negative rake angle make a groove by ploughing leading to lateral flow of the
y Cutting speed is very high workpiece material.
y Very
V hi h specific
high ifi energy off cutting
i
Low
y Low shear angle
y Low feed rate
y Low depth of cut Fig Grits engage shearing, ploughing and rubbing

Howischipaccommodationvolumeis Specificenergyconsumptioningrinding Howmaythespecificgrindingenergyvary


relatedtomaterialremovalrate?
related to material removal rate? withmaterialremovalrateingrinding?
with material removal rate in grinding?
y Volume of chip accommodation space ahead of each grit y Specific grinding energy will start decreasing with
must be greater than the chip volume produced by each material removal rate because rake angle of the grit
grit to facilitate easy evacuation of the chip from the becomes more favourable with increase of grit depth of
grinding wheel. cut. However, if increase of material removal rate causes
chip accommodation problem in the available inter
intergrit
grit
space then specific energy may increase.

GRatio Parametersforspecifyagrindingwheel
y The grinding ratio or G ratio is defined as thee cubic mm ( )
GATE2011(PI) 1) The type of grit material
of stock removed divided by the cubic mm of wheel lost. Grindingratioisdefinedas 2) The grit size
volume of wheel wear 3)) The
Th bond
b d strength
t th off the
th wheel,
h l commonly l known
k
y In conventional grinding, the G ratio is in the range 20: 1 (a) as wheel hardness
volume of work material removed
to 80: 1.
1
volume of work material removed 4) The structure of the wheel denoting the porosity i.e.
(b)
volume of wheel wear the amount of inter grit spacing
y The G ratio is a measure of grinding production and
reflects the amount of work a wheel can do during its
cutting speed 5) The type of bond material
(c)
useful life.
life feed 6) Other than these parameters, the wheel
longitudinal feed manufacturer may add their own identification code
(d)
y As the wheel losses material,
material it must be reset or transverse feed prefixing or suffixing (or both) the standard code.
repositionedFor-2015 (IES,
to maintain GATE & PSUs)
workpiece size. Page 111 of 240 Rev.0
Abrasive CommentsandUses
Material
Aluminium oxide Softer and tougher than silicon
carbide; use on steel,
steel iron,
iron brass
IES2009
y 2marks
Siliconcarbide Used for brass,, bronze,,
aluminum, stainless steel and
cast iron
cBN (cubicboron For grinding hard, tough tool
nitride)) steels, stainless steel, cobalt and
nickel based superalloys, and
hard coatings
Diamond Used to grind nonferrous
materials tungsten carbide and
materials,
ceramics

Whyisaluminium oxidepreferredto Grit size


Gritsize Whydoessinglelayergrindingwheelshowprogressive
riseofforceduringgrindingofhighspeedsteel?
siliconcarbideingrindingsteel?
silicon carbide in grinding steel? y The grain size affects material removal rate and the
surface quality of workpiece in grinding.
y Al2O3 is tougher than SiC.
SiC Therefore it is y Large grit
grit big grinding capacity,
capacity rough workpiece y The geometry of grit undergoes irreversible change in
preferred to grind material having high tensile surface the form of rounding or flattening due to wear caused by
strength like steel.
steel Moreover,
Moreover Al2O3 shows higher rubbing action of hard carbides present in high speed
y Fine
Fi grit
it smallll grinding
i di capacity,
it smooth
th workpiece
k i
steel.
chemical inertness than SiC towards steel leading surface
to much improved wear resistance during
g
grinding.
g

Grade Structure / concentration


Structure/concentration Whyiscoarsegrainandopenstructuredwheel
y The worn out grit must pull out from the bond and make y The structure should be open for grinding wheels ispreferredforstockremovalgrinding?
is preferred for stock removal grinding?
room for fresh sharp grit in order to avoid excessive rise engaged in high material removal to provide chip
of grinding force and temperature. accommodation space. y Coarse grit allows large grit protrusion and open
y A soft wheel should be chosen for grinding hard y The space between the grits also serves as pocket for structure provides large inter grit chip space. Thus in
material.
material holding grinding fluid.
fluid combination those two provide large space for chip
accommodation during stock removal grinding and risk
y A hard wheel should be chosen for grinding soft y Dense structured wheels are used for longer wheel life,
of wheel loading is minimized.
material.
t i l f holding
for h ldi precision
i i forms
f and
d profiles.
fil

For-2015 (IES, GATE & PSUs) Page 112 of 240 Rev.0


B di M i l f G i di h l
BondingMaterialsforGrindingwheels Bonding Materials for Grinding wheels
BondingMaterialsforGrindingwheels B di M i l f G i di h l
BondingMaterialsforGrindingwheels
Type of Bond Attributes Type of Bond Attributes
Vitrified bonds
Vitrified bonds Composed of clays and other ceramic Rubber bond For use in thin wheels, replaced by resin y They are composed of clays and other ceramic
substances, porous, strong, rigid, and bond.
bond substances.
unaffected by oils, water, or Oxychloride Limited use. y Vitrified wheels are p
porous,, strong,
g, rigid,
g , and unaffected
temperature. Brittle and can not be used b d
bond by oils, water, or temperature over the ranges usually
for high wheel speed. Metal bond Extensively used with super abrasive encountered in metal cutting. g
Resinoid, or Plastic bond, replaced shellac and wheels, high toughness, high accuracy, y The operating speed range in most cases is 1500 to 5000
phenolic
p rubber wheels,, not with alkaline large stock removal. m/min.
resins grinding fluid. Electroplated Used for small wheel, form wheel and
Shellac bond For flexible cut off wheels, replaced by bond p abrasive wheels,, for abrasive
thin super
resin bond. milling and ultra high speed grinding.
Replace by electroplated bond

Whatisthemainshortcomingofvitrified Resinoid or phenolic resins


Resinoid,orphenolic Shellac bond
Shellacbond
bond? y Because plastics can be compounded to have a wide y At one time this bond was used for flexible cut off
range of properties, such wheels can be obtained to cover wheels.
Vitrified bond is brittle and can not with stand high a variety of work conditions. y At present use of shellac bond is limited to grinding
impact loads. This bond can not be used for high wheel y They have, to a considerable extent, replaced shellac and wheels engaged in fine finish of rolls.
speed due to risk of wheel breakage under centrifugal rubber wheels.
wheels
force.
y Resin bond is not recommended with alkaline grinding
fl id for
fluid f a possible
ibl chemical
h i l attack
tt k leading
l di t bond
to b d
weakening.

Rubber bond
Rubberbond Oxychloride bond Metal bond
Metalbond
y Its principal use is in thin wheels for wet cut off
cutoff y Itislesscommontypebond,butstillcanbeusedindisc y Metal bond is extensively used with super abrasive
operation. grindingoperation.Itisusedunderdrycondition. wheels. Extremely high toughness of metal bonded
y Rubber bond was once popular for finish grinding on wheels makes these very effective in those applications
bearings and cutting tools. where form accuracy as well as large stock removal is
desired.

For-2015 (IES, GATE & PSUs) Page 113 of 240 Rev.0


Electroplated bond
Electroplatedbond Brazed bond
Brazedbond Gl i
Glazing
y This
Thi bond
b d allows
ll large
l (3040%)
( %) crystal
t l exposure above
b y This
Thi is
i relatively
l ti l a recentt development,
d l t allows
ll crystal
t l y With continuous
ti use a grinding
i di wheel
h l becomes
b dull
d ll with
ith
the bond without need of anyy truing
g or dressing.
g This exposure
p as high
g 6080%. In addition g
grit spacing
p g can be the sharp
p abrasive g
grains becoming
g rounded.
bond is specially used for making small diameter wheel, precisely controlled. This bond is particularly suitable for y This condition of a dull grinding wheel with worn out
form wheel and thin super abrasive wheels. Presently it is very high material removal either with diamond or cBN grains is termed as glazing.
th only
the l bond
b d for
f making
ki wheels
h l for
f abrasive
b i milling
illi and
d wheel.
h l The
Th bond
b d strength
t th is
i much
h greater
t than
th provided
id d
ultra high
g speed
p grinding.
g g byy electroplated
p bond. This bond is expected
p to replace
p
electroplated bond in many applications.

L di
Loading Dressing G 20
GATE2014
y Some
S grinding
i di chips
hi gett lodged
l d d into
i t the
th spaces between
b t y Dressing is the conditioning of the wheel surface which Match the Machine Tools (Group A) with the probable
ensures that grit cutting edges are exposed from the Operations (Group B):
the g
grits resulting
g in a condition known as loaded wheel. bond and thus able to penetrate into the workpiece Group A
G GroupB
G B
material.
y Loading is generally caused during the grinding of soft P:CenterLathe 1:Slotting
y In dressing attempts are made to splinter the abrasive
and ductile materials. Q:Milling 2:Counterboring
grains to make them sharp and free cutting and also to
remove any residue left by material being ground.
ground R:Grinding 3:Knurling
y A loaded grinding wheel cannot cut properly and need
y Dressing therefore produces microgeometry. S:Drilling 4:Dressing
dressing.
dressing P Q R S P Q R S
( ) 1
(a) 2 4 3 ( )
(b) 2 1 4 3
(c) 3 1 4 2 (d) 3 4 2 1

CanaresinbondedcBN wheelbe Isdressingnecessaryforsinglelayer Truing


electrochemicallydressed?
electrochemically dressed? wheel? y Truing is the act of regenerating the required geometry
on the grinding wheel.
y Electrochemical dressing is not possible with resin y Conventional macro level dressing is not required y Truing is also required on a new conventional wheel to
bonded wheel because it is not electrically conducting. because the wheel inherently has an open structure. ensure concentricity with specific mounting system.
However, touch dressing is carried out to obtain better
y Truing
T i and d dressing
d i are commonly l combined
bi d into
i t one
uniformity in grit height in order to improve surface
operation for conventional abrasive grinding wheels, but
finish of the workpiece.
are usually
ll two
t di ti tl separate
distinctly t operation
ti f super
for
abrasive wheel.

For-2015 (IES, GATE & PSUs) Page 114 of 240 Rev.0


BalancingGrindingWheels Creep feed grinding
Creepfeedgrinding Statethebasicadvantageofacreepfeed
y Because of the high rotation speeds involved,
involved grinding y Thismachineenablessinglepassgrindingofasurface grinderoveraconventionalsurface
grinder over a conventional surface
wheels must never be used unless they are in good withalargerdownfeedbutslowertablespeedthanthat
balance.
balance adoptedformulti passconventionalsurfacegrinding.
adoptedformultipassconventionalsurfacegrinding. y Productivityisenhancedandlifeofthegrindingwheelis
y Grinding wheel must be balanced Statically and y Increepfeedgrinding,theentiredepthofcutis extended.
D
Dynamically.
i ll completedinonepassonlyusingverysmallin feed
completedinonepassonlyusingverysmallinfeed
y A slight imbalance will produce vibrations that will cause rates.
waviness in the work surface. It may cause a wheel to
break, with the probability of serious damage and injury.

C li d i l G i di
CylindricalGrinding
IES2011Conventional y Center type cylindrical grinding is commonly used far
Centertype
What is creep feed grinding? Discuss its salient producing external cylindrical surfaces.
f t
features, advantages,
d t and
d application.
li ti y The grinding wheel revolves at an ordinary cutting
[10 marks] speed, and the workpiece rotates on centers at a much
slower speed.
speed
y Grinding machines are available in which the workpiece
i held
is h ld in
i a chuck
h k for
f grinding
i di both
b th external
t l and
d internal
i t l
cylindrical surfaces.

Whatarethecharacteristicfeaturesofa C t l
Centerless G i di
Grinding C t l
Centerless G i di
Grinding
universalcylindricalgrinder?
universal cylindrical grinder? y Centerless grinding makes it possible to grind both y The regulating wheel controls the rotation and
external and internal cylindrical surfaces without longitudinal motion of the workpiece and usually is a
y Characteristicfeaturesofauniversalcylindricalgrinder requiring the workpiece to be mounted between centers plastic or rubber
plastic rubberbonded
bonded wheel with a fairly wide face.
notpossessedbyplaincylindricalgrinderare: or in a chuck. y Theworkpieceisheldagainsttheworkrestbladebythe
Swivelling wheelhead y This eliminates the requirement of center holes in some cuttingforcesexertedbythegrindingwheelandrotates
Swivelling wheelheadslide workpieces and the necessity for mounting the atapproximatelythesamesurfacespeedasthatofthe
Swivelling headstock workpiece thereby reducing the cycle time.
workpiece, time regulatingwheel.
regulatingwheel
y Two wheels are used. The larger one operates at regular
grinding
i di speeds
d and d does
d th actual
the t l grinding.
i di Th
The
smaller wheel is the regulating wheel. It is mounted at
an anglel to
t the
th plane
l off the
th grinding
i di wheel.
h l
For-2015 (IES, GATE & PSUs) Page 115 of 240 Rev.0
Centerless Grinding
C t l
Centerless G i di
Grinding C t l
Centreless i t l G i di
internalGrinding
The axial feed is calculated by the equation y This machine is used for grinding cylindrical and
tapered holes in cylindrical parts (e.g. cylindrical liners,
F = dN sin
various bushings etc).
where y The workpiece is rotated between supporting roll,
F = feed (mm/min) pressure roll and regulating wheel and is ground by the
d = diameter of the regulating wheel (mm) grinding wheel.
N = revolutions per minute of the regulating wheel
= angle
g of inclination of the regulating
g g wheel

Statethedisadvantagesofcentreless S f G i di hi
SurfaceGrindingMachines
cylindricalgrindingmachine?
cylindrical grinding machine? y Surface grinding machines are used primarily to
grind flat surfaces.
Itdoesnotgrindconcentricallywithcentres. y However formed irregular surfaces can be
formed,
Largediametershortworkpiecearedifficultto produced on some types of surface grinders by use
controlintheprocess of a formed wheel.
wheel
Itmaynotimproveworkpieceperpendicularity. Four basic types of surface grinding machines are:
1 Horizontal spindle and reciprocating table
1.
2. Vertical spindle and reciprocating table
3. Horizontal
H i l spindle
i dl and
d rotary table
bl
4. Vertical spindle and rotary table

Istransversefeedprovidedinvertical L i
Lapping Ch t i ti fl i
Characteristicsoflappingprocess
spindlereciprocatingtablesurfacegrinder?
spindle reciprocating table surface grinder? y Lappingisbasicallyanabrasiveprocessinwhichloose y Useoflooseabrasivebetweenlapandtheworkpiece
abrasivesfunctionascuttingpointsfindingmomentary y Usuallylapandworkpiecearenotpositivelydrivenbut
y Usually no transverse feed is provided in such machine. supportfromthelaps. areguidedincontactwitheachother
The wheel diameter is kept larger than the width of the y Materialremovalinlappingusuallyrangesfrom.003to y Relativemotionbetweenthelapandtheworkshould
workpiece surface to be ground. .03mmbutmanyreach0.08to0.1mmincertaincases.
03mmbutmanyreach0 08to0 1mmincertaincases changecontinuouslysothatpathoftheabrasivegrains
h ti l th t th fth b i i
ofthelapisnotrepeatedontheworkpiece.
y Castironisthemostlyusedlapmaterial.However,soft
steel,copper,brass,hardwoodaswellashardenedsteel
andglassarealsoused.

For-2015 (IES, GATE & PSUs) Page 116 of 240 Rev.0


Ab i fl i
Abrasivesoflapping V hi l t i l f l i
Vehiclematerialsforlapping Technicalparametersaffectinglappingprocessesare
y Al2O3 andSiC,grainsize5~100m
dSiC i i y Machineoil
M hi il y unitpressure
it

y Cr2O3,grainsize1
grainsize1~2m
2m y Rapeside oil y thegrainsizeofabrasive

y B4C3,grainsize5
g 5 60m
y grease
g y concentrationofabrasiveinthevehicle

y Diamond,grainsize0.5~5m y lappingspeed

H i
Honing H i
Honing H i
Honing
y Honing is a finishing process, in which a tool called hone y It is desired that
carries out a combined rotary and reciprocating motion 1. Honing stones should not leave the work surface
while the workpiece does not perform any working 2. Stroke
St k length
l th mustt cover the
th entire
ti workk length.
l th
motion.
3. In honing rotary and oscillatory motions are
y Most honing is done on internal cylindrical surface,
surface such combined to produce a cross hatched lay pattern.
as automobile cylindrical walls. The honing stones are
held against the workpiece with controlled light
pressure. The honing head is not guided externally but,
instead floats in the hole,
instead, hole being guided by the work y The honing stones are given a complex motion so as
surface. to prevent every single grit from repeating its path Fig.Honingtool Fig.Laypatternproducedbycombinationofrotaryand
over the work surface.
surface oscillatorymotion
ill i

Th iti l t
Thecriticalprocessparametersare Buffing
y Buffing
g is a p g operation
polishing p p
in which the workpiece
y 1.rotationspeed
t ti d
is brought into contact with a revolving cloth wheel that
y 2.oscillationspeed
2 oscillationspeed has been charged with a fine abrasive, such as polishing
rough.
y 3.lengthandpositionofthestroke
3 g p y The wheels are made of disks of linen, cotton,
broadcloth, or canvas, and achieve the desired degree of
y 4.honingstickpressure firmness through the amount of stitching used to fasten
th layers
the l off cloth
l th together.
t th
y Negligible amount of material is removed in buffing
while
hil a very high
hi h luster
l t is i generated
t d on theth buffed
b ff d
surface.
y The
Th dimensional
di i l accuracy off the
th parts
t is
i nott affected
ff t d by
b
For-2015 (IES, GATE & PSUs) Page 117 of 240 the buffing operation. Rev.0
SuperFinishing
S Fi i hi
SuperFinishing Statethespecificapplicationofaplanetary
internalgrinder.
internal grinder
y Planetary internal grinders find application for grinding
holes in workpieces of irregular shape or large heavy
workpieces.
Fig. super finishing of end face
of a cylindrical work piece in radial mode Fig. super finishing operation in plunge mode

IIn this
hi case the
h abrasive
b i stone covers the h section
i off the
h
In this both feeding and oscillation of the super
workpiece requiring super finish. The abrasive stone is
finishing stone is given in the radial direction.
slowly
l l fedf d in
i radial
di l direction
di i while
hil its
i oscillation
ill i i
is
imparted in the axial direction. It reduce surface
roughness
h and
d increase
i b i load
bearing l d capacity.
it

GATE 1995
GATE GATE 1998
GATE GATE 1998
GATE
Among the conventional machining processes, Ideal surface roughness, as measured by the In machining using abrasive material, increasing
maximum specific energy is consumed in maximum height of unevenness, is best achieved abrasive grain size
(a) Turning (b) Drilling when, the material is removed by (a) Increases the material removal rate
(c) Planning (d) Grinding (a) An end mill (b) Decreases the material removal rate
(b) A grinding
i di wheel
h l (c) First decreases and then increases the material
(c) A tool with zero nose radius removal rate
(d) A ball mill. (d) First increases and then decreases the material
removal rate

GATE 2000
GATE GATE 2002
GATE GATE 2006
GATE
Abrasive material used in grinding wheel selected The hardness of a grinding wheel is determined by If each abrasive grain is viewed as a cutting tool,
for grinding ferrous alloys is the then which of the following represents the cutting
(a) Silicon carbide (b) Diamond (a) Hardness of abrasive grains parameters in common grinding operations?
(c) Aluminium oxide (d) Boron carbide (b) Ability of the bond to retain abrasives (a) Large negative rake angle, low shear angle and high
(c) Hardness of the bond cutting speed
((d)) Abilityy of the g
grinding
g wheel to p
penetrate the work (b) Large positive rake angle, low shear angle and high
piece cutting
tti speedd
(c) Large negative rake angle, high shear angle and low
cutting speed
(d) Zero rake angle,
g highg shear angle
g and highg cuttingg
For-2015 (IES, GATE & PSUs) Page 118 of 240
speed Rev.0
GATE 1997
GATE IES 2005
IES IES 2009
IES
List I List II Consider the following statements in respect of Which one of the following is NOT used as abrasive
(A) Grinding 1. Surface for oil retention grinding? material in grinding wheels?
(B) Honing
H i 2. S f
Surface f max. load
for l d 1 The pitch of the grit cutting edges is larger than the
1. (a) Aluminium oxide
capacity pitch of the milling cutter. (b) Silicon carbide
(C) Superfinishing 3. Surface of limiting friction 2. The
Th cutting
tti angles
l off the
th grits
it have
h a random
d (c) Cubic boron nitride
D)) Burnishingg 4.
4 Surface of matte finish geometry. ((d)) Manganese
g oxide
3. The size of the chip cuts is very small for grinding.
5. Surface for pressure sealing
6
6. Surface for interference fit.
fit Which of the statements g given above are correct?
(a) 1 and 2 (b) 2 and 3
(c) 1 and 3 (d) 1, 1 2 and 3

IES 1997
IES IES 1996
IES IES 2001
IES
Which one of the following materials is used as the Grinding wheel is said to be loaded when the Specific cutting energy is more in grinding process
bonding material for grinding wheels? (a) Metal particles get embedded in the wheel surface compared to turning because
(a) Silicon carbide blocking the interspaces between cutting grains.
grains (a) Grinding (cutting) speed is higher
(b) Sodium silicate (b) Bonding material comes on the surface and the (b) The wheel has multiple cutting edges (grains)
(c) Boron carbide wheel
h l becomes
b bl t
blunt. (c) Plaguing force is significant due to small chip size
((d)) Aluminum oxide (c) Work piece being ground comes to a stop in ((d)) Grinding
g wheel undergoes
g continuous wear
cylindrical grinding.
((d)) Grinding
g wheel stops
p because of veryy large
g depth
p of
cut

IES 1996
IES IES 1994
IES IES 1992
IES
Specific energy requirements in a grinding process The ratio of thrust force to cutting force is nearly 2.5 Assertion (A): Vitrified bond is preferred for thin
are more than those in turning for the same metal in grinding wheels.
removal rate because of the (a) Turning (b) Broaching Reason (R): Vitrified bond is hard brittle.
brittle
(a) Specific pressures between wheel and work being (c) Grinding (d) Plain milling (a) Both A and R are individually true and R is the
high.
high correctt explanation
l ti off A
(b) Size effect of the larger contact areas between wheel (b) Both A and R are individually true but R is not the
andd work.
k correct explanation of A
(c) High cutting velocities ((c)) A is true but R is false
(d) High heat produced during grinding. (d) A is false but R is true

For-2015 (IES, GATE & PSUs) Page 119 of 240 Rev.0


IES 2000
IES IES 1995
IES IES 2010
IES2010
Assertion ((A):) The ratio of cutting
g force to thrust force is Soft materials cannot be economically grind due to In relation to the peripheral or surface
very high in grinding process as compared to other
machining processes. (a) The high temperatures involved speeds of the grinding wheel and that of the
Reason (R): Random orientation and effective negative (b) Frequent
F t wheel
h l clogging
l i workpiece in cylindrical grinding of alloy
rake angles of abrasive grains increase the cutting force (c) Rapid wheel wear steel workpieces, the grinding wheel speed is
and adversely affect the cutting action and promote
rubbing action. (d) Low work piece stiffness (a) Less than the speed of the workpiece
(a) Both A and R are individually true and R is the correct (b) Same as the speed of the workpiece
explanation of A
((b)) Both A and R are individuallyy true but R is not the
(c) Double the speed of the workpiece
correct explanation of A (d) 65 to 75 times the speed of the workpiece.
(c) A is true but R is false
(d) A is false but R is true

IES 2009
IES IES 2002
IES IES 2001,ISRO2009
IES 2001 ISRO 2009
Given that the peripheral speed of the grinding Which of the following materials are used in The marking on a grinding wheel is '51
51 A 36 L 5 V 93
93'..
wheel of 100 mm diameter for cylindrical grinding grinding wheel? The code '36' represents the
of a steel work piece is 30 m/s, what will be the 1 Aluminium oxide
1. (a) Structure
estimated rotational speed of the grinding wheel in 2. Cubic boron nitride (b) Grade
revolution per minute (r.p.m.)?
3. Silicon carbide (c) Grain size
(a) 11460 (b) 5730
Select the correct answer using
g the codes g
given below: ((d)) Manufacturer's number
( ) 2865
(c) 86 (d) 95
(a) 1, 2 and 3 (b) 1 and 2
(c) 2 and 3 (d) 1 and 3

IES 2000
IES IES 1995
IES IES 1993
IES
The sequence of markings "S S 14 K 14 S
S" on a grinding In the grinding wheel of A 60 G 7 B 23, B stands for Tool life in the case of a grinding wheel is the time
wheel represents respectively (a) Resinoid bond (b) Rubber bond (a) Between two successive regrinds of the wheel
(a) Bond type,
type structure,
structure grade,
grade grain size and abrasive ( ) Shellac
(c) Sh ll bond
b d (d) Silicate
Sili t bond.
b d (b) Taken
T k forf the
th wheel
h l to
t be
b balanced
b l d
type (c) Taken between two successive wheel dressings
(b) Abrasive
Ab i type,
t grain
i size,
i grade,
d structure
t t and
d bond
b d (d) Taken for a wear of 1mm on its diameter
type
(c) Bond type, grade, structure, grain size and abrasive
type
(d) Abrasive type, structure, grade, grain size and bond
yp
type
For-2015 (IES, GATE & PSUs) Page 120 of 240 Rev.0
IES 2001
IES IES 1994
IES IES 1999
IES
Assertion (A): Hard wheels are chosen for grinding Consider the following statements regarding Consider the following reasons:
hard metals. grinding of high carbon steel: 1. Grinding wheel is soft
Reason (R): In hard wheels only the abrasive grains 1 Grinding at high speed results in the reduction of
1. 2. RPM off grinding
i di wheel
h l is
i too
t low
l
are retained for long time. chip thickness and cutting forces per grit. 3. Cut is very fine
( ) Both
(a) B th A and d R are individually
i di id ll true
t and
d R is
i the
th 2. Aluminium
Al i i oxide
id wheels
h l are employed.
l d 4. An improper cutting fluid is used
correct explanation of A 3. The grinding wheel has to be of open structure. A grinding wheel may become loaded due to reasons
(b) Both A and R are individually true but R is not the Of these statements stated at
correct explanation of A (a) 1, 2 and 3 are correct (b) 1 and 2 are correct (a) 1 and 4 (b) 1 and 3
(c) A is true but R is false (c) 1 and 3 are correct (d) 2 and 3 are correct (c) 2 and 4 (d) 2 and 3
(d) A is false but R is true

IES 2001
IES IES 1993
IES IES 2000
IES
Dry and compressed air is used as cutting fluid for In centre less grinding, the work piece centre will be Consider the following advantages:
machining (a) Above the line joining the two wheel centres 1. Rapid process
(a) Steel (b) Aluminium (b) Below
B l theth line
li joining
j i i the
th two
t wheel
h l centres
t 2. Work
W k with ith keyways
k can be
b ground
d
(c) Cast iron (d) Brass (c) On the line joining the two wheel centres 3. No work holding device is required.
(d) At the intersection of the line joining the wheel Which of these are the advantages of centre less
centres with the work p
plate p
plane. g
grinding?
g
(a) 1, 2 and 3 (b) 1 and 2
(c) 2 and 3 (d) 1 and 3

IES 1996
IES IES 1993
IES IES 2007
IES
A grinding wheel of 150 mm diameter is rotating at Consider the following parameters: Honing Process gives surface finish of what order?
3000 rpm. The grinding speed is 1. Grinding wheel diameter. (a) 10 m (CLA) (b) 1.0 m (CLA)
2. Regulating
R l ti wheel
h l diameter.
di t ( ) 0.1 m (CLA)
(c) (d) 0.01 m (CLA)
3. Speed of the grinding wheel.
4. Speed of the regulating wheel.
5. Angle between the axes of grinding and regulating
wheels.
Among these parameters,
parameters those which influence the
axial feed rate in centreless grinding would include
( ) 2, 4 and
(a) d 5 (b) 1, 2 and d3
For-2015 (IES, GATE & PSUs)
(c) 1, 4 and 5 (d) Page 3, 4121
andof5 240 Rev.0
IES 1992
IES IES 2012
IES IES 2001
IES
CLA value for Honing process is () g gp
Statement(I):Honingisanabradingprocesstoremove (
Match ListI (Cuttingg Tools)) with ListII ((Applications)
pp )
stockfrommetallicsurfaces. and select the correct answer using the codes given
(a) 6 (b) 0.05 3.0 below the lists:
( ) g y
Statement(II):Honingiscommonlydoneoninternal
( ) 0.05 1.0 (d) 0.025 0.1
(c) surfaces. List I List II
((a)) Both Statement ((I)) and Statement ((II)) are A. Trepanning tool 1. For surface finishing by
h i
honing
individually true and Statement (II) is the correct
explanation of Statement (I) B. Side milling cutter 2. For machining gears
(b) Both Statement (I) and Statement (II) are C Hob
C. H b cutter 3. F cutting
For i keyways
k i shafts
in h f
individually true but Statement (II) is not the correct D. Abrasive sticks 4. For drilling large diameter
explanation of Statement (I) holes
(c) Statement (I) is true but Statement (II) is false Codes:A B C D A B C D
( ) 1
(a) 3 2 4 (b) 4 3 2 1
(d) Statement (I) is false but Statement (II) is true
(c) 1 2 3 4 (d) 4 2 3 1

IES 1992
IES IES 1992
IES IAS 2004
IAS
A surface finish of 0.025 0.1 micrometer CLA values Buffing wheels are mode of The size effect refers to the increase in specific
is to by produced. Which machining process would (a) Softer metals (b) Cotton fabric cutting energy at low values of under formed chip
you recommend? ( ) Carbon
(c) C b (d) Graphite
G hit thickness. It is due to which one of the following?
(a) Grinding (b) Rough turning (a) Existence of ploughing force
( ) Lapping
(c) L i (d) Honing
H i (b) Work
W k hardening
h d i
(c) High strain rate
(d) Presence of high friction at chiptool interface.

IAS 2000
IAS IAS 1999
IAS IAS 2001
IAS
Consider the following statements in respect of a Assertion (A): The grade of a grinding wheel is a Consider the following statements:
The setup for internal centreless grinding consists of a
grinding wheel of specification, 51A 36L7R23, measure of hardness of the abrasive used for the regulating wheel, a pressure roll and a support roll, between
using the standard alphanumeric codification: wheel. which the tubular workpiece is supported with the grinding
wheel within the tube, wherein
1. Abrasive used in the wheel is aluminum oxide Reason (R): Grading is necessary for making right 1.The grinding wheel, workpiece and regulating wheel centers
2. The
Th grain i size
i off abrasive
b i is i medium
di selection of the wheel for a particular work.
work must lie on one line
(a) Both A and R are individually true and R is the 2.The directions of rotation of workpiece and grinding wheel are
3. The wheel grade is medium hard same
4. It has an open structure correctt explanation
l ti off A 3.The directions of rotation of pressure roll, support roll and
(b) Both A and R are individually true but R is not the regulating wheel are same
5. It has resinoid as bonding agent 4 The directions of rotation of grinding wheel and regulating
4.The
correct explanation of A wheel are same
Which (If these statements are correct?
(c) A is true but R is false Which of these statements are correct?
( ) 1, 2 and
(a) d 3 (b) 1, 3 and d4 (a) 1, 2 and 3 (b) 1, 3 and 4
(d) A is false but R is true122 of 240
(c) 2, 3 and For-2015
5 (d) (IES, GATE & PSUs)
1, 4 and 5 Page (c) 2 and 3 (d) 3 and 4 Rev.0
IAS 1997
IAS IAS 2007
IAS 2007 IAS 1999
IAS
Which of the following pairs are correctly matched? Match List I with List II and select the correct answer Which one of the following processing sequences
using the code given below the Lists: will give the best accuracy as well as surface finish?
1. Drill press : Trepanning
List I List II
2. Centreless
C t l grinding:
i di Th
Throughh feeding
f di (a) Drilling,
Drilling reaming and grinding
(Machine Tool/ Cutting Tool) (Part/ Characteristics)
3. Capstan lathe: Ram type turret A. Screw cuttingg lathe1. Self locking
g taper
p (b) Drilling, boring and grinding
Select the correct answer using the codes given below: B. Drill 2. Chasing dial (c) Drilling, reaming and lapping
Codes: C. End mill 33. Wiperp insert ((d)) Drilling,
g reaming
g and electroplating
p g
(a) 1 and 2 (b) 1, 2 and 3 D. Grinding wheel 4. Self releasing taper
55. Balance weights
g
( ) 1 and
(c) d3 (d) 2 and d3
Code:A B C D A B C D
((a)) 4 5 3 1 ((b)) 2 1 4 5
(c) 4 1 3 5 (d) 2 5 4 1

IAS 2001
IAS NC,CNC&Robotics Wh t i NC/CNC?
WhatisNC/CNC?
Which one of the following grinding wheels (with y NC is
i an acronym for
f Numerical
N i l Control
C t l and
d CNC is
i an
Grade, Grit and Bond) is suitable for cutter
grinding? acronym
y for Computer
p Numerical Control.
(a) K 60 vitrified (b) K 320 vitrified
( ) T 60
(c) 6 resinoid
i id (d) T 320 resinoid
i id

B SKM d l
BySKMondal

WhatisthedifferencebetweenNCandCNC? WhatisthedifferencebetweenNCandCNC? Wh did CNC t t t d?


WheredidCNCgetstarted?
y The difference between NC and CNC is one of age and y Some
S off the
th enhancements
h t that
th t came along
l with
ith CNC y 1940 Jhon
Jh Parson
P developed
d l d first
fi t machine
hi able
bl to
t drill
d ill
capability.
y The earliest NC machines performed limited functions include: Canned Cycles,
y , Sub Programming,
g g, Cutter holes at specific
p coordinates p
programmed
g on p
punch
and movements controlled by punched tape or punch Compensation, Work coordinates, Coordinate system cards.
cards.
cards
rotation, automatic corner rounding, chamfering, and B y 1951 MIT developed servomechanism
y As the technology evolved, the machines were equiped
with
ith increasingly
i i l powerful
f l microprocessors
i (
(computers)
t ) spline
li interpolation.
i t l ti y 1952 MIT developed first NC machines for milling.
with the addition of these computers, NC machines
b
become CNC machines.
hi y 1970 First
Fi CNC machines
hi came into
i picture
i
y CNC machines have far more capability than their
Nowadayss modified 1970
Nowaday 1970ss machines are used.
used
predecessor. contd..
For-2015 (IES, GATE & PSUs) Page 123 of 240 Rev.0
IAS 1996
IAS Do all machines speak the same CNC
DoallmachinesspeakthesameCNC Wh t i C ti l C t l
WhatisaConversationalControl
Assertion (A): The temperature control of an language y CNC machine
hi tool
t l builders
b ild offer
ff an option
ti what
h t is
i
electric iron is an example of servomechanism.
Reason (R): It is an automatic control system.
system y No, while there is fairly standard set of G and M codes, known as the conversational control. This control lets
(a) Both A and R are individually true and R is the there is some variation in their application. For example the operator/programmer use simple descriptive
correctt explanation
l ti off A
a G0 or G00 command is universally regarded as the language to program the part. The control then
(b) Both A and R are individually true but R is not the
correct explanation of A command
d for
f rapid
id travel.
l Some
S older
ld machines
hi d not
do di l d a graphical
displayed hi l representation
t ti off the
th instructions
i t ti
((c)) A is true but R is false have a G00 command. On these machines, rapid travel is so the operator/programmer
p p g can verifyy the tool p
path.
(d) A is false but R is true
commanded by using the F (feed) word address.

C C hi f h
AreCNCmachinesfasterthan C C hi
AreCNCmachinesmoreaccurate GATE 1994
GATE
conventionalmachines?
conventional machines? thanconventionalmachines?
than conventional machines? CNC machines are more accurate than conventional
machines because they have a high resolution
encoder and digital read
readouts
outs for positioning.
y Yes, No, Sometimes. When it comes to making a single, y Yes, they can be. But like anything else it depends on
simple part it is hard to beat a conventional mill or lathe.
lathe who
h is
i running
i the
th machine,
hi h
how well
ll the
th machines
hi h
has T
True or false?
f l ?
CNC machines move faster in rapid travel than been maintained,, q
qualityy of setup
p and so on.
conventional machines.

NC/CNCMachinesAdvantages NC/CNCMachinesDisadvantages IES 1999


IES
y High
Hi h Repeatability
R t bilit and
d Precision
P i i e.g. Aircraft
Ai ft parts
t Consider the following statements regarding
y Costlysetup,skilledoperators numerically controlled machine tools:
y Volume of production is very high
y Computers,programmingknowledgerequired
C t i k l d i d 1 They reduce nonproductive
1. non productive time
y Complex contours/surfaces need to be machined. E.g.
Turbines 2. They reduce fixturing
y Maintenanceisdifficult
y Flexibility in job change, automatic tool settings, less 3. They reduce maintenance cost
scrap Which of these statements are correct?
y More safe, higher productivity, better quality (a) 1, 2 and 3 (b) 1 and 2
y Less
L paper work,
k faster
f t prototype
t t production,
d ti reduction
d ti (c) 2 and 3 (d) 1 and 3
in lead times

For-2015 (IES, GATE & PSUs) Page 124 of 240 Rev.0


IES 1995
IES NC/CNC/DNC
Consider the following characteristics of y Direct Numerical Control is a system that uses a Directnumericalcontrol
production jobs: central computer to control several machines at the same
1 Processing of parts frequently in small lots
1. time
2. Need to accommodate design changes of products. y Distributed Numerical Control (DNC): the central
3. Low rate of metal removal computert downloads
d l d complete l t programs to
t the
th CNC
machines, which can be workstations or PCs, and can get
4. Need for holding
4 g close tolerances
th information
the i f ti for
f the
th machine
hi operations.
ti
The characteristics which favour the choice of
y The speed of the system is increased, large files can be
numerically controlled machines would include
handled and the number of machine tools used is
(a) 1, 2 and 3 (b) 2, 3 and 4 expanded.
( ) 1, 3 and
(c) d 4 (d) 1, 2 and d4
497 498

IES 2009
IES GATE 1993
GATE
DNC In which of the following machining manual part With reference to NC machine, which of the
programming is done? following statement is wrong?
(a) CNC machining (b) NC machining (a) Both closedloop
closed loop and openloop
open loop control systems are
(c) DNC machining (d) FMS machining used
(b) Paper
P t
tapes, fl
floppy t
tapes and
d cassettes
tt are usedd for
f
data storage
(c) Digitizers may be used as interactive input devices
((d)) Post p
processor is an item of hardware

499

IES 2007
IES 20 0
JWM2010 IES 2009
IES
What are the main components of an NC machine? Consider the following g components
p g g numerical
regarding What is the purpose of satellite computers in
1. Part program control system : Distributed Numerical Control machines?
2. Machine
M hi Control
C t l Unit
U it 1 Programme of instructions
1. (a) To act as standby
stand by systems
3. Servo motor 2. Machine control unit (b) To share the processing of largesize NC programs
Select the correct answer using the code given below: 3. Processing
P i equipment
i (c) To serve a group of NC machines
(a) 1, 2 and 3 (b) 1 and 2 only Which of these are correct ? ((d)) To network with another DNC setup p
(c) 2 and 3 only (d) 1 and 3 only (a) 1, 2 and 3 (b) 1 and 2 only
(c) 2 and 3 only (d) 1 and 3 only

For-2015 (IES, GATE & PSUs) Page 125 of 240 Rev.0


IES 1999
IES 20 0
JWM2010 IES 2002S1
IES 2002 S1
Consider the following components: g g y
ConsiderthefollowingadvantagesofDNCsystems: Match List I with List II and select the correct
1. A dedicated computer 1.Timesharing answer:
2 Greatercomputationalcapability
2.Greatercomputationalcapability List I List II
2. Bulk
B lk memory
(NC machine tool systems) (Features)
3. Telecommunication lines 3.Remotecomputerlocation
A NC system 1.
A. 1 It has an integrated automatic tool
Which of these components are required for a DNC changing unit and a component
y
system? Whichoftheaboveis/arecorrect? indexingg device
(a) 2 and 3 (b) 1 and 2 (a)1and2only (b)2and3only B. CNC system 2. A number of machine tools are
(c) 1,
1 2 and 3 (d) 1 and 3 (c)2only (d)1 2and3
(d)1,2and3 controlled byy a computer.
p No tape
p
reader, the part program is
transmitted directly to the
machine tool from the
computer memory

IES 2002Contd..FromS1
IES 2002 C td F S1 St M t
StepperMotor
C. y
DNC system 33. The controller consists of IAS2011main y The
Th stepper
t motor
t isi special
i l type
t off synchronous
h motor
t
softwired computer and
hard wired logic Graphic Explain, at least two, characteristics each of NC, which is designed
g to rotate through
g a specific
p angle
g
display of tool path is
also possible
CNC and DNC. (Called step) for each electrical pulse received from the
D. Machining centre 4. The instructions on tape is [10Marks] control unit.
prepared in binary
d i l form
decimal f and
d operatedd by
b
a series of coded
instructions
Codes:A B C D A B C D
( ) 4
(a) 2 3 1 (b) 1 3 2 4
(c) 4 3 2 1 (d) 1 2 3 4

BasicCNCPrinciples
IAS2010Main
IAS2009main
Illustratewiththehelpofneatsketchesthedifferences
What is the function of stepper motor?
betweenopen loopandclosed loopcontrolinNC
betweenopenloopandclosedloopcontrolinNC
[2 marks] system.Whyisfeedbacknotpossibleinopenloop
controlsystem?

[22 Marks]

For-2015 (IES, GATE & PSUs) Page 126 of 240 Rev.0


GATE 2007
GATE IES 1994
IES IES 2002
IES
WhichtypeofmotorisNOTusedinaxisorspindle Feed drives in CNC milling machines are provided In a CNC machine tool, encoder is used to sense and
drivesofCNCmachinetools? by control
(a) Inductionmotor (b) DCservomotor (a) Synchronous motors (a) Table position
(c) Steppermotor (d) Linearservomotor (b) Induction motors (b) Table velocity
(c) Stepper motors (c) Spindle speed
((d)) Servomotors. ((d)) Coolant flow

B i L th U it (BLU)
BasicLengthUnit(BLU) GATE 1997
GATE
y In NC machine, the displacement length per one pulse In a point to point control NC machine, the slides
output from machine is defined as a Basic Length Unit are positioned by an integrally mounted stepper
(BLU). motor drive. If the specification of the motor is
y In the CNC computer each bit (binary digit) represents 1 1o/pulse, and the pitch of the lead screw is 3.6 mm,
BLU.
BLU what is the expected positioning accuracy?
Bit = BLU ( a ) 1 m (b) 10 m
y Example: If one pulse makes a servo motor rotate by one (c ) 50 m (d ) 100 m
degree and the servo motor moves the table by 0.0001
mm, one BLU will be 0.0001 mm.
y The lead of a ball screw is related to the displacement
p
unit of the machine tool table.

GATE 2007(PI)
GATE 2007 (PI) GATE 2008(PI) l
Example
In a CNC machine feed drive, a stepper motor A stepper
t motor
t has
h 150 steps.
t The
Th output
t t shaft
h ft off the
th y A DC servomotor is coupled directly to a leadscrew
with step angle of 1.8o drives a lead screw with which drives the table of an NC machine tool. A
pitch of 2 mm.
mm The Basic Length Unit (BLU) for motor is directlyy coupled
p to a lead screw of p
pitch 4 mm,, digital encoder,
encoder which emits 500 pulses per
this drive is which drives a table. If the frequency of pulse supply to revolution, is mounted on the other end of the
leadscrew If the leadscrew pitch is 5 mm and the
leadscrew.
(a) 10 microns (b) 20 microns the motor is 200 Hz, the speed of the table (in mm/min) motor rotates at 600 rpm, calculate
(c) 40 microns (d) 100 microns is ( ) The
(a) Th linear
li velocity
l it off the
th table
t bl
(b) The BLU of the NC system
(a) 400 (b) 320 (c) 300 (d) 280
(c) The frequency of pulses transmitted by the encoder.

For-2015 (IES, GATE & PSUs) Page 127 of 240 Rev.0


GATE 2014(PI)
loop pointtopoint
In an open loop, point to point controlled CNC drilling
IES 2011 C ti l
IES2011Conventional G
GATE 20 0 ( )
2010(PI) machine, a stepper motor, producing 200 angular steps per
y The table of a CNC machine is driven by a Lead screw which For a 3 axes
axes CNC table, the slide along the vertical axis revolution,
revolution drives the table of a drilling machine by one
is rotated by a DC servomotor. A digital encoder which emits of the table is driven by a DC servo motor via a lead angular step per each pulse generated by a pulse generator
screw nut mechanism. The lead screw has a pitch of 5
screw (shown in figure).
figure) Each angular step moves the table by
1000 pulses per second is mounted on the lead screw as a mm. This lead screw is fitted with a relative one Basic Length Unit (BLU) along X axis with a lead screw
feedback device. If the lead screw p
pitch is 6 mm and motor (incremental) circular encoder. The basic length unit having a pitch of 4 mm. If the frequency of pulse generator
rotates at 500 rpm, find (BLU) of the slide along the vertical axis of the table is is doubled, the BLU will
0.005 mm. When the table moves along the vertical axis
1. Basic length Units of the system by 9 mm, the corresponding number of pulses generated
2
2. Linear velocity of the table.
table by the encoder is ((a)) become
b d bl off previous
double i value
l
(a) 1400 (b) 1800 (c) 4200 (d) 9000 (b) become half of previous value
3. Frequency of pulses generated by the feedback device.
(c) remain the same
[5 Marks]
(d) become zero

StatementforLinkedAnswersquestions:S1 GATE 2008Q1


GATE 2008 Q 1 (StatementinS2)
(St t t i S 2) GATE 2008Q2
GATE 2008 Q 2 (StatementinS3)
(St t t i S 3)
In the feed drive of a Point to Point open loop CNC
PointtoPoint The Basic Length Unit (BLU), i.e., the table A customer insists on a modification to change the BLU
drive, a stepper motor rotating at 200 steps/rev drives a movement corresponding to 1 pulse of the pulse of the CNC drive to 10 microns without changing the
table through a gear box and lead screw screwnut
nut mechanism generator, is table speed. The modification can be accomplished by
(pitch = 4 mm, number of starts = 1). (a) 0.5 microns (b) 5 microns
Output rotational speed
The gear ratio = Input rotational speed is given by U = 14 ( ) 50 microns
(c) i (d) 500 microns
i
The stepper motor (driven by voltage pulses from a pulse
generator)
t ) executest 1 step/pulse
t / l off the th pulse
l generator.
t
The frequency of the pulse train from the pulse
generator
t isi f = 10,000 pulses l per minute.
i t

IAS2010
IAS Main
2010Main
GATE 2009(PI) GATE2014(PI) In openloop NC system the shaft of a stepping motor is
The
h totall angular
l movement (in
( degrees)
d ) off a leadscrew
l d Each
E h axis i off NC machine hi iis ddriven
i by a stepper
b t motor
t connected directly to the lead screw xaxis
x axis of the
drive with a lead screw. The pitch of lead screw is p mm. machine table. The pitch of the lead screw is 3.0 mm.
with a pitch of 5.0
5 0 mm to drive the work
worktable
table by a Th step
The t angle l off stepper
t motort per pulse l input
i t is
i The number of step angles on the stepping motor is 200.
200
distance of 200 mm in a NC machine is degrees/pulse. The ratio of gear drive in stepper motor
Determine how closelyy the pposition of the table can be
d i is
drive i g(number
( b off turns
t off the
th motor t for
f each h single
i l
(a) 14400 (b) 28800 (c) 57600 (d) 72000 controlled, assuming that there are no mechanical errors
turn of the lead screw). The number of pulses required
in the p
positioning
g system.
y
t achieve
to hi a linear
li movementt off x mm is i
g 360 g g 360 g Also, what is the required frequency of the pulse train
(a) x (b) x (c ) x (d ) x
360 p p 360 p p and
d the
h corresponding
d rotationall speed
d off the
h stepping
motor in order to drive the table at a travel rate of 100
mm/min? [ Marks]
[8 k ]
For-2015 (IES, GATE & PSUs) Page 128 of 240 Rev.0
ControlSystemspossibleinCNCMachine GATE 1992
GATE P i tt i t t i ht li d
Pointtopointstraightlinemode
y Point to point mode: In a point to point type of NC system
pointtopoint
(a) Control of position and velocity of the tool is
essential
(b) Control of only position of the tool is sufficient
(c) Control of only velocity of the tool is sufficient
((d)) Neither p
position nor velocityy need be controlled

GATE 2006
GATE
NC contouring is an example of
(a) Continuous path positioning
(b) Pointtopoint
P i tt i t positioning
iti i
(c) Absolute positioning
(d) Incremental positioning

GATE2005 C di t t
Coordinatesystem
y All the machine tool use Cartesian Co ordinate system.
Coordinate system
WhichamongtheNCoperationsgivenbeloware
continuouspathoperations? y The first axis to be identified is the Z axis, This is
followed by X and Y axes respectively.
respectively
ArcWelding(AW) Milling(M)
Drilling(D)
g PunchingisSheetMetal(P)
g
LaserCuttingofSheetMetal(LC)SpotWelding(SW)
(a) AW,LCandM (b)AW,D,LCandM
(c) D,LC,PandSW (d)D,LC,andSW

For-2015 (IES, GATE & PSUs) Page 129 of 240


Righthandcoordinatesystems Rev.0
IES 2000
IES
Assertion (A): The axis of an NC drilling machine
spindle is denoted as zaxis.
Reason (R): In NC machine tool, tool the axis
perpendicular to both x and yaxis is designated as
z axis
zaxis
(a) Both A and R are individually true and R is the
correctt explanation
l ti off A
(b) Both A and R are individually true but R is not the
correct explanation of A
(c) A is true but R is false
(d) A is false but R is true

IES 1996
IES
Assertion (A): Numerically controlled machines
having more than three axes do not exist.
Reason (R): There are only three Cartesian
coordinates namely xyz.
( ) Both
(a) B th A and d R are individually
i di id ll true
t and
d R is
i the
th
correct explanation of A
(b) Both A and R are individually true but R is not the
correct explanation of A
(c) A is true but R is false
(d) A is false but R is true
5axesCNCverticalaxismachiningcentreconfiguration

Absolute and Incremental Coordinate System

For-2015 (IES, GATE &


Absolute Coordinate System
PSUs)
Incremental Coordinate System
Page 130 of 240 Rev.0
IES 2003S1
IES 2003 S1 IES 2003Contd..FromS1
IES 2003 C td F S1
While part programming If incremental co ordinates system is used, the co
coordinates co GATE2012SameQinGATE2012(PI)
Q ( )
in CNC machines, the ordinates of each point A, B and C are A CNC vertical milling machine has to cut a
input of dimensional (a) A: X 5.0,
5 0 Y 10.0
10 0 (b) A: X 5.0,
5 0 Y 10.0
10 0 straight
t i ht slot
l t off 10 mm width
idth andd 2 mm depth
d th by
b a
information for the tool B: X 20.0, Y5.0 B: X 25, Y 15.0 cutter of 10 mm diameter between points (0, 0)
path can be given in the andd (100,
( 100)) on the
th XY plane
l (di
(dimensions
i i
in
absolute coordinate C: X 10.0, Y 10.0 C: X 35, Y 5.0
mm). The feed rate used for milling is 50 mm/min.
system or in incremental ((c)) A: X 10.0, Y 55.0 ((d)) A: X 10.0, Y 55.0
Milling time for the slot (in seconds) is
coordinate system. The B: X 15.0, Y 25.0 B: X 5.0, Y 20.0
(a) 120 (b) 170 (c) 180 (d) 240
above figure shows the C: X 15.0,
15 0 Y 35.0
35 0 C: X 10.0,
10 0 Y 10
10.00
route to be followed by the
tool from O to C, i.e., O A
B C.

Th f ll i th t t b f ll d
Thefollowingarethestepstobefollowed P tP i
PartProgramming
whiledevelopingtheCNCpartprograms.
y FANUCCONTROLL
y Processplanning
y Axesselection y SIEMENSCONTROLL
y Toolselection
y Cuttingprocessparametersplanning
y Jobandtoolsetupplanning
J pp g
y Machiningpathplanning y For a CNC machine control unit (MCU) decides cutting
y Partprogramwriting speed, feed,
speed feed depth of cut,
cut tool selection , coolant on off
y Partprogramproving and tool paths. The MCU issues commands in form of
numeric data to motors that position slides and tool
accordingly.

TableofImportantGcodes
CNC programming
CNCprogramming
Importantthingstoknow:
ProgrammingKeyLetters Code Meaning Format
y O Programnumber(Usedforprogramidentification)
G00 RapidTransverse N__G00X___Y___Z___
N G00X Y Z
CoordinateSystem y N Sequencenumber(Usedforlineidentification) G01 LinearInterpolation N__G01X___Y___Z___F___
y G
G Preparatoryfunction G02 CircularInterpolation,
CircularInterpolation N G02X Y Z
N__G02X__Y__Z___R___F___
R F
Units,incrementalorabsolutepositioning y X Xaxisdesignation CW N__G02X___Y__Z__I___J__K__F__
y Y Yaxisdesignation
g
G
G03 CircularInterpolation,
C l l N G X___Y___Z__R__F___
N__G03 X Y Z R F
Coordinates:X,Y,Z,RX,RY,RZ y Z Zaxisdesignation
CCW
y R Radiusdesignation N__G03 X__Y__Z__I__J__K__F__
Feedrateandspindlespeed
F d d i dl d y F Feedratedesignation G04 Dwell N__G04P___
y S Spindlespeeddesignation
G17 XY Plane
y H
H Toollengthoffsetdesignation
CoolantControl:On/Off,Flood,Mist
C l C l O /Off Fl d Mi
y D Toolradiusoffsetdesignation G18 XZPlane
y T ToolDesignation
g G19
9 YZPlane
ToolControl:Toolandtoolparameters
T lC l T l d l y M Miscellaneousfunction
For-2015 (IES, GATE & PSUs) Page 131 of 240 Rev.0
TableofImportantGcodes TableofImportantGcodes
Code Meaning
G20/G70 InchUnit
Format Code Meaning Format
G44 Toollengthcompensation N__G44H__
N G44H
Rapidtraverse:G00
G21/G71 MetricUnit (minus)
y G00:
G28 AutomaticReturntoReference G49 Toollengthcompensation y tomakethemachinemoveatmaximumspeed.
t k th hi t i d
Point cancel
y Itisusedforpositioningmotion.
G40 Cuttercompensationcancel G80 Cancelcannedcycles
Ca ce ca ed cyc es G90G00X20 0Y10 0
G90G00X20.0Y10.0
G81 Drillingcycle N__G81Z__R__F__
G41 Cuttercompensationleft N__G41D__ End
G90 Absolutepositioning G90:
9
G
G42 C tt
Cuttercompensationright
ti i ht N G D
N__G42D__ absolute
(
(20,10)
)
G91 Incrementalpositioning coordinates (10,10)
G43 Toollengthcompensation N G43H
N__G43H__ G92 Absolutepreset,changethe
Absolutepreset changethe N__G92X__Y__Z__
N G92X Y Z
(plus) datumposition
Start (0,0)

Linearinterpolation:G01 Circularinterpolation:G02,G03 Circularinterpolation:G02,G03


y G01: y G02,G03:
y Forcircularinterpolation,thetooldestinationandthecircle Y
y linearinterpolationatfeedspeed.
p p centerareprogrammedinoneblock
G91G0lX200.0Y100.0F200.0 y G02isclockwiseinterpolation,G03iscounterclockwise X R=-50mm
interpolation End SpecifyRwith
Y
G 02 R signbeforeit:
G91: End G17 X __ Y __ F __;
incremental 100.0 G 03 I __ J __ 180 +R
coordinates G 02 R R
>180
G18 X __ Z __ F __; Start R=50mm
G 03 I __ K __
G 02 R
G19 Y __ Z __ F __;
G 03 J __ K __ G91G02X60.0Y20.0R50.0 F300.0
Start 200 0
200.0 X End Circlecenter radius
Circlecenter,radius 9 5
G91G02X60.0Y20.0R50.0 F300.0
3
point

p ,
Circularinterpolation:G02,G03 Circularinterpolation:G02,G03 Circularinterpolation:G02,G03
N0010G92X200.0Y40.0Z0; AnnotationforCircularInterpolation
Y y SpecifyCenterwithI,J,K N0020G90G03X140.0Y100.0I60.0F300
End y I0.0,J0.0,andK0.0canbeomitted.
I J dK b itt d
N0030G02X120.0Y60.0I 50.0 G92:
y I,J,Karetheincremental
Or Todefineworking y IfX,Y,Zareallomittedintheprogram,thatmeans
distancefromthestartof
N0010G92X200.0Y40.0Z0
N0010G92X200 0Y40 0Z0 coordinate startandendofarcaresamepoints
startandendofarcaresamepoints.
X thearc;
h
N0020G90G03X140.0Y100.0R60.0F300 N0020G02I20.0(afullcircle)
y Viewingthestartofarcas N0030G02X120.0Y60.0R50.0
Start theorigin,I,J,Khave
th i i I J Kh y IfI,J,K,andRallappearsincircularinterpolation
IfI J K andRallappearsincircularinterpolation
Y
j positiveornegativesigns. G90: instruction,RisvalidandI,J,andKareinvalid
Center absolute 100 R50
i coordinates
di t 60 R60
40
X
O 90 120 140 200
For-2015 (IES, GATE & PSUs) Page 132 of 240 Rev.0
GATE 2014
GATE2014 GATE 2007(PI)
GATE 2007 (PI) GATE 2004
GATE
FortheCNCpartprogramming,matchGroupAwith
GroupB: The interpolator in a CNC machine controls During the execution of a CNC part program block
GroupA Group B (a) Spindle Speed (b) Coolant flow N020 G02 X45.0 Y25.0 R5.0 the type of tool motion will
be
P:circularinterpolation,counter I:G02 (c) Feed rate (d) Tool change
clockwise (a) Circular Interpolation clockwise
Q:dwell II:G03 (b) Circular Interpolation counter clockwise
R:circularinterpolation clockwise
R:circularinterpolation,clockwise III:G04 ((c)) Linear Interpolation
p
S:pointtopointcountering IV:G00 (d) Rapid feed

P Q R S P Q R S
( ) II
(a) III I IV ( )
(b) I III II IV
(c) I IV II III (d) II I III IV

GATE 2010
GATE IES 2009
IES GATE 2001
GATE
In a CNC program block, N002 G02 G91 X40 Z40, Interpolation
I t l ti in
i the
th controller
t ll refers
f to
t control
t l off In an NC machining operation, the tool has to be
G02 and G91 refer to moved from point (5, 4) to point (7, 2) along a
(a) Circular interpolation in counterclockwise direction which one of the following
g in a CNC machine? circular path with centre at (5, 2). Before starting the
and incremental dimension operation, the tool is at (5, 4). The correct G and M
(a) Loading/unloading of jobs on machine
(b) Circular
Ci l interpolation
i t l ti ini counterclockwise
t l k i direction
di ti code for this motion is
and absolute dimension (b) Loading/unloading of tools from the tool changer (a) N010 G03 X7.0 Y2.0 I5.0 J2.0
(c) Circular interpolation in clockwise direction and (b) N010
N G X7.0
G02 X Y
Y2.0 I
I5.0 J
J2.0
(c) Axes of machine for contouring
incremental dimension (c) N010 G01 X7.0 Y2.0 I5.0 J2.0
(d) Circular interpolation in clockwise direction and (d) Coolant and miscellaneous functions on machine (d) N010 G00 X7.0 Y2.0 I5.0 J2.0
absolute dimension

GATE 2005
GATE GATE2014(PI)
The tool of an NC machine has to move along a
ToolCompensation
circular arc from (5, 5) to (10,10) while performing an A CNC instruction G91G01X30Y40F100 commands the
y ToolRadiusCompensation
operation. The centre of the arc is at (10, 5). Which movement of tool along the path at a feed rate of 100 y LefthandG41
L fth dG
one of the following NC tool path commands y RighthandG42
performs the above mentioned operation? mm/min (G91 incremental format and G01 linear
y CanceltoolradiuscompensationG40
C l l di i G
(a) N010G02 X10 Y10 X5 Y5 R5 interpolation). The feed rate of the tool (in mm/min) y ToolHeightCompensation
(b) N010G03
N G X10 X Y10
Y X5X Y5Y R5R along the X axis will be _______ y PositiveG43
(c) N010G01 X5 Y5 X10 Y10 R5 y NegativeG44
(d) N010G02 X5 Y5 X10 Y10 R5 y CanceltoolheightcompensationG49

For-2015 (IES, GATE & PSUs) Page 133 of 240 Rev.0


GATE 2000
GATE
ToolRadiusCompensation CancelToolCompensation:G40
In finish machining of an island on a casting with
y Toolradiuscompensationsmakeitpossibleto CNC milling machine, an end mill with 10 mm
programdirectlyfromthedrawing,andthuseliminate y Notethedifferencebetweentwoways
thetooloffsetcalculation
th t l ff t l l ti diameter is employed. The corner points of the
N0060G01 X2.000Y1.700 island are represented by (0, 0), (0, 30), (50, 30), and
G41(G42)D N0060G40G01 X2.000Y1.700M02
y D:theradiusoftooltocompensateissavedinamemoryunitthat
D th di ft lt t i di itth t
N0070G40
7 4 M02 (50, 0). By applying cutter radius right
isnamedD compensation, the trajectory of the cutter will be
y G41/G42isdirectlyrelatedwithdirectionoftoolmovementand
whichsideofpartiscut
whichsideofpartiscut. (a) (5,
( 5 0),
0) (5,
( 5 35),
35) (55,
(55 35),
35) (55,
(55 5),
5) (5,
( 5 5)
5)
(b) (0, 5), (55, 5), (55, 35), (5, 35), (5, 5)
(c) (5, 5), (5, 25), (45, 25), (45, 5), (5, 5)
rampoffblock effectivetotheendpoint
(d) (5,
5 55), (45,
45 55), (45,
45 25),
5 (5,5 25),
5 (5,5 55)

GATE 2014
GATE
For machining a rectangular island represented by ToolHeightCompensation g p
ToolHeightCompensation
coordinates P(0, 0), Q(100, 0), R(100, 50) and S(0, 50) on
a casting using CNC milling machine, an end mill with a G43(G44)H y Example:
diameter of 16 mm is used. The trajectory of the cutter y N0010G91G00X12.0Y80.0
G G G91:
y H:specifiedmemoryunitusedtosaveheight
center to machine the island PQRS is y N0020G44Z32.0H02 incremental
compensationoftool. coordinates
(a) (8, 8), (108, 8), (108, 58), (8, 58), (8, 8) y Positivecompensation(G43):
y Ifweput0.5mmintoH02,
(b) (8,
(8 8),
8) (94,
(94 8),
8) (94,
(94 44),
44) (8,
(8 44),
44) (8,
(8 8) realposition=specifiedposition+valuesavedinH
y realposition=32.0 0.5=32.5
(c) (8, 8), (94, 0), (94, 44), (8, 44), (8, 8) y Negativecompensation(G44):
(d) (0,
( 0),) (100,
( 0),
) (100,
( 50),
) (50,
( 0),
) (0,
( 0)) realposition=specifiedposition
l iti ifi d iti valuesavedinH
l di H y Canceltoolheightcompensation:G49

TableofImportantMcodes GATE 2009


GATE 2009
p g g
Rulesforprogramming
y M00Programstop
M P
Block Format
y M01Optionalprogramstop
y M03Spindleonclockwise
S i dl l k i N135 G01 X1.0
X1 0 Y1.0
Y1 0 Z0.125
Z0 125 F5

y M04Spindleoncounterclockwise Sample Block


Restrictions on CNC blocks
y M05Spindlestop Each may contain only one tool move
y M06Toolchange Each may contain any number of non-tool move G-codes
Each may contain only one feed rate
y M08Coolanton Each may contain only one specified tool or spindle speed
y M09Coolantoff The block numbers should be sequential
Both the program start flag and the program number must be
y M10Clampson independent of all other commands (on separate lines)
The data within a block should follow the sequence shown
y M11Clampsoff in the above sample
p block
y M02orM30Programstop,resettostart
For-2015 (IES, GATE & PSUs) Page 134 of 240 Rev.0
IES 1993
IES 1993 IES 1996
IES
A 'block'
means
block of information in N.C. machine program In manual programming and tape preparation for a
NC drilling machine, the spindle speed was coded
ExampleofCNCProgramming
Example of CNC Programming
(a) One row on tape as S 684 (using the magic
magicthree
three code). The spindle
speed in rpm will be y WhatMustBeDoneToDrillAHoleOnACNC
(b) A word comprising several rows on tape
(a) 684 VerticalMillingMachine
g
(c) One complete instruction
((d)) One complete
p program
p g for a jjob (b) 68.4
(c) 840
((d)) 6840
4

ToolHome Top
p
View 2.)ZAxisRapidMove
Top JustAboveHole Top
View View
3.)TurnOnCoolant
)
55.)ZAxisFeedMoveto
4.)TurnOnSpindle
) O S i dl DrillHole
1 )X&YRapidToHolePosition
1.)X&YRapidToHolePosition
.100
Front Front Front
View View View

HeresTheCNCProgram! ToolAtHome

Top Top Top O0001


O
View View 7.)TurnOffSpindle View N005G54G90S600M03
6.)RapidZAxisMove
6 )RapidZAxisMove
N010G00X1.0Y1.0
OutOfHole 8.)TurnOffCoolant
N015G43H01Z.1M08
9.)X&YAxisRapid N020G01Z.75F3.5
N025G00Z 1M09
N025G00Z.1M09
MoveHome
Front Front Front N030G91G28X0Y0Z0
View View View N035M30

For-2015 (IES, GATE & PSUs) Page 135 of 240 Rev.0


ToolAtHome ToolAtHome

Top O0001
O Top O0001
O Top O0001
O
View O0001
View N005G54G90S600M03 View N005G54G90S600M03
N
NumberAssignedtothisprogram
b A i d hi
N005 SequenceNumber N010G00X1.0Y1.0
G54 FixtureOffset
G90 AbsoluteProgrammingMode G
G00 R idM i
RapidMotion
S600 SpindleSpeedsetto600RPM X1.0 XCoordinate1.0in.fromZero
M03 SpindleoninaClockwiseDirection Y1.0 YCoordinate1.0in.fromZero

Front Front Front


View View View

Top O0001
O Top O0001
O Top O0001
O
View N005G54G90S600M03 View N005G54G90S600M03 View N005G54G90S600M03
N010G00X1.0Y1.0 N010G00X1.0Y1.0 N010G00X1.0Y1.0
N015G43H01Z.1M08 N015G43H01Z.1M08 N015G43H01Z.1M08
G43 ToolLengthCompensation N020G01Z.75F3.5 N020G01Z.75F3.5
H01 SpecifiesToollengthcompensation
G01 StraightLineCuttingMotion N025G00Z 1M09
N025G00Z.1M09
Z.1 ZCoordinate.1in.fromZero
Z.75 ZCoordinate.75 in.fromZero
Front M08 FloodCoolantOn Front 35
F3.5 FeedRatesetto3.5in/min.
35 / Front G00 RapidMotion
Z
Z.1 ZCoordinate.1in.fromZero
ZC di i f Z
View View View M09 CoolantOff

O0001
IES 1995
IES 1995
p
Top O0001 Match List I with List II and select the correct answer
N005G54G90S600M03
N G G S6 M View N005G54G90S600M03
N G G S6 M using the codes given below the lists:
Top
View N010G00X1.0Y1.0 N010G00X1.0Y1.0 List I List II
N015G43H01Z.1M08 (A function
f i connected d (A
(Associated
i d parameter))
N015G43H01Z.1M08 with NC m/c tool)
N020G01Z.75F3.5
75 3 5 N020G01Z.75F3.5
N020G01Z .75F3.5 A Interpolation
A. 1 Tape preparation
1.
N025G00Z.1M09 N025G00Z.1M09 B. Parity check 2. Canned cycle
N030G91G28X0Y0Z0 Front
F N030G91G28X0Y0Z0 C Preparatory function
C. 3 Drilling
3.
G91 IncrementalProgrammingMode D. Point to point control 4. Contouring
Front G28 ZeroReturnCommand View N035M30 5. Turning
M30 EndofProgram
View X0,Y0,Z0
X,Y,&ZCoordinatesatZero
Code:A B C D A B C D
(a) 4 1 2 3 (b) 4 1 2 5
(c) 5 1 3 2 (d) 1 4 3 2
For-2015 (IES, GATE & PSUs) Page 136 of 240 Rev.0
IAS 2011 M i
IAS2011Main APT L
APTLanguage
In an NC drilling g operation,
p , the tool tipp is at location (
( IFS2011 y APT (Automatically Programmed Tools)
100, 0, 100). The datum (0, 0, 0) is left hand lower corner y The APT language consists of many different types of
on topp surface of the workpiece,
p , which is rectangular
g In NC machine, what is the purpose of the parity statements made up of the following valid letters, numerals
(300 mm x 300 mm x 1.5 mm thick). A thru' hole of 10 check ? What is the function of Data Processing and punctuation marks.
mm diameter is t o be drilled in the centre of the y Letters: ABCDEFGHIJKLMNOPQRSTUVWXYZ
workpiece. Using only rapid positioning and linear Unit (DPU) and Control Loop Unit (CLU) of MCU.
y Numerals: 0123456789
p
interpolation functions,, write the pprogram
g blocks,, in How is Feed Rate Number (FRN) expressed ? What / Aslashdividesastatementintotwosections eg
Aslashdividesastatementintotwosections.eg.,
absolute mode. GO/PAST,
Assume permitted cutting speed = 32 m/min and feed is indirect feedback ?
, Acommaisusedasaseparatorbetweentheelementsin
Acommaisusedasaseparatorbet eentheelementsin
rate = 150 mm/min. [10Marks] [10marks] astatementgenerallytotherightoftheslash.
= Anequalsisusedforassigninganentitytoasymbolic
A l i df i i tit t b li
name,e.g.,P1=POINT/25,50,30.

Words IES 1998


IES Th l t APT t it f
ThecompleteAPTpartprogramconsistsof
Which of the following are the rules of thefollowingfourtypesofstatements
y The
Th words
d to
t be
b used
d in
i the
th statements
t t t are built
b ilt up from
f
programming NC machine tools in APT language?
one to six letters or numerals with the first one being
ga y Geometry
1 Only capital letters are used
1.
letter. No special character is allowed in the words. 2. A period is placed at the end of each statement y Motion
3. Insertion of space does not affect the APT word y Postprocessor
Select the correct answer using
g the codes g
given below:
(a) 1 and 2 (b) 2 and 3 y Compilationcontrol
(c) 1 and 3 (d) 1 alone

OtherPartProgrammingLanguages APTLanguage
y ADAPT
D ((ADaptation
Daptat o APT)) was tthee first
st atte pt to adapt APT
attempt g g
APTLanguage OthercapabilitiesofAPT,themacrofacility,withusevariableargumentasina
FORTRANsubroutine,forexample:
FORTRAN b i f l
programming system for smaller computers P0 = POINT/0.0, 0.3, 0.1
Additionalstatements:
y AUTOSPOT (AUTOmatic Sytem for POsitioning Tools) was FROM/P0
d l
developed
d by
b IBM and
d first
fi t introduced
i t d d ini 1962
6 MACHIN/DRILL,
MACHIN/DRILL 2 CALL/DRILL,
/ X=1.0,
1 0 Y=1.0,
1 0 Z=0.1,
0 1 DEPTH=0.7
0
COOLNT/ CALL/DRILL, X=2.0, Y=1.0, Z=0.1, DEPTH=0.7
y EXAPT (EXtended subset of APT) was developed jointly in
German in about 1964 by several universities to adapt APT for Forexample: COOLNT/MIST COOLNT/FLOOD COOLNT/OFF GOTO/P0
European use. It is compatible with APT and thus can use the FEDRAT/
whenthedefinitionofthemacroDRILLis:
same processor as APT SPINDL/ DRILL = MACRO/X, Y, Z, DEPTH
y COMPACT was developed
d l d by
b Manufacturing
f Data Systems, Inc. Forexample:
l SPINDL/ON
/ SPINDL/1250,
/ CCLW GOTO/X,Y,Z
(MDSI) TOOLNO/ GODLTA/0,0, -DEPTH
y SPLIT (Sundstrand Processing Language Internally Translated) TURRET/ , , DEPTH
GODLTA/0,0,
was developed by Sundstrand Corporation, intended for its own TARMAC
END
machine tools
y MAPT (MicroAPT) is a subset of APT, to be run on the
microcomputersFor-2015 (IES, GATE & PSUs) 61
Page 137 of 240 62
Rev.0 63
Point (POINT)
( ) Point (POINT) Point (POINT)

PTA = POINT/ 33,4,5


45 PTB = POINT/ INTOF
INTOF, LIN1
LIN1, LIN2 PTD = POINT/ YSMALL, INTOF, LIN3, C1 y
PTD = POINT/ XSMALL, INTOF, LIN3, C1
PTC = POINT/ YLARGE, INTOF, LIN3, C1
y PTC = POINT/ XLARGE, INTOF, LIN3, C1 PTC
(3, 4, 5)
LIN2
PTA

z LIN3
PTB C1
LIN1

PTD
x

Point (POINT) Point (POINT)


( ) Line (LINE)
( )

PTE = POINT/ YLARGE,


YLARGE INTOF,
INTOF C1,
C1 C2 PT7 = POINT/ CENTER,
CENTER C6
PTE = POINT/ XLARGE, INTOF, C1, C2 y LIN1 = LINE/ P1, P2
PTF = POINT/ YSMALL,, INTOF,, C1,, C2
PTF = POINT/ XSMALL, INTOF, C1, C2 C1 y
y
C6
PTE
P2

PT7
P1

PTF C2
LIN1

x x
x

Line (LINE)
( ) Line (LINE) Line (LINE)
L12 = LINE/ PT4, ATANGL, 20, XAXIS
LIN = LINE/ POINT, ATANGL, ANGLE (in degrees), LINE
LIN4 = LINE/ PT6,
PT6 15,
15 -30,
30 3 L14 = LINE/ PT1,
PT1 ATANGL,
ATANGL 40
L15 = LINE/ 32, -3, 2, ATANGL, -15, XAXIS
L16 = LINE/ PT3, ATANGL, 40, YAXIS
y
y LINE2
y
PT6 PT3 L
L14
P1

40
PT1 L12
L16 30 LINE1
LINE
PT4
L4 (15,30,3)
LINE LINE/P ATANGL LINE
LINE2=LINE/P1,ATANGL,30,LINE1
40 20

x
x 15 x
L15
For-2015 (IES, GATE & PSUs) Page 138 (32,3,2)
of 240 Rev.0
Line (LINE) Line (LINE) Line (LINE)

LIN = LINE/ SLOPE, SLOPE VALUE, INTERC, MODIFIER, d N = LINE/


N / ATANGL,
NG , DEGREES,
G S, INTERC,
N C, MODIFIER,
O ,d
LIN The LEFT & RIGHT modifier indicates whether the line
where the slope value is y/x. The modifier options are [XAXIS,
The modifier options are [XAXIS, YAXIS], and d is the is at the left or right tangent point, depending on how
YAXIS], and d is the corresponding intercept value on the selected
corresponding
p g intercept
p value on the selected axis ((i.e., modifier).
)
axis
i (i.e.,
(i modifier).
difi ) one looks at the circle from the point.
point

y y
L1 = LINE/ PT51, LEFT, TANTO, C11

LINE1 L1
LINE1

C11
LINE1=LINE/SLOPE 1 INTERC XAXIS 6
LINE1=LINE/SLOPE,1,INTERC,XAXIS,6 LINE1=LINE/ATANGL 30 INTERC d
LINE1=LINE/ATANGL,30,INTERC,d
=30 PT51
x x
(6 )P i t fX I t
(6,0)PointofXIntercept
t d

Line (LINE) Line (LINE) Line (LINE)


L6 = LINE/ LEFT, TANTO, C3, LEFT, TANTO, C4
L2 = LINE/ PT51, RIGHT, TANTO, C11
L6
L3 = LINE/ PT40, RIGHT, TANTO, C11 L6 = LINE/ RIGHT, TANTO, C4, RIGHT, TANTO, C3
L4 = LINE/ PT40, LEFT, TANTO, C11 C4
Left
L3 Right C3
Right L6
Right
PT40 C4
L1
L8 L9
Left
f C3
L7
Left L4
Left
PT51 The descriptive words LEFT and RIGHT are used by L8 L9

Right
g from the first circle written towards the
looking L77
L
L2
second circle.

Line (LINE) Line Plane (PLANE)

LN3 = LINE/ PNT6, PARLEL, LN15 LN5 = LINE/ INTOF,


INTOF PLAN1,
PLAN1 PLAN2 PLAN10 = PLANE/ PT6
PT6, PT12,
PT12 PT15
LN4 = LINE/ PNT5, PERPTO, LN13
LN5
PLAN10
y PT15

PNT6 PNT5
LN3 PT6 PT12

LN4
4 y 3.0

LN15 PLAN1
LN13 PT4
z
PLAN2
PLAN14

x
For-2015 (IES, GATE & PSUs) Page 139 of 240 x
Rev.0
Plane (PLANE) Circle (CIRCLE)
( ) Circle (CIRCLE)
( )

PLAN14 = PLANE/ PT4,


PT4 PARLEL,
PARLEL PLAN10
C1 = CIRCLE/ 3, 6, 5, 4.3 C3 = CIRCLE/ CENTER, PT6, TANTO, LN4
PLAN14 = PLANE/ PARLEL, PLAN10, YSMALL, 3.0
C1 = CIRCLE/
C C / CENTER,
C PT3,
3 RADIUS,
A S 4.3
43 C7 = CIRCLE/ CENTER
CENTER, PT8,
PT8 PT5
PLAN10
y y y
PT15
C1 LN4
y PT6 PT12 PT5
3.0 43
4.3

PT3 PT6 PT8


PT4 (3,6,5) C7
C3
z
PLAN14
x x x
x

The Machining
g Plan The Machiningg Plan The Machining Plan

Contouring: z
Checksurface
y Part surface: the surface on which the end of the Drivesurface CS CS CS

y
tool is riding.
Directionof
y Drive surface: the surface against which the edge of cutter cuttermotion

the tool rides. x


DS DS DS

y Check surface: a surface at which the current tool


motion
i isi to stop. Partsurface
TO ON PAST

GOUP
The Machining
g Plan FROM/PTARG
GO/TO,L1,TO,PL2,TOL3
Motion
i commands: GORGT/L3,PAST,L4
GORGT/L3 PAST L4
GOLFT
GOLFT/ : Move left alongg the drive surface GOFWD
GORGT/ : Move right along the drive surface
Present tool
GOUP/ : Move up along the drive surface GOBACK position
GODOWN/ : Move down along the drive surface GORGT
GOFWD/ : Move forward from a tangent position
GODOWN
GOBACK/ : Move backward from a tangent position

Previous
For-2015 (IES, GATE & PSUs) Page 140 of 240 Rev.0
tool position
M hi i Specifications
Machining S ifi i Machining Specifications Machining Specifications
Postprocessor
P commands
d for
f a particular
i l machine
hi tooll are: FEDRAT/ : specifies the feed rate for moving the tool along the TOLERANCE SETTING:
SETTING Nonlinear
N li motion
i is
i accomplished
li h d in
i
MACHIN/ : used to specify the machine tool and call the part surface in inches per minute: straight-line segments, and INTOL/ and OUTTOL/ statements
postprocessor for that tool: di
dictate the
h number
b off straight-line
i h li segments to be
b generated.
d
FEDRAT/ 4.5
MACHIN/ DRILL,, 3 INTOL/ 0.0015
SPINDL/ : gives the spindle rotation speed in revolutions per
COOLNT/ : allows the coolant fluid to be turned on or off: OUTTOL/ 0.001
minute:
COOLNT/ MIST SPINDL/ 850
COOLNT/ FLOOD TURRET/ : can be used to call a specific tool from an automatic
COOLNT/ OFF tool changer:
TURRET/ 11

Machining Specifications M hi i Specifications


Machining S ifi i
PARTNO:
PARTNO identifies
id ifi the
h part program andd is
i inserted
i d at the
h start off FINI:
FINI specifies
ifi the
h endd off the
h program.
g g
APTLanguage
OtherMotionstatements:
the program. GO/{TO}, Drive surface, {TO} Part surface, {TO},
Ch k surface
Check f
CLPRNT: indicates that a cutter location printout is desired. Or
CUTTER: specifies a cutter diameter for offset (rough versus finish GO/{TO}, Drive surface, {TO} Part surface, {TANTO},
Check surface
cutting). If a milling cutter is 0.5 in. in diameter and we have AndthesamewithPASTorONinsteadofTO
GOLFT/
CUTTER/ 0.6 GORGT/
GOUP/
then the tool will be offset from the finish cut by 0.05 in. GODOWN/
GOFWD/ /
GOBACK/
Forexample:
GO/TO, L1, TO, PS, TANTO, C1
GO/PAST, L1, TO, PS, TANTO, C1

96

Answer: Contd.
IES 2008
IES2008
Name the four types of statements in a complete APT
PARTNO CONTOUR CUTTER/25.0
MACHIN/MILL, 1 TOLER/0.1
part program.
program Prepare part program for geometry CLPRNT INTOL/0.05
INTOL/0 05
UNITS/MM OUTTOL/0.05
description of the contour shown in the figure below:
Y P0 = POINT/0.0, 0.0, 0.0 FEDRAT/200
[15Marks]
[15 Marks] P1 = POINT/110.0,
POINT/110 0 20.0,
20 0 0.0
00 SPINDL/500, CLW
30 40
P2 = POINT/20.0, 20.0, 0.0 COOLNT/ON
20 P3 = POINT/90.0, 110.0, 0.0 FROM/P0
L2 C1 P4 = POINT/20.0, 100.0, 0.0
L3 GO/TO, L1, TO, PL1, TO, L5
20 P5 = POINT/50.0, 130.0, 0.0
R
135 GOLFT/L1, PAST, L2
L1 = LINE/P2, ATANGL, 90, XAXIS
L2 = LINE/P4, ANTNGL, 45, XAXIS GORGT/L2 PAST,
GORGT/L2, PAST L3
L3 = LINE/P5, ATANGL, 135, L2 GORGT/L3, TANTO, C1
L4
80 L4 = LINE/P1,, PERPTO,, L3 GOFWD/C1, PAST, L4
L1
L5 = LINE/P1, PERPTO, L4 GOFWD/L4, PAST, C2
C2
C1=CIRCLE/CENTER, P3, RADIUS, 20.0 GORGT/C2, PAST, L5
L5
20 C2=CIRCLE/CENTER,
C2 CIRCLE/CENTER, P1, RADIUS, 20.0 GORGT/L5 PAST,
GORGT/L5, PAST L1
R P1
P2 20 PL1=PLANE/P1, P2, P3
For-2015 (IES, GATE & PSUs)
X Page 141 of 240 Rev.0
Contd.
RAPID IES 2007
IES2007
Prepare part using APT language for milling the contour
GOTO/P0
COOLNT/OFF shown in Fig.
Fig in a single pass.
pass D [20Marks]
[20 Marks]
SPINDL/OFF C 110

END R30
B
FINI Q

110
120

E
+

+
R40
40

A F
100 + 40 P

+
Material : M S.

8 mm

Answer: Contd. Contd.


PARTNO CONTOUR CUTTER/25.0 RAPID
MACHIN/MILL, 2 TOLER/0.1 GOTO/P0
CLPRNT INTOL/0.05
INTOL/0 05 COOLNT/OFF
UNITS/MM OUTTOL/0.05 SPINDL/OFF
P0 = POINT/0.0, 0.0, 10.0
FEDRAT/200 END
PTA = POINT/0.0, 0.0, 0.0
PTB = POINT/0.0, 120.0, 0.0 SPINDL/500, CLW FINI
PTC = POINT/30.0, 150.0, 0.0 COOLNT/ON
PTD = POINT/140.0, 150.0, 0.0 FROM/P0
PTE = POINT/140.0, 40.0, 0.0 GO/TO, LAB, TO, PL1, TO, LAF
PTF = POINT/100.0, 0.0, 0.0 GOLFT/LAB, TANTO, CBC
PTQ = POINT/30.0, 120.0, 0.0
GOFWD/CBC PAST
GOFWD/CBC, PAST, LCD
PTP = POINT/140.0, 0.0, 0.0
GORGT/LCD, PAST, LDE
LAB = LINE/PTA, PTB
LCD
C = LINE/PTC,
/ C, PTD GORGT/LDE, PAST, CEF
LDE = LINE/PTD, PTE GORGT/CEF, PAST, LAF
LAF = LINE/PTA, PTF GORGT/LAF, PAST, LAB
CBC = CIRCLE/CENTRE,, PTQ, Q, RADIUS,, 30.0
CEF = CIRCLE/CENTRE, PTP, RADIUS, 40.0
PL1=PLANE/PTA, PTB, PTC

C2 C2
R30 R30
Y L2 Y L2
P3 P3
C1 C1
IES 2006
IES2006
Prepare part program to machine the contour shown in
R20
Answer:
R20

P2 P2
the figure using APT on CNC milling machine.
machine L3
PARTNO CONTOUR
L3
R30
[15Marks] 100 mm
MACHIN/MILL, 3
100 mm
L1 CLPRNT
80 80 L1
UNITS/MM
R20
P0 = POINT/0.0, 0.0, 10.0
P1 = POINT/0.0, 0.0, 0.0
X P2 = POINT/60.0, 80.0, 0.0 X
100 mm 60 50 P3 = POINT/150.0, 100.0, 0.0 60 50
P1 L4 P4 P1 L4 P4
80 200 mm P4 = POINT/200.0,
POINT/200 0 0.0,
0 0 0.0
00 200 mm

C1 = CIRCLE/ CENTER, P2, RADIUS, 20


C2 = CIRCLE/CENTER, P3, RADIUS, 30
L1 = LINE/P1, LEFT, TANTO, C1
L2 = LINE/LEFT, TANTO, C1, LEFT, TANTO, C2
60 50
L3 = LINE/P4
LINE/P4, RIGHT,
RIGHT TANTO
TANTO, C2
200 mm

For-2015 (IES, GATE & PSUs) Page 142 of 240 L4 = LINE/P1, P4


Rev.0
Material: MS Thickness: 8.0 mm PL1=PLANE/P1, P2, P3
Contd. Contd.
CUTTER/25.0
TOLER/0.1
RAPID
GOTO/P0
H W k
HomeWork
INTOL/0.05
INTOL/0 05 COOLNT/OFF
p
Write a complete p
part p g
program in APT for machining g
OUTTOL/0.05 SPINDL/OFF the product which is given in the diagram. Thickness of
COOLNT/ON END the workpiece is 6 mm. All dimensions are in mm.
SPINDL/500, CLW FINI
FEDRAT/200
[15]
FROM/P0
GO/TO, L1, TO, PL1, TO, L4
GOLFT/L1, TANTO, C1
GOFWD/C1 PAST,
GOFWD/C1, PAST L2
GOFWD/L2, TANTO, C2
GOFWD/C2, PAST, L3
GOFWD/L3, PAST, L4
GORGT/L4, PAST, L1

REMARKMOTIONSTATEMENTFOLLOW
FROM/P0
PARTNOCONTOUR L1 LINE/RIGHT TANTO C1 RIGHT TANTO C3
L1=LINE/RIGHT,TANTO,C1,RIGHT,TANTO,C3
GO/TO,L1,TO,PL1,TANTO,C1
MACHIN/MILL,1 L2=LINE/LEFT,TANTO,C1,LEFT,TANTO,C2
C4=CIRCLE/XLARGE,OUT,C2,OUT,C3,RADIUS,62
C CIRCLE/XLARGE OUT C OUT C RADIUS 6 GORGT/L1,TANTO,C3
CLPRNT
PL1=PLANE/P1,P2,P3 GOFWD/C3,TANTO,C4
UNITS/MM GOFWD/C4 TANTO C2
GOFWD/C4,TANTO,C2
REMARKPOSTPROCESSORSTATEMENTFOLLOW
P0=POINT/25.0,25.0,25.0 GOFWD/C2,PAST,L2
CUTTER/50.0
P1=POINT/0.0,0.0,6.0
/ , , GOFWD/L2 TANTO C1
GOFWD/L2,TANTO,C1
TOLER/0.01
TOLER/
P2=POINT/117.0,32.0,6.0 INTOL/0.05 GOFWD/C1,PAST,L1
P3=POINT/117 0 32 0 6 0
P3=POINT/117.0,32.0,6.0 OUTTOL/0.05
OUTTOL/ RAPID
C1=CIRCLE/CENTER,P1,RADIUS,10.0 FEDRAT/200 GOTO/P0
C CIRCLE/CENTER P RADIUS
C2=CIRCLE/CENTER,P2,RADIUS,12.5 SPINDL/
SPINDL/1000,CLW
CLW COOLNT/OFF
C3=CIRCLE/CENTER,P3,RADIUS,12.5 COOLNT/ON SPINDL/OFF
END
FINI

IES 2011 C ti l
IES2011Conventional IES 1997
IES IES 1995
IES
State the method of defining line segment of Which of the following are valid statements for In APT language, the cutter motion in incremental
point to point motion of the tool in APT language? coordinate mode is addressed as
cutter motion using APT program format.
1 GO/TO/............
1. GO/TO/ (a) GO/TO/.....
GO/TO/
[5 Marks] 2. GO DLTA/............ (b) GO/TO.....
3. GO/TO, . (c) GO DLTA/....
Select the correct answer using g the codes g
given below: ((d)) GO FWD/...
(a) 1 and 2 (b) 2 and 3
(c) 1 and 3 (d) 1, 1 2 and 3

For-2015 (IES, GATE & PSUs) Page 143 of 240 Rev.0


GATE 2008 (PI)
GATE2008(PI) Wh t i
Whatisanindustrialrobot?
i d t i l b t?
Suppose point P1 in APT programming is coded by statement Robotics A robot is a reprogrammable,
reprogrammable multifunctional
P1 = POINT/XSMALL, INTOF, LN1, CR1
manipulator designed to handle material, parts, tools or
The coded g
geometric situation without causing
g error is specialized devices through variable programmed
motions for the performance of a variety of tasks.

WhatCanRobotsDo?
Advantages of Robots
AdvantagesofRobots Disadvantages of Robots
DisadvantagesofRobots
y Robotics and automation can, in many situation, increase y Robots lack capability to respond in emergencies, this can cause:
p y, safety,
productivity, y, efficiency,
y, q y, and consistencyy of
quality, pp p
Inappropriate and wrong g responses
p
products A lack of decisionmaking power IndustrialRobots
d l b
y Robots can work in hazardous environments A loss of power
y R b t need
Robots d no environmental
i t l comfort
f t Damage to the robot and other devices Material
Material handling
Human injuries Material transfer
y Robots work continuously without any humanity needs and
y Robots may have limited capabilities in Machine loading and/or unloading
illnesses
Degrees
D off Freedom
F d Spot welding
y Robots have repetable precision at all times Dexterity Continuous arc welding MaterialHandling
y Robots can be much more accurate than humans, they may have Sensors Manipulator
Spray
p y coatingg
mili or micro inch accuracy.
accuracy Vision systems Assembly
y Robots and their sensors can have capabilities beyond that of Realtime Response
Inspection
humans y Robots are costly, y, due to
y Robots can process multiple stimuli or tasks simultaneously, Initial cost of equipment
humans can only one. Installation Costs
y Robots replace human workers who can create economic Need for peripherals A
Assembly
bl
problems Need for training Manipulator
Need for Programming SpotWelding
Manipulator

Asimov's three laws of robotics


Asimov'sthreelawsofrobotics All robots have the following basic components:
Allrobotshavethefollowingbasiccomponents:
WristConfigurations
1. Manipulators: the mechanical unit, often called the
First law (Human safety): "arm,"
" " that
th t does
d the
th actual
t l work k off th
the robot.
b t It iis
y A robot may not injure a human being, or, through composed of mechanical linkages and joints with actuators y Wristassemblyisattachedtoendofarm
i
inaction,
ti allow
ll a human
h b i to
being t come to
t harm.
h to drive the mechanism directly or indirectly through gears, y Endeffector
E d ff i
isattachedtowristassembly
h d i bl
chains, or ball screws.
Second law (Robots are slaves): 2. Feedback devices: transducers that sense the p positions of y Functionofwristassemblyistoorientendeffector
y A robot must obey orders given it by human beings, various linkages and joints and transmit this information to y Bodyandarmdeterminesglobalpositionofend
the controllers in either digital or analog Form. effector
p where such orders would conflict with the First
except
Law. 3. End effectors: the "hand" or "gripper" portion of the y Twoorthreedegreesoffreedom:
h d ff d
robot, which attaches the end of the arm and perform the y Roll
Third law (Robot survival): operations of the robot.
robot y Pitch
y A robot must protect its own existence as long as such 4. Controller: the brains of the system that direct the y Yaw
protection does not conflict with the First or Second movements of the manipulator.
manipulator
Law. For-2015 (IES, GATE & PSUs) 5. Power supply Page 144 of 240 Rev.0
End Effectors
EndEffectors
DegreesofFreedom
g
y Thespecialtoolingforarobotthatenablesitto pp
GrippersandTools y The degree of freedom or grip of a robotic system can be
performaspecifictask compared to the way in which the human body moves.
y Twotypes: y For
F each
h degree
d off freedom
f d a joint
j i isi required.
i d
y Grippers tograspandmanipulateobjects(e.g.,
parts)duringworkcycle y The degrees of freedom located in the arm define the
y Tools toperformaprocess,e.g.,spotwelding,spray configuration.
painting
y Each of the five basic motion configurations utilizes three
degrees of freedom in the arm.
y Three degrees of freedom located in the wrist give the end
effector all the flexibility.

Degrees of Freedom (contd )


DegreesofFreedom(contd.) Degrees of Freedom (contd )
DegreesofFreedom(contd.)
y A total of six degrees of freedom is needed to locate a The radial traverse: is the extension and retraction
robot
robotss hand at any point in its work space.
space of the arm or the inandout
in and out motion relative to the
y Although six degrees of freedom are needed for base.
maximum flexibility,
flexibility most robot employee only three to The
Th verticali l traverse: provides
id theh upanddown
dd
five degrees of freedom.
motion of the arm of the robotic system.
y The more the degrees of freedom,
freedom the greater is the
y The three degrees of freedom located in the wrist,
complexity of motions encountered.
which bear the names of aeronautical terms, are
y The three degrees of freedom located in the arm of
Pitch or bend: is the upanddown movement of the
a robotic system are:
wrist.
The
Th rotational
t ti l reverse: is
i the
th movementt off the
th arm
Yaw: is the rightandleft movement of the wrist.
assembly about a rotary axis, such as leftandright
swivel
i l off the
th robots
b t arm about
b t a base.
b Roll or swivel: is the rotation of the hand.
hand

T fR b t
TypesofRobot T fR b t
TypesofRobot T fR b t
TypesofRobot
y Cartesian or y
Gantry y Cylindrical robot: y Spherical
p or
robot: Polar robot:
y It's a robot whose axes
y It's a robot whose arm
form a cylindrical y It
It'ss a robot whose axes
has three prismatic
joints, whose axes are coordinate system. form a polar coordinate
coincident with a y
system.
y Used
U d for f assembly
bl
Cartesian coordinator. y Used for handling at
operations, handling at
y Used for pick and place machine tools,, spot p
machine
hi t l
tools, spott welding, diecasting,
work, application of
sealant, assembly welding, and handling fettling machines, gas
operations, handling att di
die casting
ti welding and arc
machine tools and arc machines. welding.
welding.
welding
For-2015 (IES, GATE & PSUs) Page 145 of 240 Rev.0
Types of Robot
TypesofRobot T fR b t
TypesofRobot T fR b t
TypesofRobot
y SCARA robot
y Articulated or y Parallel robot
y The SCARA acronym stands Revolute Robot: One use is a mobile
for Selective Compliant Assembly
y It
It'ss a robot whose arm platform handling
Robot Arm or Selective Compliant
has at least three rotary cockpit flight
Articulated Robot Arm.
joints.
joints simulators It
simulators. It'ss a robot
y It's a robot which has two parallel whose arms have
y Used for assembly
rotaryy jjoints to p
provide compliance
p concurrent prismatic
operations,
ti di casting,
die ti
in a plane or rotary joints.
fettling machines, gas
y Used for pick and place work, work welding,
ldi arc welding
ldi
application of sealant, assembly and spray painting.
operations and handling machine
tools

IES 2012
IES Robot Control Systems
RobotControlSystems
Theconfigurationofarobotusingatelescopingarmthat y
JointDriveSystems y Limitedsequencecontrol pickandplace
operationsusingmechanicalstopstosetpositions
i i h i l ii
canberaisedorloweredonahorizontalpivotmounted y Electric
y Playbackwithpointtopointcontrol records
onarotatingbaseiscalled y Useselectricmotorstoactuateindividualjoints
workcycleasasequenceofpoints,thenplaysback
(a)Polar y Preferreddrivesystemintoday'srobots
thesequenceduringprogramexecution
(b)C li d i l
(b)Cylindrical y Hydraulic
y Playbackwithcontinuouspathcontrol
y Useshydraulicpistonsandrotaryvaneactuators
(c)Cartesiancoordinate greatermemorycapacityand/orinterpolation
y Notedfortheirhighpowerandliftcapacity
(d)Jointedarm capabilitytoexecutepaths(inadditiontopoints)
y Pneumatic
y Intelligentcontrol exhibitsbehaviorthatmakes
y Typicallylimitedtosmallerrobotsandsimplematerial
T i ll li it dt ll b t d i l t i l
itseemintelligent,e.g.,respondstosensorinputs,
transferapplications
makesdecisions,communicateswithhumans

Working Envelope
WorkingEnvelope Robotic Arc Welding Cell
RoboticArcWeldingCell
y
RobotControlSystem
y Robotperforms
fluxcoredarc
Cell
C ll
Supervisor
Level2
welding(FCAW)
operationatone
Controller
workstation
k i
Level1
&Program whilefitter
changespartsat
theother
Joint1 Joint2 Joint3 Joint4 Joint5 Joint6 Sensors Level0
workstation

For-2015 (IES, GATE & PSUs) Page 146 of 240 Rev.0


Robot Programming
RobotProgramming Leadthrough Programming L dh h ProgrammingAdvantages
Leadthrough P i Ad
y Leadthrough programming
y Advantages:
g
y Work cycle is taught to robot by moving the 1. Poweredleadthrough y Easilylearnedbyshoppersonnel
manipulator through the required motion cycle and y Commonforpointto
y Logicalwaytoteacharobot
simultaneously entering the program into controller pointrobots
y Nocomputerprogramming
memory for later playback y Usesteachpendant
y Disadvantages:
y Robot programming languages 2. Manualleadthrough
y Downtimeduringprogramming
y Textual programming language to enter commands y Convenientfor
continuouspath y Limitedprogramminglogiccapability
Li i d i l i bili
into robot controller
controlrobots y Notcompatiblewithsupervisorycontrol
y Simulation and offline
off line programming y Humanprogrammer
y Program is prepared at a remote computer terminal physicalmoves
andd downloaded
d l d d to robotb controller
ll for
f execution
i manipulator
without need for leadthrough methods

IES2011 IES 2010


IES2010 IES 2006
IES
Consider the following g statements: Which one of the following is the third basic
Trajectoryofarobotmean:
Good dynamic performance is usually difficult to achieve component of robots besides power supply and
(a)Pathtracedbytheendeffectors in robots which contain a rotary base because control (memory) console?
(b)KinematicsofRobot 1. Position, speed and acceleration of the other joints cause
(a) Software (b) Coaxial cable
( )
(c)Robotjoints
j variations in the reflected torque and moment of inertia.
2. The moment of inertia reflected at the base depends upon the ( ) Mechanical
(c) M h i l unit
it arm (d) Microcomputer
Mi t
(d)Robotprogramming
weight of the object being carried.
3. The moment of inertia reflected at the base also depends upon
the distance between the base axis and the manipulated object.
Which of the above statements is/are correct?
(a) 1, 2 and 3 (b) 2 and 3 only
(c) 1 only (d) 1 and 3 only

IES 2000
IES GATE 2013
GATE2013
Consider the following characteristics of a robot:
CAD
Computer Aided
d d Design (CAD):
( ) Used
d for
f creating the
h In
I a CAD package,
k mirror
i image
i off a 2D
D point
i t
1. The tip of the robot arm moves from one point to
another with its in
inbetween
between path not being defined. product database P(5,10)
(5, ) is to be obtained about a line which p
passes
2. It can be used for drilling holes at difference points in a through the origin and makes an angle of 45o
workpiece.
workpiece y Geometric Modeling
3. It can be used for V butt joint welding between two counterclockwise with the Xaxis. The coordinates
y Engineering Analysis
points.
points off the
th transformed
t f d point
i t will
ill be
b
4. The memory capacity required for its control unit is low. y Design Review and Evaluation
Which of these are the characteristics associated with
ith a point (a) (7.5,
(7 5 5) (b) (10,
(10 5) (c) (7.5,
(7 5 5)
5) (d) (10,
(10 5)
5)
to point robot?
y Automated Drafting
( ) 1 and
(a) d2 (b) 1, 3 and d4
(c) 1, 2 and 4For-2015
(d) (IES, GATE
2, 3 and 4 & PSUs) Page 147 of 240 Rev.0
GATE 2014
GATE2014 IES 2006
IES
CAM
ArobotarmPQwithendcoordinatesP(0,0)andQ(2,5)
A b t PQ ith d di t P( ) dQ( ) ComputerAidedManufacturing(CAM): Which item best describes a CAM technology?
y ComputerAidedProcessPlanning(CAPP) (a) Geometric modeling (b) Documentation
p y 9 o.
rotatescounterclockwiseaboutPintheXYplaneby90 y ComputerizedmaterialResourcePlanning(MRP) ( ) Drafting
(c) D fti (d) Numerical
N i l control
t l
ThenewcoordinatepairoftheendpointQis y NCpartprogramming
y RobotProgramming
R b P i
(a)(2,5) (b)(5,2)
y ComputerizedScheduling
(c)(5,2) (d)(2,5) y Computerizedprocesscontrol
y ComputerizedManufacturingControlbyFMS
y Shopfloorcontrol
y ComputerAidedQualityControl(CAQC)
p Q y ( Q )
y ComputerAidedInspection

Automation Automation
y Automation is the process of following a predetermined Fixed Automation
ISRO2011 sequence of operations with little or no human intervention,
using
i specialized
i li d equipment
i and d devices
d i that
h perform
f and
d y It
I is
i also
l known
k as hard
h d automation.
i
control the manufacturing process.
In CAM, " Part programming" refers to Why go for Automation? y Used to produce a standardized product.
product
1. Increased productivity
(a) Generation of cutter location data y Used for very large quantity production of one or few
2. Reduced cost of labour
(b) Online Inspection 3. Improved quality marginally different components.
4. Reduced inprocess
p inventoryy
(c) Machine Selection 5. Reduce Manufacturing time y Highly specialized tools, devices, equipment, special
6. Increased safety
(d) Tool
T l Selection
S l i purpose machine tools,
tools are utilized to produce a
There are three types of Automation
1. Fixed Automation product.
2. Programmable
P bl Automation
A t ti
3. Flexible Automation y Very efficient, high production rate , low unit cost.

Automation Automation IES 2012


IES
Programmable Automation Flexible Automation
Programmableautomationissuitablefor
P bl t ti i it bl f
y Can change the design of the product or even change the y If is also known as FMS, and uses CAD/CAM
(a)Lowproductionvolumeandlargevarietiesofparts
product by changing the program. y Produce different products on the same equipment in
(b)Lowproductionvolumeandsmallvarietiesofparts
p p
y Used
U d for
f the
th low
l quantity
tit production
d ti off large
l number
b off any order
d or mix.
i
different components.
p (c)Highproductionvolumeandsmallvarietiesofparts

y Equipment are designed to be flexible or programmable.


(d)Highproductionvolumeandlargevarietiesofparts

y Used for batch production.

For-2015 (IES, GATE & PSUs) Page 148 of 240 Rev.0


Wh t i FMS?
WhatisanFMS? FMSComponents FMS G l
FMSGoals
y A fflexible manufacturing
f g system
y ((FMS)) is a y Reduction in manufacturing cost by lowering direct
y Most FMS systems comprise of three main
manufacturing system in which there is some labor cost and minimizing scrap, rework, and material
systems
amount of flexibilityy that allows the system
y to wastage.
y Work
W k machines
hi (t i ll automated
(typically t t d CNC
react in the case of changes. y Less skilled labor required.
machines) that perform a series of operations;
y Two categories of flexibility y Reduction in work
workinprocess
in process inventory by eliminating
y An integrated material transport system and a
y Machine flexibility, covers the system's ability to be the need for batch processing.
computer that controls the flow of materials,
changed to produce new product types,
types and ability to tools, and information (e.g. machining data y Reduction in production lead time permitting
change the order of operations executed on a part. manufacturers to respond more quickly to the variability
and machine malfunctions) throughout the
y Routing flexibility,
flexibility which consists of the ability to of market demand.
demand
system;
use multiple machines to perform the same operation y Better process control resulting in consistent quality.
on a part, as well as the system
system'ss ability to absorb y Auxiliaryy work stations for loading g and
largescale changes, such as in volume, capacity, or unloading, cleaning, inspection, etc.
capability.

f
AdvantagesofFMS Di d t f FMS
DisadvantagesofFMS IES 1996
IES
y Faster,, lower cost changes
g from one p
part to another y Limited ability to adapt to changes in product or product Whichofthefollowingpairsarecorrectlymatched?
which will improve capital utilization mix (e.g., machines are of limited capacity and the 1. CNCmachinePostprocessor
y Lower direct labor cost,, due to the reduction in number tooling necessary for products, even of the same family,
of workers 2. Machiningcentre.Toolmagazine
M hi i t T l i
is not always feasible in a given FMS)
y Reduced inventory, y, due to the p planningg and 3. DNC.FMS
y Substantial preplanning
pre planning activity
programming precision (a) 1,2and3 (b) 1and2
y Expensive, costing millions of dollars
y Consistent and better q quality,
y, due to the automated (c) 1and3 (d)2and3
control y Technological problems of exact component positioning
y Lower cost/unit
/ of output,
p , due to the g greater and precise timing necessary to process a component
productivity using the same number of workers y Sophisticated manufacturing systems
y Savings
g from the indirect labor,, from reduced errors,,
rework, repairs and rejects

IES 2006
IES 2006 IES 2004
IES IES 2012
IES
Flexible manufacturing allows for: Consider the following characteristics: Rankorderclusteringasappliedtomanufacturing
(a) Tool design and production 1. Single machine tool automationis
(b) Automated
A t t d design
d i 2. Manual
M l materials
t i l handling
h dli system
t (a)Atechniqueofidentifyingprocesssequencein
(c) Quick and inexpensive product change 3. Computer control productionofacomponent
(d) Quality control 4. Random sequencing of parts to machines (b)Aj ti ti (JIT) th d
(b)Ajustintime(JIT)method
Which of the above characteristics are associated with (c)Anapproachofgroupingthemachinesintocellsin
flexible manufacturing system? anFMSsystem
(a) 1,
1 2 and 3 (b) 1 and 2 ( )
(d)Atooltogeneratebillofmaterials
g
(c) 3 and 4 (d) 2, 3 and 4

For-2015 (IES, GATE & PSUs) Page 149 of 240 Rev.0


ReferenceBook N df U ti lP
NeedforUnconventionalProcesses
y CAD/CAM:ComputerAidedDesignand IFS2011 y New materials having high strength and hardness,
hardness such as
ManufacturingByGroover
Prepare a flow diagram for writing the computer nimonic alloys and alloys with alloying elements such as
y CNCMachines ByB.S.Pabla,M.Adithan
ByB S Pabla M Adithan
programme in FORTRAN for Pulse MIG welding tungsten, molybdenum, and columbium are difficult to
y Machinetooldesignandnumericalcontrol By
Mehta machine by the traditional methods.
methods
process.
y ComputerControlOfManu.Systems ByKoren y By conventional machining the MRR reduces with an
[
[10marks]
k ]
increase in the work material hardness.
y Need
N d f
for d l
development
t off nontraditional
t diti l machining
hi i
processes which utilize other methods such as
electrochemical processes for the material removal.

N df U ti lP
NeedforUnconventionalProcesses I U ti l M hi i
InUnconventionalMachining Cl ifi ti f NTMM
ClassificationofNTMM
y Complex
C l shapes.
h y Different forms of energy directly applied to the The Non traditional Machining Methods are classified
Nontraditional
workpiece to have shape transformation or material according to the major energy sources employed in
y A very high accuracy is desired besides the complexity of removal from work surface. machining.
the surface to be machined. y No chips, No lay pattern on work surface, no direct 1.ThermalEnergyMethods
physical contact between the tool and the workpiece .
y The tool material does not have to be harder than the 2.Electro ChemicalEnergyMethod
work
k material.
t i l
3.ChemicalEnergyMethods
y Tool forces do not increase as the work material gets
harder. 4.MechanicalEnergyMethods
y Economic metal removal rate does not decrease as the
work material gets harder.

1 Th lE M th d
1.ThermalEnergyMethods 2 El
2.Electro Ch i l E M h d
ChemicalEnergyMethod 3 ChemicalEnergyMethods
3. Ch i l E M th d
y Electricaldischargemachining(EDM)
El t i ldi h hi i (EDM) These methods involve controlled etching of the
y ElectroChemicalMachining(ECM)
El Ch i lM hi i (ECM)
workpiece material in contact with a chemical solution.
y LaserbeamMachining(LBM)
y ElectroChemicalgrinding(ECG)
El t Ch i l i di (ECG)
y PlasmaArcMachining(PAM)
g y Chemical Machining Method (CHM).
y ElectroChemicalHoning(ECH)
El t Ch i lH i (ECH)
y ElectronBeamMachining(EBM)
y ElectroChemicalDeburring
Electro ChemicalDeburring (ECD)
y IonBeamMachining(IBM)

For-2015 (IES, GATE & PSUs) Page 150 of 240 Rev.0


4 MechanicalEnergyMethods
4. M h i lE M th d GATE 2014
GATE2014 S Ob ti
SomeObservations
The process utilizing mainly thermal energy for y EDM has the lowest specific
p p q
power requirement and can
y UltraSonicMachining(USM)
Ult S i M hi i (USM)
achieve sufficient accuracy.
y AbrasiveJetMachining(AJM) removing material is y ECM has the highest
g metal removal rate,, MRR.
(a) Ultrasonic Machining y USM and AJM have low MRR and combined with high
y WaterJetMachining(WJM)
g tool wear,, are used for nonmetal cutting.
g
(b) Electrochemical Machining y LBM and EBM have high penetration rates with low
MRR and,, therefore,, are commonlyy used for micro
(c) Abrasive Jet Machining drilling, sheet cutting, and welding.
y CHM is used for manufacturing g PCB and other shallow
(d) Laser
L B
Beam M hi i
Machining components.
y PAM can be used for clean,, rapid p cuts and p profiles in
almost all plates upto 20 cm thick with 5o to 10o taper.

Sh C tti C bilit
ShapesCuttingCapability GATE2014 Li it ti f NTMM
LimitationsofNTMM
The various NTMM have some special shape cutting The
Th following
f ll i four
f unconventional
ti l machining
hi i processes y Expensive
E i sett up, low
l MRR and
d skilled
kill d labour
l b required.
i d
capability as given below:
are available in a shop
p floor. The most appropriate
pp p one to y The limitation of electrical machining methods is that
1. Micromachining and Drilling : LBM and EBM
drill a hole of square cross section of 6 mm 6 mm and the work material must be an electrical conductor. Also,
2 Cavity sinking and standard Hole Drilling: EDM and
2.
25 mm deep is consumption of electrical energy is very large.
USM
( ) Abrasive
(a) b Jet Machining
h y The NTMM which have not been proved commercially
3. Fine hole drilling and Contour Machining: ECM
(b) Plasma Arc Machining economical are: USM,
USM AJM,
AJM CHM,
CHM EBM and PAM.
PAM
4. Clean, rapid Cuts and Profiles: PAM
((c)) Laser
ase Beam
ea Machining
ac g
5. Shallow Pocketing: AJM
(d) Electro Discharge Machining

IES 2012
IES GATE 2006
GATE IES 2007
IES
Whichofthefollowingprocesseshasveryhighmaterial Arrangeg the p g order of
processes in the increasing Consider the following statements in relation to the
removalrateefficiency? their maximum material removal rate. unconventional machining processes:
(a)Electronbeammachining Electrochemical Machiningg ((ECM)) 1 Different forms of energy directly applied to the
1.
(b)Electrochemicalmachining Ultrasonic Machining (USM) piece to have shape transformation or material removal
Electron Beam Machining (EBM) from work surface.
surface
(c)Electrodischargemachining
Laser Beam Machining (LBM) and 2. Relative motion between the work and the tool is
( )
(d)Plasmaarcmachining g
Electric Discharge Machining (EDM) essential.
ti l
(a) USM, LBM, EBM, EDM, ECM 3. Cutting tool is not in physical contact with work
(b) EBM,
EBM LBM,
LBM USM,
USM ECM,
ECM EDM piece.
(c) LBM, EBM, USM, ECM, EDM (a) 1 and 2 onlyy (b) 1, 2 and 3 onlyy
(d) LBM, EBM, USM, EDM, ECM (c) 2 and 3 only (d) 1 and 3 only
For-2015 (IES, GATE & PSUs) Page 151 of 240 Rev.0
IES 2009
IES 2009 IAS 2002
IAS
Which one of the following statements is correct in (
Match List I (Processes) ) with List II (Tolerances
(
respect of unconventional machining processes? obtained) and select the correct answer using the codes
given below the Lists:
(a) The cutting tool is in direct contact with the job List I List II
(b) The tool material needs to be harder than the job
material
t i l
(c) The tool is never in contact with the job
(Processes)
A. Plasma Arc machining 1.
B. Laser Beam machining 2.
(Tolerances obtained)
75 microns
25 microns
ECM
(d) There has to be a relative motion between the tool C. Abrasive Jet machining 3. 50 microns
and the job
j D. Ultrasonic machining 4. 125 microns
Codes:A B C D A B C D B SKM d l
BySKMondal
(a) 4 1 3 2 (b) 3 2 4 1
(c) 4 2 3 1 (d) 3 1 4 2

El t h i l M hi i
ElectrochemicalMachining El t h i l M hi i
ElectrochemicalMachining
y Electrochemical machining is the reverse of electro y Variation in the current density will result in work
plating taking the electrodes shape.
y The workpiece
work piece is made the anode,
anode which is placed in y The electrode is fed with a constant velocity,
velocity and the
close proximity to an electrode (cathode), and a high electrolyte is fed through the tool.
amperage direct current is passed between them through
an electrolyte, such as salt water, flowing in the anode
cathode gap.
gap
y Metal is removed by anodic dissolution and is carried
away in
i the
th form
f off a hydroxide
h d id in i the
th electrolyte
l t l t for
f
recycling or recovery.
y MRR in ECM depends on atomic weight of work material
Fig- Electrochemical Machining process

ECM E i t
ECMEquipment ECM E i t
ECMEquipment ECM E i t
ECMEquipment
y Supply Voltage 2 to 35 V DC and Current 500 to 40,000 A y The electrolyte consists of the metal debris removed
y The tooltowork gap needs to be maintained at a very from the anode, which will have to be filtered before it is
small value 0.1
0 1 to 0.25
0 25 mm.
mm A servo drive is provided on repumped
re pumped into the system.
the tool axis for this purpose. y Also a large amount of heat is generated during the
y The
Th electrolyte
l t l t needs d to
t be
b pumped d through
th h this
thi gap att electrolysis which heats up the electrolyte,
electrolysis, electrolyte and hence it
high pressures ranging from 0.70 to 3.00 MPa. This needs to be cooled.
i t d
introduces a large
l amountt off load
l d on theth machine,
hi
because of the large working areas involved. Hence the
machine
hi structure
t t will
ill have
h t be
to b made d rigid
i id to
t a
withstand such forces.

For-2015 (IES, GATE & PSUs) Page 152 of 240 Rev.0


El t l t
Electrolyte Tool
y is so chosen that the anode (workpiece)
The electrolyte ( p ) The p p
properties of tool materials should be:
is dissolved but no deposition takes place on the cathode
1. High electrical and thermal comductivity
(tool).
Properties electrolyte should be 2. Easy machinability
1. High g electrical conductivityy 3. Good shiffness
2. Low viscosity 4. High corrosion resistance
ForECMofsteelNaCl isusedastheelectrolyte.
3 High specific heat
3.
y Tool materials: Copper, brass, bronze, Al, Stainless
4. Chemical stability
5 Resistance to formation of passivating film on
5. Steel Cupro nickel,
Steel, nickel etc.
etc
workpiece surface y Material wear / Tool wear: Infinite
6 Noncorrosive
6. Non corrosive and nontoxic
non toxic
7. Inexpensive and readily available

d
Advantages i d
Disadvantages A li ti
Applications
1. Use of corrosive media as electrolytesy makes it difficult to y Any electrically conductive work material irrespective
1 Complex threedimensional
1. three dimensional surfaces can be machined of their hardness, strength or even thermal properties.
handle.
accurately. Good for low machinability or complicated y The machining surface can be situated at any
2. Sharp interior edges and corners (< 0.2 mm radius) are
shapes.
shapes difficult to produce. i
inaccessible.
ibl
2. As ECM leads to atomic level dissolution, the surface 3. Very expensive machine. y Shape application blind complex cavities, curved
fi i h is
finish i excellent
ll t (Ra 0.2 to
t 0.66 m)) with
ith almost
l t stress
t 4. Forces are large with this method because of fluid pumping surfaces, through cutting,
surfaces cutting large through cavities.
cavities
free machined surface and without any thermal forces. y It is used for the machining of the gas turbine blades.
damage. 5. V
Very hi h specific
high ifi energy consumption i ( b
(about 150 times
i y Die sinking
3. The tool wear is practically nil which results in a large that required for conventional processes), y Profiling and contouring
number of components produced per tool. 6
6. Not applicable with ith electrically
electricall nonconducting
non conducting materials y T
Trepanningi
and jobs with very small dimensions y Grinding
4. MRR is highest
g (1600 mm3/min) among g NTMM and 7
7. Lower fatigue strength y D illi
Drilling
comparable with conventional machining.
y Micromachining

ISRO2009 PSU
ECMcannotbeundertakenfor
ECM tb d t k f
PSU
The machining process in which the work picce is
(a)steel Commercial ECM is carried out at a combination
di l d into
dissolved i t an electrolyte
l t l t solution
l ti is
i called
ll d off
(b)Nickelbasedsuperalloy
(a) low voltage high current
(a) Electro
Electrochemical
chemical machining (c)Al2O3
(b) low current low voltage
(d)Titaniumalloy
(b) Ultrasonic machining
g ((c)) high
g current high
g voltage
g
(c) Electrodischarge machining (d) low current low voltage

(d) Laser machining

For-2015 (IES, GATE & PSUs) Page 153 of 240 Rev.0


ECM C l l ti
ECMCalculations ECM C l l ti
ECMCalculations
IAS2011Main y laws state that,,
Faradays
EI AI
What is the principle of electrochemical It E yMRR = g/s = g/s
machining
hi i (ECM)? m= F F V
F.
What are the advantages and disadvantages of F IfyouputE=equivalentweightinCGSi.e.g/mole
IfyouputE=equivalentweightinCGSi e g/mole
ECM over conventionall drilling?
d ll Where m =weight(g)ofamaterial
Comment on the surface finish and the accuracy of I =current(A) IinAmpere(A)
the ECM. t =time(sec) F=96500columb/molei.e.As/mole
l b l l
[
[20Marks]] E =gramequivalentweightofthe
gramequivalentweightofthe TheMRRwillbeing/s
material
F co sta t o p opo t o a ty
=constantofproportionality
Faraday(96,500coulombs)

ECM C l l ti
ECMCalculations ECM C l l ti
ECMCalculations GATE 2014
GATE2014
y MRR for pure metal The p p
principle of material removal in Electro

AI cm3 EI cm3 chemical machining is


3
=
vF sec F sec (a)Ficks law

y MRR for Alloy (b)Faradayslaws


Eeq I cm 3
( )Ki hh ff l
(c)Kirchhoffslaws

eq F sec (d)Ohm slaw
(d)Ohmslaw

100 x 100 x v
= i and = i i
eq i i Eeq i Ai

E l
Example GATE2008(PI) GATE 2011(PI)
GATE 2011 (PI)
U i ECM 3/minfromanironworkpiece,
UsingECMremove5cm / i f i k i In an electro chemical machining (ECM) operation,
operation a While removing material from iron (atomic weight = 56,
valency = 2 and density = 7.8 g/cc) by electrochemical
whatcurrentisrequired?
q square hole of dimensions 5 mm x 5 mm is drilled in a
machining, a metal removal rate of 2 cc/min is desired.
block of copper. The current used is 5000 A. Atomic The current (in A) required for achieving this material
Atomicweightofiron56,density7.8g/cm3 valency,2 weight
g of cupper
pp is 633 and valencyy of dissolution is 1. removal rate is
Faradays constant is 96500 coulomb. The material (a) 896.07 (b) 14.93
removal rate (in g/s) is ( ) 448.03
(c) 8 (d) 53764.29
6
(a) 0.326 (b) 3.260 (c) 3.15 x 103 (d) 3.15 x 105

For-2015 (IES, GATE & PSUs) Page 154 of 240 Rev.0


E l
Example E l (GATE 2009)
Example(GATE2009) GATE 2013
GATE2013
Calculate the material removal rate and the Electrochemicalmachiningisperformedtoremove During the electrochemical machining (ECM) of
electrode feed rate in the electrochemical materialfromanironsurfaceof20mmx20mmunder iron (atomic weight = 56, valency = 2) at current of
machining of an iron surface that is 25 mm 25 mm thefollowingconditions: 1000 A with 90% current efficiency, the material
in crosssection using NaCl in water as electrolyte. Interelectrodegap = 0.2mm removal rate was observed to be 0.26 gm/s. If
The gap between the tool and the workpiece is 0.25 S
SupplyVoltage(DC)
l V lt (DC) = 12V
V Titanium (atomic weight = 48, valency = 3) is
mm. The supply voltage is 12 V DC. The specific machined by the ECM process at the current of 2000
Specificresistanceofelectrolyte
=2cm
resistance of the electrolyte is 3 c m A with 90% current efficiency, the expected material
For iron, Valency, Z = 2 AtomicweightofIron = 55.85 removal rate in gm/s will be
At
Atomici weight,
i ht A = 55.85
8 ValencyofIron = 2 (a) 0.1
0 1 1 (b) 0.23
0 23 (c) 0.30
0 30 (d) 0.52
0 52
Density, = 7860 kg / m3 Faraday'sconstant = 96540Coulombs
Th t i l
Thematerialremovalrate(ing/s)is
l t (i / )i

E l
Example GATE 2008
GATE Fl l i
Flowanalysis
p
Composition p
of a Nickel superalloyy is as follows: y To calculate the fluid flow required, match the heat
A researcher
h conducts
d t electrochemical
l t h i l machining
hi i
Ni = 70.0%, Cr = 20.0%, Fe = 5.0% and rest Titanium generated to the heat absorbed by the electrolyte.
Calculate rate of dissolution if the area of the tool is 1500 ((ECM)) on a binary
y alloy
y ((density g/ 3) of iron
y 6000 kg/m
mm2 and a current of 1000 A is being passed through the (atomic weight 56, valency 2) and metal P (atomic
cell Assume dissolution to take place at lowest valancy
cell.
of the elements. weight 24, valency 4). Faraday's constant = 96500
coulomb/mole.
l b/ l Volumetric
V l t i material
t i l removall rate
t off
y is 550 mm3/s at a current of 2000 A. The
the alloy y Neglecting all the heat losses
percentage of the metal P in the alloy is closest to
l2R = q e ce (B o )
(a) 40 (b) 25 (c) 15 (d) 79

E l
Example DynamicsofElectrochemicalMachining
The electrochemical machining of an iron surface that is g
Overvoltage
25 mm 25 mm in crosssection using NaCl in water as y If the total over voltage at the anode and the cathode is
electrolyte. The gap between the tool and the workpiece V and the applied voltage is V,
V the current I is given
is 0.25 mm. The supply voltage is 12 V DC. The specific by,
V V
resistance of the electrolyte is 3 cm. I=
R
Estimate the electrolyte flow rate. Specific heat of the
electrolyte is given as 0.997
0 997 cal/g
cal/gC
C. The ambient
temperature is 35C and the electrolyte boiling
temperature is 95
temperature, 95C
C.
Density, = 7860 kg/m3 y Schematic representation of the ECM process with no
feed to the tool
For-2015 (IES, GATE & PSUs) Page 155 of 240 Rev.0
E l
Example GATE 2007(PI)
GATE 2007 (PI) GATE 2012(PI)LinkedS1
In
I ECM operation
ti off pure iron
i an equilibrium
ilib i gap off 2 Which one of the following process conditions In an EDM process using RC relaxation circuit,
circuit a 12 mm
leads to higher MRR in ECM process? diameter through hole is made in a steel plate of 50 mm
mm is to be kept.
p Determine supply
pp y voltage,
g , if the total thickness using a graphite tool and kerosene as
( ) higher
(a) hi h current,t larger
l atomic
t i weight
i ht
overvoltage is 2.5 V. The resistivity of the electrolyte is 50 dielectric. Assume discharge time to be negligible.
((b)) higher
g valency,
y, lower current Machining is carried out under the following conditions:
mm and the set feed rate is 0.25 mm/min. (c) lower atomic weight, lower valency Resistance 40
(d) higher
hi h valency,
l l
lower atomic
i weight
i h Capacitance 20 F
Supply
pp y voltage
g 220 V
Discharge voltage 110 V
The time for one cycle,
cycle in milliseconds,
milliseconds is
(a) 0.55 (b) 0.32 (c) 0.89 (d) 0.24

GATE 2012(PI)LinkedS2 l h i l G i di ( CG)


ElectrochemicalGrinding(ECG)
In an EDM process using RC relaxation circuit,
circuit a 12 mm y In ECG,, the tool electrode is a rotating,
g, metal bonded,,
diamond grit grinding wheel.
diameter through hole is made in a steel plate of 50 mm
y As the electric current flows between the workpiece and the
thickness using a graphite tool and kerosene as wheel, through the electrolyte, the surface metal is changed
dielectric. Assume discharge time to be negligible. to a metal oxide, which is ground away by the abrasives. As
Machining is carried out under the following conditions: the oxide film is removed,
removed new surface metal is oxidized and
Resistance 40 removed.
y ECG is a low
lowvoltage
voltage high
highcurrent
current electrical process.
process
Capacitance 20 F
y The purpose of the abrasive is to increase the efficiency of the
Supply
pp y voltage
g 220 V ECG pprocess and ppermit the continuance of the pprocess.
Discharge voltage 110 V y The abrasive particles are always nonconductive material
such as aluminum oxide, diamond, or borazon (CBN). Thus
Averagepowerinput(inkW)is
they act as an insulating spacer maintaining a separation of Equipmentsetupandelectricalcircuitforelectrochemicalgrinding.
(a)0.373 (b)0.137 (c)0.218 (d)0.500 from 0.012 to 0.050 mm between the electrodes.

El t h i l G i di (ECG)
ElectrochemicalGrinding(ECG) IES 2000
IES
y The p p g and sharpening
process is used for shaping p g C
Consider the following g statements: p
OtherElectrochemicalprocesses
carbide cutting tools, which cause high wear rates on In electrochemical grinding,
expensive diamond wheels in normal grinding. y Electrochemicalpolishing
p g
1 A rubber bonded alumina grinding wheel acts as the
1.
Electrochemical grinding greatly reduces this wheel
cathode and the workplace as the anode.
wear. y Electrochemicalholedrilling
g
2 A copper bonded alumina grinding wheel acts as the
2.
y Fragile parts (honeycomb structures), surgical needles,
cathode and the work piece as the anode.
and tips of assembled turbine blades have been ECG y ElectrochemicalDeburring
g
processed d successfully.
f ll 3 Metal removal takes place due to the pressure
3.
applied by the grinding wheel.
y The lack of heat damage, burrs, and residual stresses is
very beneficial,
b f l particularly
l l when
h coupled
l d withh MRRs
4 Metal removal takes place due to electrolysis.
4. electrolysis
that are competitive with conventional grinding but Which of these statements are correct?
with
ith far
f less
l wheel
h l wear. (a) 1 and 3 (b) 2 and 4
For-2015 (IES, GATE & PSUs) (c) 2 and 3 (d) Page 156 of 240
1 and3 Rev.0
GATE 2001
GATE GATE 1997
GATE GATE 1992
GATE
In ECM, the material removal is due to Selection electrolyte for ECM is as follows: The two main criteria for selecting the electrolyte in
(a) Corrosion (a) Nonpassivating electrolyte for stock removal and Electrochemical Machining (ECM) is that the
(b) Erosion
E i passivating electrolyte for finish control electrolyte should
(c) Fusion (b) Passivating electrolyte for stock removal and non (a) Be chemically stable
(d) Ion displacement passivating
i ti electrolyte
l t l t for
f finish
fi i h control
t l (b) Not
N t allow
ll dissolution
di l ti off cathode
th d material
t i l
(c) Selection of electrolyte is dependent on current (c) Not allow dissolution of anode material
density (d) Have high electrical conductivity
((d)) Electrolyte
y selection is based on tool work
electrodes

GATE 1997
GATE IES 2002
IES IES 1997
IES
Inter electrode gap in ECG is controlled by Assertion (A): In ECM, the shape of the cavity is the Which one of the following processes does not
(a) Controlling the pressure of electrolyte flow mirror image of the tool, but unlike EDM, the tool cause tool wear?
(b) Controlling
C t lli the th applied
li d static
t ti load
l d wear in ECM is less. (a) Ultrasonic machining
(c) Controlling the size of diamond particle in the wheel Reason (R): The tool in ECM is a cathode. (b) Electrochemical machining
(d) Controlling the texture of the work piece ( ) Both
(a) B th A and d R are individually
i di id ll true
t and
d R is
i the
th (c) Electric discharge machining
correct explanation of A ((d)) Anode mechanical machiningg
(b) Both A and R are individually true but R is not the
correct explanation of A
(c) A is true but R is false
(d) A is false but R is true

Ph i l P i i l
PhysicalPrinciple Ph i l P i i l
PhysicalPrinciple
y Basic process y An arc jumps between two points along the path of least
resistance.

For-2015 (IES, GATE & PSUs) Page 157 of 240 Rev.0


Ph i l P i i l
PhysicalPrinciple Ph i l P i i l
PhysicalPrinciple Ph i l P i i l
PhysicalPrinciple
y The energy of the arc is so concentrated that it causes the y The metal and dielectric fluid is partly vaporized, y The blast from the expanding vapors knocks some
electrode, and the work to melt. But the electrode causing sudden expansion. molten particles loose, and the remaining molten metal
material is chosen so that it melts less. hardens.

Ch t i ti f EDM
CharacteristicsofEDM Ch t i ti f EDM
CharacteristicsofEDM EDM T l
EDMTool
y Mechanics of material removal melting and y Uses Voltage of 60 to 300 V to give a transient arc lasting Prime requirements EDM tool Material
evaporation aided by cavitation. from 0.1 s to 8 ms. 1. It should be electrically conductive.
y The process is based on melting temperature,
temperature not y Typical cycle time is 20 ms or less,less up to millions of 2. It should
h ld have
h goodd machinability,
hi bilit thus
th allowing
ll i
hardness, so some very hard materials can be machined cycles may be required for completion of the part. easy manufacture of complex shapes.
this way.
way y Rotating
R t ti theth wire
i in
i an orbital
bit l direction
di ti will,
ill 3. It should have low erosion rate or good work to tool
y The arc that jumps heats the metal, and about 1 to 10% of Increase accuracy in form and surface finish wear ratio.
th molten
the lt metal
t l goes into
i t the
th fluid.
fl id The
Th melted
lt d metal
t l Decrease electrode wear 4. It should have low electrical resistance.
then recast layer is about 1 to 30 m thick, and is
y Surface finish obtained 0.25
0 25 m 5. It should have high melting point.
generally
ll hard
h d andd rough.
h
6. It should have high electron emission.
y The electrode workpiece gap is in the range of 10 m to
100 m.

EDMTool W R ti
WearRatio S M h i
ServoMechanism
Theusualchoicesfortool(electrode)materialsare y One major drawback of EDM is the wear that occurs on y The
Th gap between
b t the
th tool
t l and
d work
k has
h a critical
iti l
y Copper, the electrode at each spark. Tool wear is given in terms of
wear ratio which is defined as, importance.
p As the workpiece
p is machined,, this g
gap
p
y brass,
b
y alloysofzincandtin, tends to increase. For optimum machining efficiency,
Volume of metal removed work
W
Wear ratio
ti =
y hardenedplaincarbonsteel, Volume of metal removed tool this gap should be maintained constant. This is done by
y coppertungsten, servo mechanism
h i which
hi h controls
t l the
th movementt off the
th
y Wear ratio for brass electrode is 1: 1. For most other
y silvertungsten,
metallic electrodes, it is about 33: 1 or 4
4: 1. electrode.
y tungstencarbide,
t t bid
y With graphite (with the highest melting point, 3500C),
y coppergraphite,andgraphite.
the wear ratio may range from 5: 1 up to 50: 1.
For-2015 (IES, GATE & PSUs) Page 158 of 240 Rev.0
Di l t i Fl id
DielectricFluid S 20 C i l
IES2011Conventional R l ti i it
Relaxationcircuit
y Fluid is used to act as a dielectric,, and to help
p carryy awayy
Discuss
Di the
th effects
ff t off insufficient
i ffi i t dielectric
di l t i and
d
debris.
y If the fluid is p
pumpedp through g and out the end of the electrolyte
y circulation in the interelectrode g
gap
p on the
electrode, particles will push out, and mainly collect at
the edges. They will lower the dielectric resistance, Electric Discharge machining and Electro Chemical
Fig Relaxation circuit used for generating the pulses in EDM process
Fig-Relaxation
resulting in more arcs. As a result the holes will be Machining process respectively. [5 Marks]
conical.
y If fluid is vacuum pumped into the electrode tip, straight
holes will result.
y Quite often kerosenebased oil.
y The dielectric fluid is circulated through the tool at a
pressure of 0.35 N/m2 or less. To free it from eroded
metal particles, it is circulated through a filter.

Ad t
Advantages Disadvantages A li ti
Applications
1. Hardness,, toughness
g or brittleness of the material p
poses no 1. O
Onlyy electricallyy conductive materials can be machined
problems. Due to this EDM can be used for machining y EDM can be
b used
d for
f machining
hi i any material
t i l that
th t is
i
by EDM. Thus non metallic, such as plastics, ceramics
materials that are too hard or brittle to be machined by or glass, cannot be machined by EDM. electricallyy conductive,, thus including
g metals,, alloys
y and
conventional
ti l methods.
th d
2. Electrode wear and overcut are serious problems.
2. The method does not leave any chips or burrs on the work most carbides.
piece.
piece 33. A rehardened,, highly
g y stressed zone is p
produced on the
work surface by the heat generated during machining. y EDM is widely used for machining burr free intricate
3. Cutting forces are virtually zero, so very delicate and fine
work can be done.
done This brittle layer can cause serious problems when the
part is put into service. shapes,
h narrow slots
l and
d blind
bl d cavities etc., for
f example,
l
4. The process dimension repeatability and surface finish
obtained in finishing g are extremelyy g
good. 4. Perfectly square corners cannot be made by EDM. sinking of dies for moulding,
moulding die casting,
casting plastic
5. The characteristic surface obtained, which is made up of 5. High specific energy consumption (about 50 times that
p in better oil retention. This improves
craters, helps p die life. in conventional machining) moulding, wire drawing, compacting, cold heading,
6. Because the forces between the tool and the workpiece and 6. MRR is quite low forging, extrusion and press tools.
virtually zero, very delicate work can be done.

A li ti
Applications A li ti
Applications
y EDM is
i particularly
ti l l useful
f l when
h dealing
d li with
ith internal
i t l y The method is also employed for blanking parts from sheets,
sheets IES2009Conventional
cutting off rods of materials, flat or form grinding and i. What is the principle of metal removal in EDM
cuts that are hard to g
get tools into. Machining
g tends to
process??
sharpening of tools, cutters and broaches.
work best with external cuts. ii. Describe the process with the help of sketch.
y In EDM method,
method small holes,
holes about 0.13
0 13 mm,
mm in
y Almost any geometry (negative of tool geometry) can be iii. List advantages and limitations of the system.
diameter and as deep as 20mm diameters can be drilled [ 5
[15marks]
]
generated
d on a workpiece
k iff a suitable
bl tooll can be
b with virtually no bending or drifting of hole. Due to this,
fabricated (the use of punch as a tool to machine its own EDM is particularly useful for machining of small holes,
holes
mating die is commonly employed in EDM method). orifices or slots in dieselfuel injection nozzles, or in aircraft
engines, air brake valves and so on.
For-2015 (IES, GATE & PSUs) Page 159 of 240 Rev.0
GATE 1994
GATE Wi EDM
WireEDM
Electric discharge machining is more efficient y Wire EDM is a special form of EDM wherein the
process than Electrochemical machining for
producing large non
noncircular
circular holes. electrode is a continuously moving conductive wire.
The above statement is y A thin wire of brass, tungsten, or copper is used as an
( ) True
(a) T
electrode.
(b) False
(c) Cant say y The electrode wire is typically made with a 0.05 to 0.25
(d) Insufficient data mm diameter,
diameter which is wire electrode wound between
the two spools.

y Deionized water is used as the dielectric.

Wi EDM
WireEDM GATE 2014 (PI)
GATE2014(PI)
Find the correct combination of manufacturing processes to
y This
Thi process is
i much
h faster
f t than
th electrode
l t d EDM.
EDM produce
d the
th part,
t shown
h in
i figure,
fi from
f a blank
bl k (holes
(h l shown
h
are with square and circular crosssections)
y This process is widely used for the manufacture of
punches, dies, and stripper plates, with modern
machines capable of cutting die relief, intricate
openings, tight
h radius
d contours, and
d corners routinely.
l (a) Drilling and milling on column and knee type universal
y Geometrically accurate but moderately finished straight
milling
g machine
toothed metallic spur gears,
gears both external and internal
(b) Diesinking and CNC Wirecut EDM process
type, can be produced by wire type Electro discharge
Machining (EDM).
(EDM) (c) Die
Diesinking
sinking and CNC drilling
(d) CNC Wirecut EDM process only

El t i Di h G i di (EDG)
ElectricDischargeGrinding(EDG) El t i Di h G i di (EDG)
ElectricDischargeGrinding(EDG)
y EDG is similar to EDM except that the electrode is a y The spark gap is normally held at 0.013
0 013 to 0.076
0 076 mm
rotating wheel (usually graphite). y The graphite wheel is rotated at 0.5 to 3 m/s
y Positively charged work pieces are immersed in or The method
Th th d can be
b used d for
f
flooded by a dielectric fluid and fed past the negatively 1. External cylindrical grinding, internal grinding and
charged wheel by servocontrolled
servo controlled machine table.
table surface grinding.
y Metal is removed by intermittent high frequency
2. Grinding g carbide and steel at the same time without
electrical
l t i l discharges
di h passing
i th
through
h the
th gap between
b t wheel loading.
wheel and workpiece.
3. Grinding thin sections where abrasive wheel pressures
y Each spark discharge melts or vaporizes a small amount
might cause distortion.
of metal from the workpiece surface, producing a small
4 Grinding brittle materials or fragile parts where
4.
crate at the discharge sit, as in EDM.
For-2015 (IES, GATE & PSUs) Page 160Grinding
Fig- Electric Discharge of 240 (EDG) Rev.0
abrasive materials might cause fracturing.
IES 2012
IES GATE 2004
GATE GATE 2003
GATE
Statement (I): In Electro Discharge Machining (EDM) The mechanism of material removal in EDM As tool and work are not in contact in EDM process
process, tool is made cathode and work piece anode process is (a) No relative motion occurs between them
Statement (II): In this process if both electrodes are made of (a) Melting and Evaporation (b) No
N wear off tool
t l occurs
same material, greatest erosion takes place upon anode
(b) Melting and Corrosion (c) No power is consumed during metal cutting
(a) Both Statement (I) and Statement (II) are individually
true and Statement (II) is the correct explanation of (c) Erosion and Cavitation (d) No force between tool and work occurs
Statement (I)
() ((d)) Cavitation and Evaporation
p
(b) Both Statement (I) and Statement (II) are individually
true but Statement ((II)) is not the correct explanation
p of
Statement (I)
(c) Statement (I) is true but Statement (II) is false
(d) Statement (I) is false but Statement (II) is true

GATE 1999
GATE G 20 0 ( )
GATE2010(PI) GATE 2007
GATE
In Electro Discharge Machining (EDM), the tool is
ElectroDischarge Keeping all other parameters unchanged,
unchanged the tool In electro discharge machining (EDM), if the
made of thermal conductivity of tool is high and the specific
wear in electrical discharge machining (EDM) would heat of work piece is low, then the tool wear rate
(a) Copper (b) High Speed Steel
(c) Cast Iron (d) Plain Carbon Steel be less if the tool material has and material removal rate are expected to be
respectively
(a) high thermal conductivity and high specific heat (a) High and high (b) Low and low
( ) high thermal conductivity and low specific heat
(b) ( ) High
(c) Hi h and
d low
l (d) Low
L and d high
hi h

(c) low thermal conductivity and low specific heat

(d) low thermal conductivity and high specific heat

GATE 2005
GATE IES 2005
IES GATE 2000
GATE
A zigzag cavity in a block of Which of the following is/are used as low wearing Deep hole drilling of small diameter, say 0.2 mm is
high strength alloy is to be tool material(s) in electric discharge machining? done with EDM by selecting the tool material as
finish machined. This can be (a) Copper and brass (a) Copper wire (b) Tungsten wire
carried out by using (b) Aluminium and graphite (c) Brass wire (d) Tungsten carbide
(a) Electricdischargemachining (c) Silver tungsten and copper tungsten
(b) Electrochemicalmachining ((d)) Cast iron
(c) Laserbeammachining
((d)) Abrasiveflowmachining
g

For-2015 (IES, GATE & PSUs) Page 161 of 240 Rev.0


Ult i M hi i
UltrasonicMachining
GATE 2009(PI) UltrasonicMachining
A titanium sheet of 5.0 mm thickness is cut by wire
cut EDM process using a wire of 1.0
1 0 mm diameter.
diameter
A uniform spark gap of 0.5 mm on both sides of the
wire is maintained during cutting operation. If the
feed rate of the wire into the sheet is 20 mm/min,
the material removal rate (in mm3/min) will be

((a)) 150
5 ((b)) 200 ((c)) 3300 ((d)) 4
400 BySKMondal

Ult i M hi i
UltrasonicMachining Ult i M hi i
UltrasonicMachining Ult i M hi i
UltrasonicMachining
y In ultrasonic machining, a tool of desired shape vibrates at an y USM is mainly used for machining brittle materials y At full indentation, the indentation depth in the work
ultrasonic frequency (19 ~ 25 kHz) with an amplitude of {which are poor conductors of electricity and thus material is characterized by w. Due to the indentation,
around 155 550
m over the workpiece.
p cannot be processed by Electrochemical and Electro
Electro as the work material is brittle, brittle fracture takes place
y Generally the tool is pressed downward with a feed force, F. discharge machining (ECM and EDM)}. leading to hemispherical fracture of diameter 2x under
Between the tool and workpiece, p , the machining g zone is the contact zone.
flooded with hard abrasive particles generally in the form of
y If at any moment of time, there are an average n of grits
water based slurry.
and the tool is vibrating at a frequency f f then material
y As the tool vibrates over the workpiece, the abrasive particles
removal rate can be expressed as
act as the indenters and indent both the work material and
the tool. The abrasive particles, as they indent, the work 2
material, would remove the same, particularly if the work y MRRw = ( w db )3/2 nf
material is brittle, due to crack initiation, propagation and 3
brittle fracture of the material.

P P t
ProcessParameters EffectofmachiningparametersonMRR Ult i M hi
UltrasonicMachine
Feedforce(F)

Amplitudeofvibration(ao)

averagegritdiameter,dg

Frequencyofvibration(f)

Volumeconcentrationofabrasive
inwaterslurry C
For-2015 (IES, GATE & PSUs) Page 162 of 240 Rev.0
Ult i M hi
UltrasonicMachine Ult i M hi
UltrasonicMachine SubsystemsofUSM
Subsystemsof USM
y The basic mechanical structure of an USM is very similar y Feed mechanism to provide a downward feed force on
to a drill press. the tool during machining
y It has additional features to carry out USM of brittle y The transducer,
transducer which generates the ultrasonic vibration B
work material. y The horn or concentrator, which mechanically amplifies
y The
Th workpiece
k i i mounted
is t d on a vice,
i which
hi h can be
b the vibration
th ib ti to t the
th required
i d amplitude
lit d off 15 50 m and
d
located at the desired position under the tool using a 2 accommodates the tool at its tip. A C
axis
i table.
t bl
y The table can further be lowered or raised to
accommodate work of different thickness.
y Slurryy deliveryy and return system
y D
E

T d
Transducer GATE2010(PI) T l h ld H
ToolholderorHorn
y The ultrasonic vibrations are produced by the y Its
It function
f ti is
i to
t increase
i the
th tool
t l vibration
ib ti amplitude
lit d
Ultrasonic
l i machines,
hi used
d in
i material
i l removall processes,
transducer. The transducer is driven by suitable signal
generator followed by power amplifier. The transducer q
require ultrasonic transducers. The transducers works on and to match the vibrator to the acoustic load.
for USM works on the following principle different working principles. One of the working principles y It must be constructed of a material with good acoustic
Piezoelectric effect
of such ultrasonic transducers is based on
Magnetostrictive effect
properties and be highly resistant to fatigue cracking.
(a) eddy current effect (b) Seebeck effect
Electrostrictive effect y Monel and titanium have good acoustic properties and
y Magnetostrictive
g transducers are most p
popular
p and (c) p
piezoresistive effect (d) p
piezoelectric effect
are often used together with stainless steel,
steel which is
robust amongst all.
cheaper.

T l
Tool Limitations A li ti
Applications
y Tools
T l should
h ld be
b constructed
t t d from
f relatively
l ti l ductile
d til y LowMRR y Used for machining hard and brittle metallic alloys,
y Ratherhightoolwear semiconductors, glass, ceramics, carbides etc.
materials. y Used for machining round,
round square,
square irregular shaped
y Lowdepthofhole
L d th fh l
y The harder the tool material, the faster its wear rate will holes and surface impressions.
y Machining,
M hi i wire
i drawing,
d i punching
hi or small ll blanking
bl ki
be. dies.

For-2015 (IES, GATE & PSUs) Page 163 of 240 Rev.0


Note GATE 1994
GATE IES2011
y The following material is generally machined by USM Ultrasonic machining is about the best process for USM has good machining performance for :
(i) Glass making holes in glass which are comparable in size (a) Al
(ii) Sili
Silicon with the thickness of the sheet.
(b) Steel
(iii) Germanium The above statement is
((c)) Super
p alloys
y
y Tool in USM is generally made of Steel
( ) True
(a) T
(d) Refractory material
(b) False
(c) Cant say
(d) Insufficient data

GATE 1993
GATE GATE 1992
GATE 1992 IES 2009
IES
In ultrasonic machining process, the material In Ultrasonic Machining (USM) the material By which one of the following processes the
removal rate will be higher for materials with removal rate would metering holes in injector nozzles of diesel engines
(a) Higher toughness (b) Higher ductility (a) Increase can be suitably made?
(c) Lower toughness (d) Higher fracture strain (b) Decrease (a) Ultrasonic machining
(c) Increase and then decrease (b) Abrasive
Ab i jet j t machining
hi i
((d)) decrease and then increase (c) Electron beam machining
with increasing mean grain diameter of the abrasive (d) Chemical machining
material.

IES 2006
IES IAS 1996
IAS Chemical Machining
ChemicalMachining
During ultrasonic machining, the metal removal is During ultrasonic machining, the metal removal is y Chemicals
Ch i l are used
d to
t dissolve
di l material
t i l
achieved by affected by the
(a) High frequency eddy currents (a) Hammering action of abrasive particles y Masks are used to control attack
(b) high frequency sound waves (b) Rubbing action between tool and workpiece y Most common use is circuit boards and p
plates for
(c) Hammering action of abrasive particles (c) High frequency sound waves
printing.
((d)) Rubbing
g action between tool and workpiece
p ((d)) High
g frequency
q y eddyy currents
y Cutting speed of 0.00250.1 mm/minute very slow

For-2015 (IES, GATE & PSUs) Page 164 of 240 Rev.0


Chemical Machining
ChemicalMachining Photo Chemical Machining
PhotoChemicalMachining Photo Chemical Machining
PhotoChemicalMachining
y PCM is a material removal process using chemicals
(etchants) to produce high precision parts.
y This process is also known as Photo Etching,
Etching Chemical
Blanking and Photo Chemical Milling.
y Coat
C t b th sides
both id off the
th plate
l t with
ith photoresist.
h t i t
(photoresist is a polymer that adheres to the metal when
exposedd to
t UV light).
li ht)
y Spray metal with etchant or dip it in hot acidic solution
t etch
to t h allll material
t i l other
th than
th partt coveredd with
ith
photoresist (115 min.).
y Rinse
Ri th plate
the l t tot ensure photoresist
h t i t and
d etchant
t h t
removal.

L B M hi i
LaserBeamMachining L B M hi i
LaserBeamMachining LaserBeamMachining
y Direct laser beam against surface of workpiece, as in
y Produceslargeremelt zone
laser welding
y Canproduceholesassmallas0.0005mmdiameter
C d h l ll di
y Successive pulses from laser gun vaporize tiny bits of
y Canproducedeepholes
workpiece
k i
y Usedtoproducecoolingholesinblades/vanesforjet
y Location of laser beam controlled by computer
engines
y Workpiece
p need not be conductive

y Cuts are tapered

y Gotta trap overshoot from laser beam


310 311 312

l h
ElectronBeamMachining ElectronBeamMachining
y Workpiece placed in vacuum
acuum chamber
IFS2011
y Highvoltage
g g electron beam directed toward Writetheadvantages,limitationsandapplicationsof

workpiece electronbeammachining.Whatisthesafetyproblem
connectedwithEBM?
t d ithEBM?
y Energy of electron beam melts/ vaporizes selected
region of workpiece [5 Marks]
[5Marks]

y Electron beam moved by


y deflection coils

y Similar process to EB welding

For-2015 (IES, GATE & PSUs) 313


Page 165 of 240 314
Rev.0
l
PlasmaArcCutting WaterJetMachining h
WaterJetMachining
y Plasma is a stream of ionized gas y Narrowjetofwaterdirected,athighpressureand
j f di d hi h d
y Typical temperatures are very high velocity,againstsurfaceofworkpiece
y, g p
y Same process as plasma welding, without filler metal y Jetofwatererodessurfaceofworkpiece,thereby
y Torch movement controlled by computer cuttingworkpiece
y Power requirements depend on material being cut,
cut y Computercontroltoachieveshape
C t t lt hi h
plus depth of cut
y Recast layer is deeper than with other processes

316 317 318

Abrasive Jet Machining (Dry)


AbrasiveJetMachining(Dry) GATE 2013 (PI)
GATE2013(PI)
y It is similar to sand blasting, except that a very narrow jet of AbrasiveJetMachining
g
gas and abrasive p g
particles achieves localized cutting.
y It removes material through the eroding action of a high In
I water
t jet
j t machining,
hi i the
th water
t jet
j t is
i issued
i d
velocity stream of abrasiveladen gas. through
g a 0.33 mm diameter orifice at a p
pressure of
y The gas is first compressed and mixed with the abrasive
powder in a mixing chamber and passed through outlet 400 MPa. The density of water is 1000 kg/m3. The
nozzle.
l
coefficient of discharge is 1.0. Neglecting all losses
y Computer is used to position the jet.
y G Pressure
Gas P about
b t 7 atm
t d i
during water
t jet
j t formation
f ti th
through
h the
th orifice,
ifi th
the
y Velocity of jet about 300 m/s
y Jet Diameter 0.12
0 12 mm to 1.25
1 25 mm power of the water jjet in KW is
p
y Abrasive used: Al2O3 , SiC with particle size 10 to 50 m
(a) 25.3 (b) 50.6 (c) 75.9 (d) 101.2
y Tool (nozzle) material tungsten carbide or sapphire
y Tool(nozzle)Life about30hours
319 321

AdvantagesofAJM DisadvantagesofAJM ApplicationofAJM


y Can be used in any material, conductive, non y LowMRR y Cutting and drilling on metal foils and thin
conductive ductile or brittle
conductive, y Possibilityofstraycutting
P ibilit f t tti sections of ceramics and glass
y Good dimensional accuracy (0.05 mm) y Intricate holes in electronic components such as
y Embeddingofabrasiveparticlesinsoftworkpiece
y Good Surface finish 0.25 to 1.25 m resistor paths in insulation
y Dustcontrolneeded
y Due to cooling action of gas stream no thermal damage y Engraving of characters on toughened glass

on the work surface automobile windows

y Due to negligible
g g force delicate workpiece
p can be y Cleaning, polishing and deburring the surface

machined. For-2015 (IES, GATE & PSUs) Page 166 of 240 Rev.0
GATE2014(PI)
GATE2012SameQinGATE2012(PI)
Q ( ) A hard
h d ceramic i marble,
bl having
h i density
d it () ( ) off 3000 kg/m k / 3
IAS2011Main
In abrasive jet machining, as the distance between and diameter (d) of 0.025 m, is dropped accidentally Statethemechanismofcuttingbyabrasivejet.
th nozzle
the l tip
ti andd the
th work k surface
f i
increases, th
the f
from a static
t ti weather
th balloon
b ll att a height
h i ht off 1 km k above b
material removal rate the roof of a greenhouse. The flow stress of roof material Whataretheadvantagesanddisadvantagesof
( ) increases continuously.
(a) l ( ) is
() i 2.5 GPa.GP Th marble
The bl hits
hit and d creates t an
AJM?Mentiontwoapplications.
(b) decreases continuously. indentation on the roof. Assume that the principle of
creation
ti off indentation
i d t ti i the
is th same as that th t in i case off [
[10Marks]
]
(c) decreases, becomes stable and then increases.
abrasive jet machining (AJM). The acceleration due to
(d) increases,
increases becomes stable and then decreases.
decreases gravity
it (g)
( ) is / 2. If V is
i 10 m/s i the
th velocity,
l it in i m/s, / off theth
marble at the time it hits the greenhouse, the
indentation
d d h = 1000 d V , in mm, is.........
depth
6

b
AbrasiveWJCutting AbrasiveWJCutting
IFS2011 y Used to cut much harder materials

Whatarethedisadvantagesofabrasivejetmachining? y Water is not used directly to cut material as in Pure, y Evolution of mixing tube
technology
Writesomeofitsapplications. instead water is used to accelerate abrasive particles which
y Standard Tungsten Carbide
g
do the cutting lasts 46
4 6 hours (not used much
[5Marks]
y 80mesh garnet (sandpaper) is typically used though 50 anymore)
and
d 120mesh
h is also
l used
d y Premium Composite Carbide
lasts 100150 hours
y Standoff distance between mixing
g tube and workpart
p is
y Consumables
C bl i l d
include water,
t
typically 0.0100.200 important to keep to a minimum to abrasive, orifice and mixing
keep a good surface finish tube

GATE 1992
GATE GATE 2011
GATE2011 GATE 2007
GATE
Match the following non traditional machining
Match the following g components
p pp p
with the appropriate processes with the corresponding material removal gp
Matchthemostsuitablemanufacturingprocessesfor
machining processes: mechanism: thefollowingparts.
p
Component Process Machiningprocess
gp Mechanismofmaterialremoval
f Parts g
ManufacturingProcesses
(A) Square hole in a high strength alloy (1) Milling P.Chemicalmachining 1.Erosion P. Computerchip 1. ElectrochemicalMachining
((B)) Square
q hole in a ceramic component
p ((2)) Drilling
g Q.Electro
Q Electro chemical 2 Corrosivereaction
2.Corrosivereaction Q Metalformingdiesandmoulds
Q.
(C) Blind holes in a die (3) ECM machining 2. UltrasonicMachining
((D)) Turbine blade pprofile on high
g strength
g alloy(4)
y(4) JJig
g boringg R Electro discharge
R.Electro 3 Iondisplacement
3.Iondisplacement R Turbineblade
R. 3
3. Electro discharge
Electrodischarge
(5) EDM machining Machining
(6) USM S.Ultrasonicmachining 4.Fusionandvaporization S Glass
S. 4
4. PhotochemicalMachining
Codes:A B C D A B C D
(a)P 2,Q 33,R 4,S 1(b)P 2,Q 4,R 33,S 1
Codes:P Q R S P Q R S
(a) 4 1 2 3 (b) 5 6 1 3
(c)P 3,Q 2,R 4,S 1(d)P 2,Q 3,R 1,S 4 ( ) 4
(a) 3 1 2 (b) 4 3 2 1
2 For-2015 (IES, GATE
(d) &3 PSUs) Page 167 of 240
(d) 1 Rev.0
(c) 4 1 3 1 2 4
(c) 3 1 4 2 2 4 3
GATE 1998
GATE 1998 IES 2008
IES IES 1998,ISRO2009
IES 1998 ISRO 2009
List I List II Match List
ListII with List II and select the correct answer
ListII Match List
ListII (Machining process) with List II
ListII
(A) ECM (1) Plastic shear using the code given below the lists: (Associated medium) and select the correct answer
(B) EDM ( )
(2) E i /B ittl fracture
Erosion/Brittle f t ListII
List ListII
List II using the codes given below the lists:
(Unconventional machining process) (Basic process) ListI ListII
(C) USM (3) Corrosive reaction
A Electro polishing
A. 1
1. Thermal A Ultrasonic
A. Ult i machining
hi i 1. K
Kerosene
(D) LBM (4) Melting and vaporization
B. Electrochemical machining 2. Mechanical B. EDM 2. Abrasive slurry
(5) Ion displacement
C Abrasive
C. Ab i jet j machining
hi i 3. El
Electrochemical
h i l C. ECM 3. Vacuum
(6) Plastic shear and ion displacement D. Electrical discharge machining 4. Chemical
Codes:A
C d A B C D A B C D D. EBM 4. Salt solution
Code:A B C D A B C D
(a) 4 1 2 3 (b) 5 4 2 4 Code:A B C D A B C D
(a) 4 3 2 1 (b) 2 1 4 3
(c) 4 2 1 3 (d) 3 1 2 4 ( ) 2
(a) 3 4 1 (b) 2 1 4 3
(c) 4 1 2 3 (d) 2 3 4 1
(c) 4 1 2 3 (d) 4 3 2 1

IES 2005
IES 2005 IES 2003
IES IES 2003
IES
Match List I ((Machining g Process)) with List II (
Match List I (Materials)) with List II ((Machining) g) and Assertion ((A): ) Water jet j machiningg uses high g
(Application) and select the correct answer using the select the correct answer using the codes given below pressure and high velocity water stream which acts
code given below the Lists: the Lists: like a saw and cuts a narrow groove in the material.
List I List II List I List II
A. EDM 1. Holes & cavities in hard & brittle materials Reason (R): The force required for cutting is
(Materials) (Machining) generated from sudden change in the momentum
B LBM 2.
B. 2 Microdrilling
Micro drilling & micro
microwelding
welding of
materials A. Machining of conducting materials 1. ECM of the water stream.
C. USM 3. Shaping of hard metals or reshaping of B. Ruby rod 2. EDM (a) Both A and R are individually true and R is the
cemented d carbide
bid tools
l C. Electrolyte 3. USM correct explanation of A
D. ECM 4. Shaping of cemented carbide dies and D. Abrasive slurry 4. LBM (b) Both A and R are individually true but R is not the
punches
Codes:A B C D A B C D correct explanation of A
Codes:A B C D A B C D
(a) 4 1 2 3 (b) 3 2 1 4 (a) 4 2 1 3 (b) 4 2 3 1 (c) A is true but R is false
(c) 4 2 1 3 (d) 3 1 2 4 (c) 2 4 3 1 (d) 2 4 1 3 (d) A is false but R is true

IAS 2002
IAS IAS 1999
IAS IES 2004
IES
Which one of the following pairs is NOT correctly Match List I (Unconventional machining process) with (
Match List I (Machining g pprocesses)) with List II
matched? List II (Typical application) and select the correct (Operating media) and select the correct answer using
answer using g the codes g
given below the lists: the codes given below the Lists:
(Unconventional (Application) List I List II
List I List II
machining method) A. Abrasive jet machining 1. Dielectric
A Electro discharge machining 1.
A. 1 Drilling micro holes in
(a) Electric discharge : Machining of electrically very hard metals B. Electron beam machining 2. Electrolyte
conductive materials C. Electrochemical machining 3. Abrasive slurry
B Electro chemical machining 2.
B. 2 Drilling holes in glass
(b) Laser beam : Micromachining D. Electrodischarge machining 4. Vacuum
C. Ultrasonic machining 3. Die sinking
(c) Plasma arc : Faster cutting of hard materials 5. Air
D Laser beam machining 4.
D. 4 Machining contours Codes:A B C D A B C D
(d) Electron beam : Faster metal removal rate Codes:A B C D A B C D (a) 5 4 2 1 (b) 4 5 2 1
( ) 4
(a) 2 3 1 ( ) 3
(b) 4 1 2 (c) 4 2 3 5 (d) 2 5 3 4
For-2015 (IES, GATE & PSUs) Page 168 of 240 Rev.0
(c) 4 3 2 1 (d) 3 4 2 1
IES 1999
IES GATE 2004
GATE
Match ListI with ListII and select the correct answer yp
Typical machining g operations
p are to be pperformed on hard
using the codes given below the Lists: tomachine materials by using the processes listed below.
Choose the best set of OperationProcess combinations
ListI ListII
O
Operation
ti P
Process
A. Die sinking 1. Abrasive jet machining
P. Debarring (internal surface) 1. Plasma Arc Machining
B. Debarring g 2. Laser beam machining g
Q Die sinking
Q. 2
2. Abrasive Flow Machining
C. Fine hole drilling (thin materials) 3. EDM R. Fine hole drilling in thin sheets 3. Electric Discharge
D. Cutting/sharpening
g p g hard materials Machining g
4. Ultrasonic machining S. Tool sharpening 4. Ultrasonic Machining
55. Electrochemical g
grindingg 5. Laser beam Machiningg
Code:A B C D A B C D 6. Electrochemical Grinding
((a)) 3 5 4 1 ((b)) 2 4 1 3 (a) P1 Q5 R3 S4 (b) P1 Q4 R1 S2
(c) 3 1 2 5 (d) 4 5 1 3 (c) P5 Q1 R2 S6 (d) P2 Q3 R5 S6

For-2015 (IES, GATE & PSUs) Page 169 of 240 Rev.0


C t l St t f t i l
CrystalStructureofmaterials GATE 2011
GATE2011
y FCC: Ni,Cu,Ag,Pt,Au,Pb,Al(soft) Thecrystalstructureofausteniteis
y BCC: V,Mo,Ta,W(hardmaterial) (a)bodycenteredcubic
y HCP: Mg,Zn
g (b)facecenteredcubic
y CobaltHCP<4200C,FCC>4200C (c)hexagonalclosedpacked
y ChromiumHCP<20oC,BCC>20
, oC ( )
(d)bodycenteredtetragonal
y g
y Glass Amorphous
y BCC Ferriteor iron
BCCFerriteor & ferriteor iron
ironferriteoriron

y FCC Austeniteoriron

IES 2011
IES2011
Match List I with List II and select the correct answer using IES2003 IES 1998
IES1998
the code given below the lists : MatchListIwithListIIandselectthecorrectanswer
MatchList I(CrystalStructure)withList II(Example)and
MatchListI(CrystalStructure)withListII(Example)and
ListI ListII selectthecorrectanswerusingthecodesgivenbelowthe usingthecodesgivenbelowthelists:
h d b l h l
Lists: ListI ListII
A.Alphairon
p 1.FCC ListII
List ListII
List II (Material) (Structure)
B.Zinc 2.BCC (CrystalStructure) (Example)
A. Charcoal 1. F.C.C
A. SimpleCubic 1.Zinc
C Glass
C.Glass 3 HCP
3.HCP B
B. B d
BodycenteredCubic
t dC bi 2.Copper
C B. Graphite 2. H.C.P
C. FacecenteredCubic 3.Alphaironatroom C. Chromium 3. Amorphous
D.Copper 4.Amorphous temperature D. Copper 4. B.C.C
D HexagonalClosePacked
D. H lCl P k d 4.Manganese
M
Codes Code:A B C D A B C D
Codes:A B C D A B C D
A B C D A B C D ((a)
) 4 3 1 2 ((b)
) 4 3 2 1 (a) 3 2 1 4 (b) 3 2 4 1
(a) 1 4 3 2 (b) 2 4 3 1 (c) 3 4 2 1 (d) 3 4 1 2 ( ) 2
(c) 3 4 1 ( ) 2
(d) 3 1 4
(c) 1 3 4 2 (d) 2 3 4 1

IES2001 IES2006 Pl ti d f ti
Plasticdeformation
Following the elastic deformation, material undergoes
MatchListI(NameoftheElement)withListII MatchListI(Element)withListII(CrystalStructure)
(CrystalStructure)andselectthecorrectanswerusing andselectthecorrectanswerusingthecodegiven plastic deformation.
thecodesgivenbelowthelists: belowtheLists: y Also characterized by relation between stress and
ListI ListII List I
List List II
List strain at constant strain rate and
d temperature.
A. Fluorspar 1.Bodycenteredcubic A. AlphaIron 1.Hexagonalclosedpacked
B. AlphaIron
p 2.Hexagonalclosedpacked
g p pp
B. Copper 2.Bodycentredcubic
y y Microscopically, it involves breaking atomic bonds,
C. Silver 3.Simplecubic C. Zinc 3.Amorphous moving
i atoms, then
h restoration i off bonds.
b d
D. Zinc 4.Facecenteredcubic D. Glass 4.Facecentredcubic y StressStrain relation here is complex because of
Codes A
Codes:A B C D A B C D Codes A
Codes:A B C D A B C D atomic
t i plane l movement, t dislocation
di l ti movement,
t and d
(a) 3 2 4 1 (b) 4 1 3 2 (a) 2 3 1 4 (b) 1 4 2 3 the obstacles they encounter.
((c)
) 44 2 33 1 ((d)
) 33 1 4
4 2 ((c)
) 2 4
4 1 33 ((d)
) 1 33 2 4
y Crystalline solids deform by processes slip and
twinning in particular directions.
For-2015 (IES, GATE & PSUs) Page 170 of 240 Rev.0 Contd
y Amorphous solids deform by viscous flow mechanism y A true stressstrain curve is called flow curve as it gives
Slip
y Slip is the prominent mechanism of plastic deformation in
without any directionality. the stress required to cause the material to flow
metals.
y Because of the complexity involved, theory of plasticity plastically
l i ll to certaini strain.
i
y It involves sliding of blocks of crystal over one other along
neglects the following effects: y Because of the complexity involved, there have been definite crystallographic planes, called slip planes.
many stressstrain relations proposed.
proposed y In physical words it is analogous to a deck of cards when it
y Anelastic strain, which is time dependent
recoverable strain. is pushed from one end.
= fn( ,
, T,
T microstructure) y Slip occurs when shear stress applied exceeds a critical
y Hysteresis behavior resulting from loading and
value.
unloading of material. = K n Strain hardening exponent, n = 0.1 - 0.5
.m
y During slip each atom usually moves same integral
y Bauschinger
B hi effect
ff dependence
d d off yield
i ld stress on = K Strain - rate sensitivity,
sensitivity m = 0
0.4
4-0
0.9
9 number
b off atomic distances
d along
l the
h slip
l plane
l producing
d
loading path and direction. = K( 0 + )n Strain from previous work - 0 a step, but the orientation of the crystal remains the same.
y Equations
E ti relating
l ti stress
t and
d strain
t i are called ll d = 0 + K n Yield strength - 0 y Steps observable under microscope as straight lines are
called slip lines.
constitutive equations.
Contd

Twinning y The important role of twinning in plastic deformation is IES2007


y The second important mechanism of plastic deformation
is twinning. that it causes changes in plane orientation so that further
slip can occur. Whatisthemovementofblockofatomsalong
Wh ti th t fbl k f t l
y It results when a portion of crystal takes up an orientation certaincrystallographicplanesanddirections,
that is related to the orientation of the rest of the untwined y Twinning generally occurs when slip is restricted, because
l tti in
lattice i a definite,
d fi it symmetrical
t i l way. the stress necessary for twinning is usually higher than that termedas?
y The twinned portion of the crystal is a mirror image of the for slip. (a) Glide
parent crystal.
p y The pplane of symmetry
y y is called twinning g y Thus some HCP metals with limited number of slip
Thus, (b) Twinning
plane. systems may preferably twin.
(c) Slip
y Each atom in the twinned region moves by a homogeneous y Also, BCC metals twin at low temperatures
p because slipp is
shear
h a distance
di t proportional
ti l to
t its
it distance
di t f
from th twin
the t i (d) Jog
difficult.
plane.
y The lattice strains involved in twinning g are small,, usuallyy y Of course, twinning and slip may occur sequentially or
in order of fraction of interatomic distance, thus resulting even concurrentlyl in
i some cases.
in very small gross plastic deformation.
Contd

IES2005 IES1998 At i St t
AtomicStructure
y Atoms consist of a relatively dense nucleus composed of
TheB.C.C.andH.C.P.metalsundergoplastic
Th B C C dH C P t l d l ti Assertion(A):Plasticdeformationinmetalsand positively charged protons and neutral particles of nearly
alloysisapermanentdeformationunderload.This identical mass, known as neutrons.
deformationby: propertyisusefulinobtainingproductsbycold y Surrounding the nucleus are the negatively charged
(a) Slip rolling.
rolling electrons which have only 1/1839 times the mass of a
electrons,
Reason(R):Plasticorpermanentdeformationin neutron and appear in numbers equal to the protons, to
(b) Twinning metaloralloyiscausedbymovementordislocations. maintain a net charge balance.
( ) Edgedislocation
(c) Ed di l ti ( ) BothAandRareindividuallytrueandRisthecorrect
(a) B thA dR i di id ll t dRi th t y The
Th light
li h electrons
l that
h surround d the
h nucleus
l play
l a far
f
explanationofA more significant role in determining material properties.
(d) Twinningincombinationwithslip
(b) BothAandRareindividuallytruebutRisnotthe y Again,
g experiments
p reveal that the electrons are arranged
g
correctexplanationofA
l f in a characteristic structure consisting of shells and
(c) AistruebutRisfalse subshells, each possessing a distinctive energy. Upon
(d) AisfalsebutRistrue absorbing a small amount of energy, an electron can jump
to a higherenergy
hi h shell
h ll farther
f h fromf the
h nucleus.
l

For-2015 (IES, GATE & PSUs) Page 171 of 240 Rev.0 Contd
y The reverse jump can also occur with the concurrent At i B d
AtomicBonds y A third type of primary bond can form when a complete outer
release of a distinct amount, or quantum, of energy. y General characteristics of materials joined by ionic bonds shell cannot be formed by either electron transfer or electron
include moderate to high strength,
strength high hardness,
hardness brittleness,
brittleness sharing.
sharing This bond is known as the metallic bond.
bond
y The number of electrons surrounding the nucleus of a high melting point, and low electrical conductivity.
y If there are only a few valence electrons (one, two, or three) in
neutral atom is called the atomic number. y A second type of primary bond is the covalent type.
each of the atoms in an aggregate, these electrons can easily be
y More
M i
important, h
however, are those
h electrons
l i the
in h y Like the ionic bond,
bond the covalent bond tends to produce
materials with high strength and high melting point. removed while the remainder are held firmly to the nucleus.
outermost shell or subshell, known as valence y Atom movement within the framework material (plastic y These highlymobile,"free" electrons account for the high
electrons.
electrons deformation) requires the breaking of discrete bonds,
bonds thereby electrical and thermal conductivity values as well as the opaque
making the material characteristically brittle. property (free electrons can absorb the discrete energies of light
y These are influential in determining chemical y Electrical conductivity depends on bond strength, ranging from radiation) observed in metals.
properties electrical conductivity,
properties, conductivity some mechanical conductive tin (weak covalent bonding)
bonding), through
semiconducting silicon and germanium, to insulating diamond y Moreover, they provide the "cement" required for the positive
properties, the nature of interatomic bonding, atom (carbon). negativepositive attractions that result in bonding.
size, and optical
p characteristics. y Engineering materials possessing ionic or covalent bonds tend y Bond strength,
strength and therefore material strength,
strength varies over a
to be ceramic (refractories or abrasives) or polymeric in nature.
wide range.
Contd Contd

y More significant, however, is the observation that the IES2008 IES2003


p
positive ions can move within the structure without Assertion(A):Elementsareclassifiedintometalsand Assertion(A):Unlikeinthecaseofionicbonds,the
Assertion(A):Unlikeinthecaseofionicbonds the
the breaking of discrete bonds. Materials bonded by nonmetalsonthebasisoftheiratomicweights. coordinationnumbersforcovalentlybondedatoms
metallic bonds can therefore be deformed by atom Reason(R):Thevalenceelectronstructures arenotcontrolledbytheradiiratio.
movement mechanisms and produce a deformed contributetotheprimarybondingbetweentheatoms Reason(R):Acovalentbondhasaspecificdirectionof
material that is every bit as strong as the original. toformaggregates. bondinginspace.
y This
h phenomenon
h is the
h basis
b off metall plasticity,
l (a) BothAandRaretrueandRisthecorrectexplanation (a) BothAandRareindividuallytrueandRisthecorrect
ofA explanationofA
ductility, and many of the shaping processes used in
(b) BothAandRaretruebutRisNOTthecorrect (b) BothAandRareindividuallytruebutRisnot the
the fabrication of metal products.
products explanationofA correctexplanationofA
(c) AistruebutRisfalse (c) AistruebutRisfalse
(d) AisfalsebutRistrue
Ai f l b tRi t (d) AisfalsebutRistrue
Ai f l b tRi t

IES 2011
IES2011 D l f i
Developmentofagrainstructure y The small, continuous volumes of solid are known as
Solid material chemical bonds are : y When a metal solidifies, a small particle of solid forms cristals or grains, and the surfaces that divide them
from
f the
th liquid
li id with
ith a lattice
l tti structure
t t characteristic
h t i ti off the
th (i.e.,
(i the
th surfaces
f off crystalline
t lli discontinuity)
di ti it ) are
(a) Ionic, molecular and fusion given material. known as grain boundaries.
(b) Covalent, fusion and fission y This p particle then acts like a seed or nucleus and g grows as
y The process by which a grain structure is produced
(c) Ionic, covalent and molecular other atoms in the vicinity attach themselves. The basic
crystalline unit is repeated throughout space. Upon solidification is one of nucleation and growth.
((d)) Fission,, molecular and ionic y Grains are the smallest of the structural units in a
y In actual solidification,
solidification many nuclei form independently at
various locations throughout the liquid and have random metal that are observable with ordinary light
orientations with respect to one another. Each then grows microscopy.
py
untill it begins
b to interfere
f with
h its neighbours.
hb
y The atoms in the grain boundaries are more loosely
y Since adjacent lattice structures have different alignments
or orientations,
orientations growth cannot produce a single continuous bonded and tend to react with the chemical more
structure. readily than those that are part of the grain interior.
For-2015 (IES, GATE & PSUs) Page 172 of 240 Contd Rev.0 Contd
y The
Th number
b and
d size
i off the
h grains
i ini a metall vary with
i h the
h Fracture of metals
Fractureofmetals
rate of nucleation and the rate of growth. IES2002 y If the plastic deformation of a metal is extended too far, the
y The ggreater the nucleation rate,, the smaller the resulting g metal mayy ultimatelyy fracture.
grains. Conversely, the greater the rate of growth, the larger Chemicalsattackatomswithingrainboundaries
Ch i l tt k t ithi i b d i y These types of fractures are known as ductile fractures,
the grain. preferentiallybecausetheyhave noting that the initial response to the applied load was one
y Because the resulting grain structure will influence certain (a) Lowerenergythanthoseinthegrains of p
plastic deformation.
mechanical and physical properties, it is an important y Another possibility, however, is where fracture precedes
property for an engineer to both control and specify. One (b) Higherenergythanthoseinthegrains plastic deformation, occuring in a sudden, catastrophic
means of specification
p is through
g the ASTM ((American manner and propagating rapidly through the material.
manner, material
Society for Testing and Materials) grain size number, ( ) Highernumberofatomsthaninthegrains
(c) Hi h b f t th i th i
These fractures, known as, brittle fractures, are most
defined as: (d) Lowernumberofatomsthaninthegrains common with metals having the bcc or hcp crystal
structures.
where N is the number of grains per square inch y Whether the fracture is ductile or brittle, however, often
visible in a prepared specimen at lOOX and n is the ASTM depends on the specific conditions of material,
grainsize number.
number Low ASTM numbers mean a few temperature state of stress,
temperature,state stress and rate of loading.
loading
massive grains;high numbers refer to materials with many y Fracture strength depends only on the basic crystal
small grains. structure .

GATE2010 IES1992 Cold working recrystallization and


Coldworking,recrystallization and
hotworking
Thematerialpropertywhichdependsonlyonthe
Th t i l t hi hd d l th Whichofthefollowingstatementistrueabout
Whi h fth f ll i t t ti t b t
basiccrystalstructureis brittlefracture? y Duringdeformation,aportionofthedeformationenergy
becomesstoredwithinthematerialintheformofadditional
(a) Fatiguestrength (b) Workhardening (a) Hightemperatureandlowstrainratesfavour dislocationsandincreasedgrainboundarysurfacearea.Ifa
brittlefracture deformedpolycrystallinemetalissubsequentlyheatedtoa
(c) Fracturestrength (d) Elasticconstant (b) ManymetalwithHCPcrystalstructurecommonly high enoughtemperature,thematerialwillseektolowerits
highenoughtemperature,thematerialwillseektolowerits
showbrittlefracture energy.New,equiaxed (sphericalshaped)crystalswillnucleate
andgrowoutoftheoriginalstructure.Thisprocessofreducing
(c) Brittlefractureisalwaysprecededbynoise theinternalenergythroughtheformationofnewcrystalsis
(d) Cupandconeformationischaracteristicforbrittle knownasrecrysrallization.
materials y The temperatureatwhichrecrystallization
p y takesplaceis
p
differentforeachmetalandalsovarieswiththeamountofprior
deformation.
Contd

y The greater the amount of prior deformation, the more y When metals are plastically deformed below their y Ifmetalsaredeformedattemperaturessufficiently
g and the lower the recrystallization
stored energy, recrystallization temperature, the process is called abovetherecrystallization,theprocessisknownas
cold working.
working hotworking.
temperature. However, there is a lower limit below
y The metal strain hardens and the structure consists of
which recrystallization will not take place in a y Deformationandrecrystallization cantakeplace
distorted grains. If the deformation is continued, the
reasonable
bl amount off time.
i simultaneously,and
i l l d largedeformationsarepossible.
l d f i ibl
metal may fracture. Therefore, we find it common
y This temperature can often be estimated by taking 0.4 practice to recrystallize material after certain amounts y Sincearecrystallized grainstructureisconstantly
ti
times th melting
the lti point
i t off the
th metal
t l when
h the
th melting
lti off cold
ld work.
k f
forming,thefinalproductwillnotexhibitstrain
i th fi l d t ill t hibit t i
point is expressed in an absolute temperature scale. y Ductility is restored, and the material is ready for hardening.
y This is also the temperature at which atomic diffusion further deformation.
deformation
(atom movement within the solid) becomes y The heating process is known as a recrystallization
significant, indicating that diffusion is an important anneal and enables deformation to be carried out to
mechanism in recrystallization. great lengths without the danger of fracture.
For-2015 (IES, GATE & PSUs) Contd Page 173 of 240 Contd Rev.0 Contd
Plastic deformation in
Plasticdeformationin
y Slip in polycrystalline material involves generation,
polycrystallinemetals g
movement and (re)arrangement of dislocations.
y Gross plastic deformation of a polycrystalline specimen y The second important mechanism of plastic
corresponds to the comparable distortion of the individual deformation is twinning. It results when a portion of
grains by means of slip.
slip Although some grains may be oriented
Fig.Recrystallization
favourably for slip, yielding cannot occur unless the
crystal takes up an orientation that is related to the
of7030brass: orientation of the rest of the untwined lattice in a
(a)coldworked33%;
33 unfavourably oriented neighbouring grains can also slip.
(b)heatedat580C y Thus in a polycrystalline aggregate, individual grains provide a d fi it symmetrical
definite, t i l way.
(1075F)for3seconds, mutual geometrical constraint on one other, and this precludes y The twinned portion of the crystal is a mirror image of
(c)4seconds,and
( )
(d)8seconds
plastic deformation at low applied stresses.
stresses the parent crystal.
crystal The plane of symmetry is called
y That is to initiate plastic deformation, polycrystalline metals twinning plane.
require higher stresses than for equivalent single crystals, where
stress depends on orientation of the crystal.
y Much of this increase is attributed to geometrical reasons.
Contd

Crystalline material and Crystal


CrystallinematerialandCrystal C lS
CrystalStructures
Structures y All solid materials are made of atoms/molecules,
/ ,
which are arranged in specific order in some materials,
Stable crystal structure satisfies called crystalline solids. Otherwise noncrystalline or
amorphous solids.
solids
y The crystals are electrically neutral.
y Groups of atoms/molecules specifically arranged
y The
Th ionion
i i repulsion
l i isi minimized.
i i i d crystal.
y Lattice is used to represent a threedimensional
y The ions or atoms in crystals
y are p
packed as closelyy as periodic array of points coinciding with atom
positions.
possible under the constrains of specific bonding. y Unit cell is smallest repeatable entity that can be used
y The free energy of the system becomes minimum
to completely represent a crystal structure.
structure It is the
building block of crystal structure

U i ll
Unitcell Mostcommonunitcells Facecenteredcubic,
Common Crystal Structures
CommonCrystalStructures
Itischaracterizedby: g
BodycenteredcubicandHexagonal. Unit Cell N CN a/R APF
y Typeofatomandtheirradii,R Simple 1 6 2 0.52
y Celldimensions(Latticespacinga,bandc)intermsof
Celldimensions(Latticespacinga bandc)intermsof Cubic
Randanglebetweentheaxis Body- 2 8 4/3 0.68
Centered
yaa*,b*,c*
,b ,c latticedistancesinreciprocallattice,
latticedistancesinreciprocallattice,*,*,
, , C bi
Cubic
* anglesinreciprocallattice Face- 4 12 4/2 0.74
y Numberofatomsperunitcell,n
p , Centered
y Coordinationnumber(CN) closestneighborstoan Cubic
atom Hexagonal
g 6 12 0.74
y Atomicpackingfactor,APF Close
For-2015 (IES, GATE & PSUs) Contd
Page 174 of 240 Packed Rev.0
C t l St t f t i l
CrystalStructureofmaterials
y FCC: Ni,Cu,Ag,Pt,Au,Pb,Al(soft) IAS2009main
y BCC: V,Mo,Ta,W(hardmaterial)
y HCP: Mg,Zn
g
y CobaltHCP<4200C,FCC>4200C
y ChromiumHCP<20oC,BCC>20
, oC

y Glass Amorphous
y BCC Ferriteor iron
BCCFerriteor & ferriteor iron
ironferriteoriron

y FCC Austeniteoriron

Fig.DifferentUnitCell

IES 2010
IES2010
Assertion(A):Mostofthematerialsexistinsingle
IES2008 IES2003
crystal.
crystal In
I the
th atomic
t i hardsphere
h d h model
d l off the
th crystal
t l The
Th coordination
di ti number
b for
f FCC crystal
t l
Reason(R):Sugarisasinglecrystalmaterial. structure of Copper, what is the edge length of unit structure is
( ) Both
(a) B th A and d R are individually
i di id ll true
t and
d R is
i the
th cell? (a) 4
correct explanation of A (b) 8
(b) Both A and R are individually true but R is NOT the ( ) 12
(c)
correct explanation of A (d) 16
(c) A is true but R is false
(d) A is false but R is true

GATE2009 IES2004 IES2000


The
Th effective
ff ti numberb off lattice
l tti points
i t in
i the
th unit
it Assuming
A i atoms
t to
t be
b perfect
f t spheres,
h what
h t is
i the
th Atomicpackingfactor(APF)inthecaseofcopper
At i ki f t (APF)i th f
cell of simple cubic, body centered cubic, and face value of the highest possible atomic packing crystalis
cantered cubic space lattices, respectively, are factor (APF) in metals? (a) 0.52
0 52
(a) 1, 2, 2 (a) 0.95 (b) 0.68
(b) 1,
1 2,
2 4 (b) 0.74
0 74 ( ) 0.74
(c)
(c) 2, 3, 4 (c) 0.66 (d) 1.633
(d) 2,
2 4,
4 4 (d) 0.5
05

For-2015 (IES, GATE & PSUs) Page 175 of 240 Rev.0


IES1999 IES2007 IES2005
MatchList I(Crystalstructure)withList II(Atomic
MatchListI(Crystalstructure)withListII(Atomic Which one of the following is the correct ascending Consider the following statements about FCC and
packingfactor)andselectthecorrectanswerusingthe
codesgivenbelowtheLists: order of packing density for the given crystal HCP crystal structure:
ListII
List ListII
List II structures of metals? 1. Both have same coordination number and atomic
A. Simplecubic 1. 74% (a) Simple cubic Face centred cubic Body centred packing fraction.
B. Bodycenteredcubic 2. 74% cubic 2. Both represent closely packed crystal structures.
C Facecenteredcubic
C. F t d bi 3. 52%
%
D. Hexagonalclosepacked 4. 68%
(b) Body centred cubic Simple cubic Face centred cubic 3. Both structures are generated by stacking of close
Codes: (c) Simple cubic Body centred cubic Face centred cubic packed plants on top of one another, but only the
A B C D A B C D (d) Body centred cubic Face centred cubic Simple cubic
stacking sequence is different.
different
(a) 3 4 2 1 (b) 4 3 2 1 Which of the statements given above are correct?
(c) 3 4 1 2 (d) 4 3 1 2 (a) 1 and 2 (b) 2 and 3
(c) 1, 2 and 3 (d) 1 and 3

F l f l i
Formulaforalatticeconstant IES2004 B i L i d i ll
BravisLatticeandunitcell

AmetalhasFCCstructure.Supposeitsatomic
A t lh FCC t t S it t i y Totalsixlatticeparameters a,b, c alongthethree
1 crystalaxes,and , , three,crystalangles.
nM 3 weightandatomicradiusisAandrrespectively.
a=
LetNdenotesAvogadro snumber.Whatisthe
LetNdenotesAvogadro'snumber.Whatisthe c>

N
densityofthematerial?
>

A A
b
(a) (b)
2 2r3 N 4 2r3 N
[Wheren=noofatomspercell,M=Atomicweight,
[Wheren noofatomspercell M Atomicweight a>
A A
N=Avogadrosnumber, =DensityofMetal] (c)
8 2r3 N
(d)
16 2r 3 N
y Therearesevenlatticesystems

Note: Total7latticesystembuttotal14Bravice lattice

1 C bi
1.Cubic 2 T l
2.Tetragonal IES2001
y a b c
a=b=c y a b c
a=b Whichoneofthefollowingpairsofaxislengths(a,b,
Whi h fth f ll i i f i l th ( b
y . = = = 90 y = = c)andinteraxialangles(,,)representsthe
1 SimpleCubic(SC)=1atom
1. tetragonalcrystalsystem?
c
1.Simpletetragonal(ST)
a (a) a = b = c; = = = 900
a
2. Bodycenteredcubic(BCC)=2atom (b) a = b c; = = = 900
a b c; = = = 900
(c)
2.Bodycenteredtetragonal(BCT) c (d) a = b = c; = = 900

3. Facecenteredcubic(FCC)=4atom
F t d bi (FCC) t a
a
For-2015 (IES, GATE & PSUs) Page 176 of 240 Rev.0
IES2006 3 O h h bi
3.Orthorhombic 4 Rh b h d l
4.Rhombohedral
In
I Zinc
Zi Blende
Bl d structure,
t t each
h atom
t is
i surrounded
d d y abc y a b c
a=b=c
by four atoms of the opposite kind which are y = = =900 y = = 90o
located at the corners of which one of the
following? 1.Simpleorthorhombic(SO) c (i)SimpleRhombohedral (Sr)
a
(a) Tetrahedron b

(b) Hexahedron 2.Bodycenteredorthorhombic(BCO)


(c) Cube 3
3.Facecenteredorthorhombic(FCO)
( )
(d) Orthorhombic
4.Endcenteredorthorhombic(ECO)

IES2007 5 H l
5.Hexagonal 6 M li i
6.Monoclinic
ForaRhombohedral
F Rh b h d l spacelattice,whichoneofthe
l tti hi h fth y a bc
a=bc y abc
followingiscorrect? y = =900 y = =900
y =1200
1. SimpleMonoclinic(Sm)
()
(i)SimpleHexagonal(Sh)
p g ( ) a

c
2. Endcenteredmonoclinic(ECM)

b a

7 T i li i
7.Triclinic IES 2011
IES2011 IES2006
y abc Inatriclinicunitcell:
Whichoneofthefollowingpairsisnotcorrectly
Whi h fth f ll i i i t tl
y (a ) = = = 90o (b) = = 90o , = 120o matched?
(c) = = 90o (d ) 90o SpaceLatticeRelationbetweenAtomicradiusr and
1.SimpleTriclinic(Stri) Edgeelementa
(a) Simplecubicstructure: a2 =4r2
(b) Bodycentred cubicstructure:3a2 =16r2
(c) Triclinic: 2a2 =3r
3r2
c
(d) Facecentred cubicstructure: a =8r2
2

b
a

For-2015 (IES, GATE & PSUs) Page 177 of 240 Rev.0


Mill i di
Millerindices Mill i di
Millerindices Di i
Direction Mill i di
Millerindices Pl
Plane
y A syste
system o otat o iss required
of notation equ ed to identify
de t y pa t cu a
particular y A vector of convenient length is placed parallel to the y Determine the intercepts of the plane along the
direction(s) or plane(s) to characterize the arrangement of required direction crystallographic axes, in terms of unit cell dimensions.
atoms in a unit cell If plane is passing through origin, there is a need to
y The length
g of the vector p projection
j on each of three
y Formulas involving Miller indices are very similar to related axes are measured in terms of unit cell dimensions construct a plane parallel to original plane
formulas from analytical geometry simple to use y Take the reciprocals of these intercept numbers
y These three numbers are made to smallest integer g
y Use
U off reciprocals
i l avoids
id the
th complication
li ti off infinite
i fi it
values, known as indices, by multiplying or dividing by y Clear fractions
intercepts
a common factor y Reduce to set of smallest integers
y Specifying dimensions in unit cell terms means that the
same label can be applied to any plane with a similar y The three indices are enclosed in square brackets, y The three indices are enclosed in parenthesis, (hkl).
stacking pattern, regardless of the crystal class of the [uvw] y A familyy of p
planes is represented
p byy {{hkl}}
crystal. Plane (111) always steps the same way regardless of y A family of directions is represented by <uvw>
crystal system. Contd

Millerindices UsefulConventions y Multiplying or dividing a Miller index by constant has


y If a plane is parallel to an axis, its intercept is at infinity no effect on the orientation of the plane
and its Miller index will be zero y When the integers used in the Miller indices contain
y Never alter negative
g numbers. This implies
p symmetry
y y more than one digit, the indices must be separated by
that the crystal may not have! Use bar over the number commas. E.g.: (3,10,13)
to represent negative numbers. y What is p planer density: y The number of lattice p
point
y A plane or direction of family is not necessarily parallel per unit area is defied as planer density.
to other planes or directions in the same family
y The smaller the Miller index, more nearly parallel the
plane to that axis, and vice versa

Contd Contd

( )
MillerIndices(hkl) Example: Find the miller indices of a plane that
makes intercepts in the units of lattice parameters IAS2009Main
StepI:Findtheinterceptsofaplanealongthecrystalaxesa,
Step I:Findtheinterceptsofaplanealongthecrystalaxesa of 1 and 2 on a and b respectively.
respectively The plane is
b,candexpresstheinterceptsinunitsofcrystalparameter parallel to c axis.
a,b,crespectively. Solution:
StepII:Findthereciprocaloftheintercepts.
StepIII:Reduce thereciprocalstothethreesmallestinteger a b c
(h k l)keepingtheratiossame
(h,k,l)keepingtheratiossame.
Intercepts 1 2
StepIV:Enclosetheseintegerintosameparameters(h,k,l)
Take reciprocals 1 0
b Reduce to reciprocals 2 1 0

b Hence millers Indices are (210)


a
For-2015 (IES, GATE & PSUs) Page 178 of 240 Rev.0
IES 2010
IES2010 IES2006 IES1999
Whatistheplanardensityof(100)planeinFCC(face
Whatistheplanardensityof(100)planeinFCC(face ThesetofMillerindicesoftheplaneshowninthe
Th t fMill i di fth l h i th
Miller indices (x, y,
centred cubic)crystalwithunitcellsideaequalto? givenfigureis
z) for the hatched
plane in the above
abo e (a) 1.484 (a) (00)
1 (b) (100)
a2
unit cell are 2 (c) (101) (d) (110)
represented as (b)
a2
(a) (100)
1
(b) (110) ((c)
)
a2
(c) (111) 2
(d) (101) ((d)
)
a2

Useful Conventions for a cubic


UsefulConventionsforacubic I Pl di b f il f l {hkl}
InterPlanardistancebetweenfamilyofplanes{hkl}
IES1998
crystal a
Aunitcellofacrystalisshowninthegivenfigure.
A it ll f t li h i th i fi
TheMillerindicesofthedirection(arrow)shown

y [uvw] is normal to (hkl) if u = h, v = k, w = l. d( hkl ) =
inthefigureis E.g.:(111) [111] h2 + k 2 + l 2
(a) [012] (b) [021] y [uvw] is parallel to (hkl) if hu + kv + lw = 0
(c) [210] (d) [201] y Two planes (h1k1l1) and (h2k2l2) are normal if Anglesbetweentwoplanesisgivenby
h1h2+k1k2+l1l2 = 0
y Two directions (u1v1w1) and (u2v2w2) are normal h1h2 + k1 k2 + l1l2
u1u2+v1v2+w1w2 = 0 cos =
h12 + k12 + l12 h22 + k22 + l22

Contd

P i d f
Pointdefects y It is clear from the equation that there is an
CrystalDefects y Pointdefectsareofzerodimensionali.e.atomicdisorderis exponential increase in number of vacancies with
y The assumption of perfectly arranged atoms in a restrictedtopointlikeregions. temperature. When the density of vacancies becomes
solid may not valid i.e. atomic order must have y Thermodynamicallystablecomparedwithotherkindof relatively large, there is a possibility for them to cluster
defects. together and form voids.
voids
b
been di
disturbed.
b d
y Disordered atomic region is called defect or y In ionic crystals, defects can form on the condition
i
imperfection.
f ti of charge neutrality.
neutrality Two possibilities are:
y Based on geometry, defects are: Point defects n Q
y Fractionofvacancysitescanbegivenasfollows:
act o o vaca cy s tes ca be g ve as o ows: = e kT
(zero D) Line defects (1D)
(zeroD), (1 D) or Dislocations,
Dislocations N
Interfacial defects (2D) and Bulk or Volume [WherenisthenumberofvacantsitesinNlatticepositions,k
defects (3
(3D).
D). isgasorBoltzmannsconstant
isgasorBoltzmann sconstant,Tisabsolutetemperaturein
Tisabsolutetemperaturein
kelvin,andQistheenergyrequiredtomoveanatomfromthe
interiorofacrystaltoitssurface.]
For-2015 (IES, GATE & PSUs) Page 179 of 240 Contd
Rev.0
IES1998;1999 IES1992 IES2009
Assertion(A):Carbonformsinterstitialsolid Whichofthefollowingisapointimperfection?
Whi h fth f ll i i i ti f ti ? Whichoneofthefollowingdefectsis
Whi h Schottky
fth f ll i d f t i 'S h ttk
solutionwhenaddedtoiron. 1.Vacancy 2.Interstitialcy defect?
Reason(R):Theatomicradiusofcarbonatomis (a) Vacancydefect
muchsmallerthanthatofiron. 3.Frenkelimperfection
F k li f i 4.Schottkyimperfection
S h k i f i
(b) Compositionaldefect
(a) BothAandRareindividuallytrueandRisthe
correctexplanationofA ( ) 1and2only
(a) ( )
(b) 2and3only ( ) Interstitialdefects
(c) I t titi ld f t
(b) BothAandRareindividuallytruebutRisnot the (d) Surfacedefect
correctexplanationofA ( ) 2,3and4only
(c) d l (d) 1,2,3and4
d
(c) AistruebutRisfalse
(d) AisfalsebutRistrue

Li d f
Linedefects B
Burgersvector Li d f
Linedefects Ed di l i
Edgedislocation
y Line defects or Dislocations are abrupt
p change
g in atomic y A dislocation is characterized by Burger
Burgerss vector, b. y ItisalsocalledasTaylor Orowan dislocation.
ItisalsocalledasTaylorOrowan
order along a line.
y It is unique to a dislocation, and usually have the y Itwillhaveregionsofcompressiveandtensilestresses
y They occur if an incomplete plane inserted between
perfect planes of atoms or when vacancies are aligned in a direction of close p pack lattice direction. It is also the oneithersideoftheplanecontainingdislocation.
p g
line. slip direction of a dislocation.
y A dislocation is the defect responsible p for the y It represents
p the magnitude
g and direction of distortion
phenomenon of slip, by which most metals deform associated with that particular dislocation.
plastically.
y Two limiting cases of dislocations, edge and screw,
y Dislocations occur in high densities (10810
1010 m22),
) and are
intimately connected to almost all mechanical properties are characterized by Burgers vector perpendicular to
which are in fact structuresensitive. the dislocation line (t) and Burgers vector parallel to
y Dislocation form during plastic deformation, solidification th dislocation
the di l ti line li respectively.
ti l Ordinary
O di di l ti
dislocation
or due to thermal stresses arising from rapid cooling. is of mixed character of edge and screw type. Contd

y A pure edge dislocation can glide or slip in a direction


perpendicular to its length i.e. along its Burgers vector in
the slip plane (made of b and t vectors),
vectors) on which
dislocation moves by slip while conserving number of
atoms in the incomplete plane.
y It may move vertically by a process known as climb, if
diffusion of atoms or vacancies can take place at
appropriate
i rate.
y Atoms are added to the incomplete plane for negative
climb i.e.
i e the incomplete plane increases in extent
downwards, and vice versa.
y Thus climb motion is considered as nonconservative,, the
movement by climb is controlled by diffusion process.
For-2015 (IES, GATE & PSUs) Contd
Page 180 of 240 Rev.0 Contd
IES2009 Li d f
Linedefects S di l i
Screwdislocation
Whichoneofthefollowingiscorrectfor
Whi h fth f ll i i Climb
tf 'Cli b'?? y It is also called as Burger
Burgerss dislocation.
(a) Dislocationmovesparalleltotheslipplane y It will have regions of shear stress around the
dislocation line
(b) Dislocationmovesperpendiculartotheslipplane
Di l i di l h li l
y For positive screw dislocation, dislocation line
(c) Slidingofoneplaneofatomsovertheotherplane
direction is p
parallel to Burgers
g vector, and vice versa.
( ) Dislocationmovesfromaslipplanetoanotherslip
(d)
plane

Contd

Li d f
Linedefects Di l i i
Dislocationmotion
y Dislocations move under applied
pp stresses,, and thus
causes plastic deformation in solids.
y Dislocations can move in three ways glide/slip, cross
slip
li andd climb
li b depending
d di on theirh i character.
h Sli is
Slip i
conservative in nature, while the climb is non
conservative, and is diffusion
diffusioncontrolled.
controlled.
y Any dislocation can slip, but in the direction of its
burgers vector.
y Edge dislocation moves by slip or climb.
y Screw dislocation moves by slip / crossslip. Possibility
f crossslip
for li arises
i as screw dislocation
di l i does
d not have
h
Contd
a preferred slip plane as edge dislocation have.

Linedefects Dislocationcharacteristics
y Dislocationshavedistortionalenergyassociatedwith IES2003 IES2009
them.
Ascrewdislocation
y Storedelasticenergyperunitlengthofthedislocation
1. LiesparalleltoitsBurger'svector Whichoneofthefollowingiscorrectfor"Burger's
Gb 2 2. LiesperpendiculartoitsBurger
LiesperpendiculartoitsBurger'svector
svector
E= vector inscrewdislocation?
vector"inscrewdislocation?
2 3. MovesinaperpendiculardirectiontotheBurger's
vector (a) Perpendiculartothedislocationline
[WhereG shearmodulusandb Burgersvector]
g
4. MovesinaninclineddirectiontotheBurger'svector (b) Inclinedtothedislocationline
I li dt th di l ti li
Selectthecorrectanswerusingthecodesgivenbelow: (c) Paralleltothedislocationline
Codes: (d) Oppositetothedislocationline
O i h di l i li
(a) 1and4 (b) 1and3
(c) 2and3 (d) 2and4

For-2015 (IES, GATE & PSUs) Page 181 of 240 Rev.0


IES2008 IES2007 I f i ld f
Interfacialdefect
Whatistheapproximatestrainenergyexpression
Wh ti th i t t i i y An interfacial defect is a 2 D imperfection in
2D
foradislocationofunitlength,irrespectiveofits crystalline solids and have different crystallographic
edgeorscrewcharacter? orientations on either side of it.
y They usually arise from clustering of line defects into a
G 2b Gb2 plane..
(a) (b)
2 2 y E.g.: External surface, Grain boundaries, Stacking
G 2b Gb2 faults, Twin boundaries, Dislocations and Phase
(c) (d) b
boundaries.
d i
4 4

Contd

IES 2010
IES2010
Surface imperfections which separate two
IES2008
orientations
i i that
h are mirror
i image
i off one Whatisasurfaceimperfection,whichseparates
Wh ti f i f ti hi h t
another is called crystalsofdifferentorientationsinapoly
crystallineaggregate,called?
(a) Stacking fault
(a) Edgedislocation (b) Stackingfault
((b)) Grain boundaryy (c) Grainboundary (d) Screwdislocation
(c) Tilt boundary
(d) Twinned boundary

Stackingfaults
y The
Th planner
l i f i produced
imperfection d d by
b the
h passage off a
partial dislocation is called stacking fault. y This is why no microscopic twins appear in FCC
B lk aVolumedefects
Bulkor V l d f
y
crystals as formation of stackingg faults is energetically
g y y Volume defects are threedimensional in nature.
y They
Th are faults
f lt in
i stacking
t ki sequence off atom t planes.
l
favorable. y These defects are introduced, usually, during
y Stacking sequence in an FCC crystal is ABC ABC ABC processing and fabrication operations like casting,
y The total energygy of a p
perfect lattice is lower than one
, and the sequence for HCP crystals is AB AB AB. AB f
forming
i etc.
with a stacking fault. This difference is stacking fault
y Two kinds of stacking faults in FCC crystals are: energy, and varies in range 0.010.1 J/m2. E.g.: Pores, Cracks, Foreign particles
y (a)
( ) ABC AC ABCwhere
ABC h CA CA representt thin
thi HCP y Lower the stacking fault energy, wider the stacking y These
Th d f t actt like
defects lik stress
t raisers,
i th deleterious
thus d l t i t
to
region which is nothing but stacking fault in FCC, mechanical properties of parent solids.
fault, metal strain hardens rapidly and twin easily.
y (b) ABC ACB CABC is called extrinsic
e trinsic or twin
t in stacking Oh
Otherwise,
i metals
l off high
hi h stacking
ki f l energy i.e.
fault i y In some instances,
instances foreign particles are added to
fault. Three layers ACB constitute the twin. Thus strengthen the solid dispersion hardening. Particles
narrower stacking faults show a deformation structure
stacking faults in FCC crystal can also be considered as added are hindrances to movement of dislocations
of banded,
banded linear arrays of dislocations.
dislocations which
hi h have
h to cut through
h h or bypass
b the
h particles
i l thus
h
submicroscopic twins. increasing the strength.
For-2015 (IES, GATE & PSUs) Contd
Page 182 of 240 Rev.0
IES 2011
IES2011 IES 2010
IES2010
Assertion (A): Natural crystals always contain
IES2003
Assertion (A): Excess defects are created by
hammering the crystalline materials. defects.
defects Whichoneofthefollowingpairsisnot
Whi h fth f ll i i i t correctly tl
Reason (R): The defects may affect colour and can matched?
Reason (R) : The thermal fluctuations create
the
h point defects
d f in crystalline
ll materials.
l make a crystal a valuable gem.
gem (a) Pointdefectincrystallattice :Selfinterstitials
(a) Both A and R are individually true and R is the (a) Both A and R are individually true and R is the (b) Lineardefectincrystallattice:Grainboundary
correct explanation
l i off A correct explanation of A ( ) Planardefectincrystallattice:Externalsurface
(c) Pl d f ti t ll tti E t l f
(b) Both A and R are individually true but R is NOT (b) Both A and R are individually true but R is NOT the (d) Volumedefectincrystallattice:otherphases
th correctt explanation
the l ti off A correct explanation of A
(c) A is true but R is false (c) A is true but R is false
(d) A is
i false
f l but
b R isi true (d) A is false but R is true

IES1997
Whichofthefollowingpropertiesofasolidare
dependentoncrystalimperfections?
1. Yieldstress 2. Meltingpoint
3. Semiconductivity 4. Ductility
Selectthecorrectanswerusingthecodesgivenbelow:
g g
(a) 1and3
(b) 1,3and4
3
(c) 2,3and4
(d) 2and4

For-2015 (IES, GATE & PSUs) Page 183 of 240 Rev.0


y Purpose of heat treatment:
H tT t t
HeatTreatment
1.To remove or relieve strains or stresses induced by cold
y Heating a metal or alloy to various definite working
ki or non uniform
if cooling
li (for
(f example
l welding):
ldi )
temperatures, holding these for various time durations Annealing
and cooling at various rates. 2. To increase strength or hardness of the material for

y Combination of controlled heating and cooling improved wear resistance: Hardening

determine not only the nature and distribution of 3.To improve machinability: Annealing

microconstituents (which determine the properties of 4.To soften the material: Annealing

a metal or alloy),
alloy) but also the grain size.
size 55. To decrease hardness and increase ductilityy and toughness.
g
(Tempering)
Contd... Contd...

Main Processes Include


MainProcessesInclude
y Annealing
IES 1992
IES1992
6. To improve the cutting properties of tools.
gg y
Whichofthefollowinggenerallydecreasesinthe
y Stress
S Relieving
R li i steelafterquenchhardening?
7. To change or modify the physical properties of the
y Quench Hardening
g 1. Brittleness
material such as electrical properties,
properties magnetic
2. Percentageelongation
properties, corrosion resistance and heat resistance y Tempering
33. Impactstrength
p g
etc. y Carburizing (a) 1and2only (b) 2and3only
8 Elimination of H2 gas dissolved during pickling or
8. y Carbon Nitriding ((c)) 1and3only
3 y ((d)) 1,2and3
, 3

electroplating which causes brittleness. y Age Hardening

y Ion Nitriding
Contd...

Fig.TTTdiagramforeutectoidtransformationinFeC Fig.TransformationsinvolvingausteniteforFeCsystem

For-2015 (IES, GATE & PSUs) Page 184 of 240 Rev.0


CCT di f F C t
CCTdiagramforFeCsystem y Critical Rate of Cooling: The minimum rate of cooling at
y TTT diagram
g is less practical since an alloy has to be cooled which the austenite is transformed into martensite alone.
rapidly and then kept at a temperature to allow for y Spheroidite: If pearlite is heated just below the eutectoid
respective transformation to take place. temperature (say 700C) and held at this temperature for a
y Usually
U ll materials
i l are cooled
l d continuously,
i l thus
h day or so, so the cementite lamelle in pearlite get
Continuous Cooling Transformation diagrams are transformed to spherical shape. The structure is called
appropriate. "spheroidite".
y For continuous cooling, the time required for a reaction to y This structure is less conducive to stress concentration
begin and end is delayed, thus the isothermal curves are because of spherical grains, as compared to cementite
shifted to longer times and lower temperatures. (l
(lamelle
ll structure).
t t )
y Main difference between TTT and CCT diagrams: no space y This, spheroidite is more tough but less hard as compared
f bainite
for b i i in i CCT diagram
di as continuous
i cooling
li always
l to pearlite.
pearlite
results in formation of pearlite.

GATE 2003
GATE2003 GATE 1996
GATE1996 IES 2002
IES2002
Duringheattreatmentofsteel,thehardnessof g
The ironcarbon diagram and the TTT curves are g p
TTTdiagramindicatestimeandtemperature
variousstructuresinincreasingorderis determined under transformationof
(a) Martensite,finepearlite,coarsepearlite, (a) Equilibrium and nonequilibrium conditions (a) Cementite (b) Pearlite
spherodite respectively (c) Ferrite (d) Austenite
(b) Finepearlite,coarsepearlite,spherodite,
martensite (b) Nonequilibrium and equilibrium conditions
respectively
(c) Martensite,coarsepearlite,finepearlite,
spherodite (c) Equilibrium conditions for both
(d) Spherodite,coarsepearlite,finepearlite, (d) Nonequilibrium conditions for both
martensite

IAS2002
IES 1998
IES1998 Two plain carbon steel specimens having 08% GATE 1997
GATE1997
carbon content are welded. If we observe the
Two cooling g curves A and B for a eutectoid iron p ,
Oncompletionofheattreatment,theresulting g
weldment under Metallurgical Microscope from
carbon alloy are superimposed on a continuous centre towards either side, the following structurewillhaveretainedAusteniteif
cooling transformation diagram as shown in the structures are observed at different zones: (a) Rateofcoolingisgreaterthanthecriticalcooling
given
i fi
figure. Fine
i pearlite
li microstructure
i i
is 1. Fine Pearlite rate
represented by the points labelled (b) Rateofcoolingislessthanthecriticalcoolingrate
2. Coarse Pearlite
( ) I and
(a) d III 3. Martensite (c) Martensite formationstartingtemperatureis
(b) II Select the correct sequence using the codes given abovetheroomtemperature
( ) IV
(c) b l
below: (d) Martensite formationfinishtemperatureisbelow
(d) I Codes: theroomtemperature
( ) 1, 2, 3
(a) (b) 1, 3, 2
(c) 2, 1, 3 (d) 3, 1, 2
For-2015 (IES, GATE & PSUs) Page 185 of 240 Rev.0
A li
Annealingprocesses F ll li
Fullannealing
y Benefits of annealing are:
y Annealing is a heat treatment process in which the y Metal is heated above the upper critical temperature &
material is taken to a high temp. kept there for some relieve stresses held there until the temperature of the work piece is
time and then cooled in furnace. increase softness, ductility and toughness uniform throughout, and finally cooling the work

y Cooling is done slowly to avoid the distortion.


distortion produce a specific microstructure piece at a slowly controlled rate in furnace so that the

y Depending on the specific purpose, annealing is temperature of the surface and that of the centre of the

classified into various types: process annealing, stress workpiece is approximately the same.

relief full annealing and normalizing.


relief, normalizing

Contd...

IES 2010
IES2010 IES 1999
IES1999 IES 1993
IES1993
Consider the following statements regarding annealing
Heatingg the hypoeutectoid
yp steels to 330oC above Whichofthefollowingstatementsaretrueof
process:
the upper critical temperature line, soaking at annealingofsteels?
1. All structural imperfections are removed
that temperature and then cooling slowly to room 1. Steelsareheatedto500to700C.
2 The hypoeutectoid steel is heated to about 50 70
2. 70 C below
temperature to formf a pearlite
li and d ferrite
f i 2. Coolingisdoneslowlyandsteadily.
C li i d l l d dil
upper critical temperature.
structure, is known as 3. Internalstressesarerelieved.
33. Cooling g can be done in heat treating g furnace,, byy heating
g it,,
keeping the metal in it and turning off furnace till it cools to ( ) Hardening
(a) H d i (b) Normalizing
N li i 4. Ductilityofsteelisincreased.
D tilit f t li i d
room temperature. (c) Tempering (d) Annealing Selectthecorrectanswerusingthecodesgivenbelow:
4. Uniform
f grain structure is resulted.
l d Codes:
Codes
Which of these statements are correct? (a) 2,3and4 (b) 1,3and4
( ) 1, 2 and
(a) d 3 only
l (b) 2, 3 andd 4 only
l (c) 1,2and4
1 2and4 (d) 1,2and3
1 2and3
(c) 1, 3 and 4 only (d) 1, 2, 3 and 4

IES 1992
IES1992 IES 2003
IES P li
Processannealing
p q g
Temperaturerequiredforfullannealinginhyperyp Primaryobjectoffullannealingisto
y After cold working the metal can be softened by
eutectoidsteelis (a) Increasetoughnessandyieldpoint
(a) 50Caboveuppercriticaltemperature(AC3) (b) Reduceductilityandresilience process annealing or "recrystallization to reduce the
(b) 50Cbelowuppercriticaltemperate(AC3) (c) Removeforeignimpuritiesandimprovesurface distortions of the crystal lattice produced by cold
((c)) 550Cabovelowercriticaltemperature(AC
p ( 1) finish
working.
working
(d) 50Cbelowlowercriticaltemperature(AC1) (d) Increaseductilityandmachinability

For-2015 (IES, GATE & PSUs) Page 186 of 240 Rev.0 Contd...
Isothermalannealingg IES 2010
IES2010
IES 2005
IES2005
y Increases the machinability. Isothermalannealingismainlyusedinalloy
The complete phase recrystallization and fine steelstoimprove
l i
y Heat above the upper critical point and held for some
grain structure is obtained in casting, forging and (a)Machinability
time, then rapidly cool to a temp. 600 700
700C,
C, and is
rolled parts by: (b)Toughness
held at this new temperature until the austenite is
(a) Recrystallization annealing (b) Normalizing (c)Ductility
completely decomposed to form pearlite.
(d)Weldability
(c) Spheroidizing (d) Austenising
y Finally cooled in still air.
air

Contd...

Stressreliefannealingg GATE2014(PI)
( ) Normalizing
For a metal alloy, which one of the following descriptions M i objective
Main bj ti
y Stress relief annealing process consists of three steps.
relates to the stressrelief annealing process? 1. Refine grain, improve machinability, tensile strength and
y The ffirst step
p is heating
g the cold worked steel to a
(a) Heating the workpiece material above its structure of weld.
weld
temperature between 5000 C and 550oC C i.e. below its
recrystallization temperature. recrystallization temperature, soaking and then cooling 2. Remove cold worked stess.
y The
h second d step involves
l h ld
holding the
h steell component at this
h in still air 3. Remove
R di l ti
dislocations d to
due t hot
h t working.
ki
temperature for 12 hours. (b) Heating the workpiece material below its Process
y The final step is to cool the steel component to room recrystallization temperature,
temperature holding for some time and y Heat the
h steell from
f 30C to 50C above
b its upper criticall
temperature in air. then furnace cooling temp, held about fifteen minutes and then allowed to cool
y It partly relieves the internal stress in cold worked steels (c) Heating the workpiece material up to its down in still air.
air
without loss of strength and hardness i.e. without change in recrystallization temperature and then rapid cooling y Homogeneous structure provides a higher yield point,
the microstructure. Since only low carbon steels can be cold
(d) Heating the workpiece up to its recrystallization ultimate tensile strength and impact strength with lower
worked,
k d theh process is i applicable
li bl to hypoeutectoid
h id steels
l
containing less than 0.4% carbon.
temperature and cooling to room temperature ductility to steels.
alternately for a few cycles Contd...

GATE 2014
GATE2014 IES 2011
IES2011 IES 2000
IES2000
The process of reheating the reduce its brittleness Which one of the following statements is NOT Assertion (A): Normalized steel will have lower
correct for normalizing? hardness than annealed steel.
without any significant loss in its hardness is (a) It is often applied to casting to relieve stresses Reason (R): The pearlite of normalized steel is
finer and has lower intermolecular space.
space
(a) normalizing (b) annealing (b) It increases strength of medium carbon steel to
some extent (a) Both A and R are individually true and R is the
(c) quenching (d) tempering correct explanation of A
(c) Better surface finish can be obtained in
(b) Both A and R are individually true but R is not the
machining correct explanation of A
(d) It increases grain size (c) A is true but R is false
(d) A is false but R is true

For-2015 (IES, GATE & PSUs) Page 187 of 240 Rev.0


S h idi i
Spheroidizing GATE 2006
GATE2006 IES 2003
IES2003
Themainpurposeofspheroidising treatmentisto Globular form of cementite in the structure of
y Heat them to slightly above the critical temperature,
temperature improve steel is obtained through
hold them at this temp for a period of time, and then (a)Hardenabilityoflowcarbonsteel (a) Normalizing
letting them cool in the furnace. ( )
(b)Machinabilityoflowcarbonsteels (b) Malleabilising
(c)Hardenabilityofhighcarbonsteels ((c)) Spheroidizing
p g
y Spheroidizing produces a rounded or globular form of
(d)Machinabilityofhighcarbonsteels (d) Carbonizing
carbide.

y It improve abrasion resistance.

Quenching
The difference between the different annealing processes is Tempering
made clear in Fig., a diagram between temperature and time. y Quenching isheattreatmentprocesswherematerialis
y Tempering
p g is the p g martensitic steel at
process of heating
cooledatarapidratefromelevatedtemperatureto
l d t id t f l t dt t t
a temperature below the eutectoid transformation
produceMartensitephase.
temperature to make
k it
i softer
f andd more ductile.
d il
Comparative coolingratesofQuenchMedia
Brine 1.20 to 1.30 y During
g the tempering
p gpprocess,, Martensite transforms to
Water
1
Water + NaOH a structure containing iron carbide particles in a matrix
<1
or KOH
Oil 0.40 to 0.50 of ferrite.
Forced air 0.03
Still air 0.02
y Brinehasfastestcoolingrateofsteelquenchingandis
B i h f li f l hi di
alsousedassecondaryrefrigerant.

IES 2010
IES2010 IES 2001
IES2001 IES 2009
IES2009
Match List I with List II and select the correct
gq g
Considerthefollowingquenchingmedia: g
Whichoneofthefollowingmediumsisusedfor
answer using the code given below the lists:
1. Oil 2.Water thefastestcoolingrateofsteelquenching?
List I List II
33. Water+NaOH 4 4.Brine (a) Air (b) Oil
(Q
(Quenching
hi media) di ) (St
(Structure
t produced)
d d)
Thecorrectsequenceofthesemediainorderof (c) Water (d) Brine
A. Water 1. Coarse pearlite
increasinghardnessofsteelundergoingheat
g g g
B Oil
B. 2. Martensite
M i treatmentis
C. Air 3. Very fine pearlite (a) 1,3,2,4 (b) 2,1,3,4
D. Furnace cools 4. Fine pearlite (c) 1,2,3,4 (d) 4,3,2,1
A B C D A B C D
(a) 1 3 4 2 (b) 2 3 4 1
(c) 1 4For-2015
3 2
(IES, (d) 2& PSUs)
GATE 4 3 1 Page 188 of 240 Rev.0
IES 2006
IES2006 M t i
Martempering
MatchListI(EffectofCooling)withListII(Cooling
Medium)andselectthecorrectanswerusingthecode
d ) d l h h d y Quench steel from the austenizing temperature to a
givenbelow: bath just above Ms.
ListI
List I List II
List
A. Martensite 1. Waterquenched y Since, austenite transforms to martensite
B. Veryfinepearlite
y p 2. Aircooled
simultaneously throughout the steel,
steel the distortion in
C. Finepearlite 3. Furnacecooled
D. Coarsepearlite 4. Oilquenched quenching is minimized.
A B C D A B C D
y This induces greater toughness in the steel.
(a) 1 4 2 3 (b) 2 3 1 4
( ) 2
(c) 3 4 1 (d) 1 2 3 4

A t i
Austempering GATE 2004
GATE2004
Fromthelistsgivenbelow,choosethemostappropriatesetof
y This hardening process is basically the same as the heattreatmentprocessandthecorrespondingprocess
characteristics
martempering, but has a longer holding time above Process Characteristics
P
P. Tempering 1
1. Austeniteisconvertedinto
the martensitic transformation temperature. bainite
Q. Austempering 2. Austeniteisconvertedinto
martensite
R. Martempering 3. Cementite isconvertedinto
globularstructure
4. Bothhardnessandbrittlenessare
reduced
d d
5. Carbonisabsorbedintothemetal
(a) P3Q1R5 (b) P4Q3R2
( ) P4Q1R2
(c) P Q R (d) P Q R
P1Q5R4

IES 1994
IES1994 IES 2006
IES2006 IES 2005
IES2005
g
Considerthefollowingtreatments: p g p
Temperingisaprocessofannealing g p
Austempering g isemployedtoobtain:
p y
1. Normalizing 2. Hardening (a) Martensite atlowtemperatures (a) 100%martensitic structure
33. Martemperingp g 4.
4 Coldworking g ((b)) Martensite athighertemperatures
g p ((b)) 100%bainitic structure
Hardnessandtensilestrengthinausteniticstainless (c) Bainite atlowtemperatures (c) 50%martensitic and50%bainitic structure
steelcanbeincreasedbyy (d) Bainite athighertemperatures (d) 100%pearlitic structure
(a) 1,2and3 (b) 1and3
((c)) 2and4
4 ((d)) 4
4alone

For-2015 (IES, GATE & PSUs) Page 189 of 240 Rev.0


IES 2004
IES2004 IES 2001
IES2001 IES 2006
IES2006
gp
Considerthefollowingpairs: p g q
'Tempering'ofquenchedmartensitic steelis p
ThepatternknownasWidmanstatten structureis
Heattreatment Effectonmediumcarbonsteel necessarytoimprovethe encounteredin:
1. Normalizingg :Grainrefinement (a) Hardnessofthemetal (a) Tempering (b) Normalizing
2. Fullannealing :Uniformgrainstructure (b) Surfacetextureorthemetal (c) Spheroidizing (d) Annealing
3. Martempering :Decreasedductility ((c)) Corrosionresistanceofthemetal
4. Spheroidizing :Maximumsoftness (d) Ductilityorthemetal
Whichofthepairsgivenabovearecorrectlymatched?
(a) 1and2 (b) 2and3
(c) 3and4 (d) 1,2,3and4
1 2 3and4

GATE2014
G 0 Solutionizing A i
Aging
Match the heat treatment processes (Group A) and their
associated effects on properties (Group B) of medium y Solutionizing
g ((solution heat treatment),
) where the y Aging
g g finelyy dispersed
p p p
precipitate p
particle will form.
carbon
b steel
t l
GroupA GroupB alloy is heated to a temperature between solvus and Aging the alloy at room temperature is called natural
P T
P:Tempering
i I St
I.Strengtheningandgrainrefinement
th i d i fi t solidus
lid temperatures and
d kept
k there
h till
ill a uniform
if solid
lid aging,
i whereas
h at elevated
l d temperatures is
i called
ll d
Q:Quenching II.Inducingtoughness
solution structure is produced. artificial aging. Most alloys require artificial aging, and
R A
R:Annealing
li III H d i
III.Hardening
aging temperature is usually between 1525% of
S:Normalizing IV.Softening
P Q R S P Q R S t
temperature
t diff
difference b t
between room temperature
t t and
d
(a) III IV II I (b) II III IV I solution heat treatment temperature.
(c) III II IV I (d) II III I IV

C H d i
CaseHardening Induction hardening
Inductionhardening GATE 2000
GATE2000
y Alternating current of high frequency passes for few Caststeelcrankshaftsurfaceishardenedbyy
y In case hardening, the surface of the steel is made hard second through an induction coil enclosing the steel (a) Nitriding (b) Normalising
and wear resistant,
resistant but the core remains soft and part to be heat treated.
treated ((c)) Carburising
g ((d)) Inductionheating
g
tough.
y Immediately after heating, water jets are activated to
quench the surface.

y Martensite is produced at the surface, making it hard


and wear resistant.

For-2015 (IES, GATE & PSUs) Page 190 of 240 Rev.0


IES 1992
IES1992 Fl h d i
Flamehardening IES 1996 1997
IES1996;1997
g y
Inductionhardeningisbasicallya y For large work pieces flame hardening is done by Guideways y oflathebedsarehardenedby
y
(a) Carburising process (a) Carburising
means of an oxyacetylene torch.
((b)) Surfacehardeningprocess
gp ((b)) Cyaniding
y g
(c) Corehardeningprocess y Heating should be done rapidly by the torch and the (c) Nitriding
(d) Noneoftheabove surface quenched.
quenched (d) Flamehardening

Laser hardening
Laserhardening C b ii
Carburizing
y Laser beams are of high intensity, a lens is used to y There is fully
y austenitic state is essential. If carburizing
g
y Carburizing is the most widely used method of surface
reduce the intensity by producing a defocused spot of hardening. is done in the ferritic region, the carbon, with very
limited solubility in ferrite, tends to form massive
si e ranging from 0.5
size 0 to 25
2 mm.
mm y Here,
Here the surface layers of low carbon steel are
cementitei particles
i l near the
h surface,
f making
ki the
h
enriched with carbon up to 0.81.0%. The source of
subsequent heat treatment difficult.
carbon mayy be a solid medium, a liquid
q or a g
gas.
y For
F thisthi reason, carburizing
b i i i always
is l d
done i the
in th
y In all cases, the carbon enters the steel at the surface
austenitic state, even though longer times are required
and diffuses into the steel as a function of time at an
due to the diffusion rate of carbon in austenite being
elevated temperature.
less that in ferrite at such temperatures.
y Carburizing is done at 920950oC.

Contd...

IES 2011
IES2011 GATE 1992
GATE1992 IES 1992
IES1992
Assertion (A): Carburizing is used for machine Carburized machine components p g
have high In case carburising g Carbon is introduced to form a
elements
l which
hi h have
h to have
h a wear resistant
i endurance limit because carburization high carbon layer at the surface. The carbon is
working surface.
(a) Raises the yield point of the material introduce in the form of
Reason (R) : The composition of surface layers
are changed in carburizing. (b) Produces a better surface finish (a) Graphite flakes (b) Pearlite
( )
(a)BothAandRareindividuallytrueandRisthe
y ((c)) Introduces a compressive
p layer
y on the surface (c) Cementite (d) Free carbon
correctexplanationofA (d) Suppresses any stresss, concentration produced in
(b)BothAandRareindividuallytruebutRisNOT the component.
thecorrectexplanationofA
h l i fA
(c)AistruebutRisfalse
(d)Ai f l b tRi t
(d)AisfalsebutRistrue

For-2015 (IES, GATE & PSUs) Page 191 of 240 Rev.0


IES 2005
IES2005 C aniding
Cyaniding GATE 2003
GATE2003
p
If the surface of a component y stressed
is heavily y Cyaniding is done in a liquid bath of NaCN, with the g y p
Hardnessofsteelgreatlyimproveswith
while the stresses in the core are of comparative (a) Annealing (b) Cyaniding
small magnitude, which one of the following heat concentration varying between 30 and 97%.
((c)) Normalising
g ((d)) Tempering
p g
treatment methods
h d isi employed?
l d y The temperature used for cyaniding is lower than that
(a) Annealing (b) Tempering
for carburizing and is in the range of 800 870oC.
800870 C
(c) Quenching (d) Case hardening
y The time of cyaniding is 13 hr to produce a case depth
of 0.25 mm or less.

Nitriding IES 1992


IES1992 IES 1995
IES1995
Q g y g
Quenchinginnotnecessarywhenhardeningis MatchListIwithListIIandselectthecorrectanswer
y During nitriding, pure ammonia decomposes to yield usingthecodesgivenbelowthelists:
i th d i b l th li t
doneby
nitrogen which enters the steel. ListI(Heattreatment) ListII(Effectonthe
(a) Casecarburizing properties)
y The temperature of nitriding is 500590oC. The time (b) Flamehardening A. Annealing 1. Refinedgrainstructure
B. Nitriding 2. Improvesthehardnessof
for a case depth of 0.02
0 02 mm is about 2 hr.
hr ((c)) Nitridingg thewholemass
(d) Anyoftheaboveprocesses C. Martempering 3. Increasessurfacehardness
y Most of the nitrogen, that enters the steel, forms hard D. Normalising 4. Improvesductility
Codes:A
d B C D A B C D
nitrides (e.g., Fe3N).
(a) 4 3 2 1 (b) 1 3 4 2
y No
N phase
h change
h occurs after
ft nitriding.
it idi c) 4 2 1 3 (d) 2 1 3 4

IES 2004
IES2004 Precipitation & Dispersion hardening
Precipitation&Dispersionhardening
Match List I (Name of treatment) with List II (Media IAS2009Main y Foreign particles can also obstructs movement of
used)
d) and d select
l t the
th correctt answer usingi the
th codes
d dislocations
di l ti i.e.
i increases
i the
th strength
t th off the
th material.
t i l
given below the Lists y Foreign particles can be introduced in two ways
List I List II precipitation
p p and mixingandconsolidation
g technique.
q
A. Pack carburizing 1. Ammonia gas y Precipitation hardening is also called age hardening
B. Gas carburizing 2. Sodium cyanide because strength increases with time.
C Cyaniding
C. 3
3. Carburizing y R
Requisite
i i for
f precipitation
i i i hardening
h d i is i that
h second d phase
h
compound must be soluble at an elevated temperature but precipitates
D. Nitriding 4. Ethane p q
upon quenching g and aging
g g at a lower temperature.
p
Codes:A
d B C D A B C D y E.g.: Alalloys, CuBe alloys, MgAl alloys, CuSn alloys
(a) 3 4 2 1 (b) 2 1 3 4
y If aging occurs at room temperature Natural aging
(c) 3 1 2 4 (d) 2 4 3 1
y If material need to be heated during aging Artificial
aging.
For-2015 (IES, GATE & PSUs) Page 192 of 240 Rev.0 Contd...
y In dispersion hardening, fine second particles are IES 2009
IES2009
mixed with matrix powder, consolidated, and pressed
in powder metallurgy techniques.
techniques Which one of the following g materials can be
y For dispersion hardening, second phase need to have subjected to an age hardening process?
veryy low solubilityy at all temperatures.
p (a) HSS
y E.g.: oxides, carbides, nitrides, borides, etc. (b) Aluminium
y Dislocation moving through matrix embedded with ((c)) Pure iron
foreign particles can either cut through the particles or
(d) Stellite
bend around and bypass them. y Optimumstrengtheningoccursduringagingoncetheright
y Cutting of particles is easier for small particles which iinterspacingofparticlesisachieved.
t i f ti l i hi d
can be considered as segregated solute atoms. Effective y Smallertheparticles,dislocationscancutthroughthemat
strengthening
g g is achieved in the bending g p
process, y lowerstresses
when the particles are submicroscopic in size. y largertheparticlestheywillbedistributedatwider
Contd... distances.

IES 1994 2005


IES1994;2005 IES 2007
IES2007 IES 2001
IES2001
Assertion (A): Carburizing is done on nonferrous Which one among g the following
g is the most Whichoneofthefollowingpairsiscorrectly
alloys to increase the surface hardness. effective strengthening mechanism of non matched?
h d
Reason (R): Precipitation hardening of non ferrous metal? (a) SolidsolutionstrengtheningIncreasingdensity
ferrous alloys involves solution heat treatment ofdislocations
(a) Solid solution hardening (b) Dispersionhardening..Creatingstrained
followed by precipitation heat treatment.
(a) Both A and R are individually true and R is the (b) Strain hardening regioninthecrystal
correct explanation of A (c) Grain size refinement (c) Strainhardening....Creatingparticlesto
resistthemovement
(b) Both A and R are individually true but R is not the (d) Precipitation hardening ofdislocations
correct explanation of A (d) Precipitationhardening..Creatingparticlesby
(c) A is true but R is false decreasingsolubilityofone
(d) A is false
f l but
b R is true phaseinanother
h i h

Grain gro th
Graingrowth S ki t i
Seasoncrackingorstresscorrosion IES 2007
IES2007
y Grain growth follows complete crystallization if the g
cracking. Which one of the following g elements/ alloy
y
material
t i l is
i left
l ft att elevated
l t d temperatures.
t t
exhibits season cracking?
y Grain growth does not need to be preceded by recovery
y
and recrystallization; ; it mayy occur in all p
polycrystalline
y y y Brasses with more than 15% zinc often experience (a) Iron (b) Brass
materials. season cracking or stresscorrosion cracking. (c) Aluminium (d) Steel
y In contrary to recovery and recrystallization, driving force y Both stress and exposure to corrosive media are
for this process is reduction in grain boundary energy.
energy required for this failure to occur (but
( residual stresses
y Tendency for larger grains to grow at the expense of smaller and atmospheric moisture may be sufficient!).
grains is based on p
g physics.
y
y In practical applications, grain growth is not desirable.
y As
A a result,
l coldworked
ld k d brass
b i usually
is ll stress relieved
li d
y Incorporation of impurity atoms and insoluble second
(to remove the residual stresses) before being placed in
phase
h particles
i l are effective
ff i in i retarding
di graini growth.
h service.
service
y Grain growth is very strongly dependent on temperature.
For-2015 (IES, GATE & PSUs) Page 193 of 240 Rev.0
IAS 1994
IAS1994 IES 2011
IES2011 Strengthening mechanisms in
Strengtheningmechanismsin
j p
Majoroperationsinthemanufactureofsteelballs Assertion (A) : The steel when heated above a Metals
usedforBallbearingsaregivenbelow certaini temperature and d cooledl d to room y Ability of a metal to deform plastically depends on ease of
temperature, structure adjustment stabilizes. dislocation motion under applied external stresses.
1. Oillapping 2. Coldheading
Reason (R) : The modification is mainly based y As
A strengthening
h i off a metall consist
i hindering
hi d i dislocation
di l i
3. Annealing 4. Hardening on cooling rate. motion. Dislocation motion can be hindered in many
55. Roughgrinding
g g g ((a)) Both A and R are individuallyy true and R is the ways, thus are strengthening mechanisms in metals.
Thecorrectsequenceoftheseoperationsis correct explanation of A y Strengthening by methods of grainsize reduction, solid
(b) Both A and R are individually true but R is NOT solution alloying and strain hardening applies for single
the
h correct explanation
l i off A phase metals.
(a) 3,2,4,1,5 (b) 3,2,1,4,5
(c) A is true but R is false y Precipitation hardening, dispersion hardening, fiber
((c)) 2,3,4,5,1
,3,4,5, ( )
(d) 2,3,5,4,1
,3,5,4,
(d) A is
i false
f l but
b t R is
i true
t strengthening
t th i and d Martensite
M t it strengthening
t th i are applicable
li bl
to multiphase metallic materials.

Strengthening by Grain Size


StrengtheningbyGrainSize
Reduction
IES1998
y Withdecreaseingrainsize,themeandistanceofa Assertion(A):Refiningthegrainsizeofa
y Thisstrengtheningmechanismisbasedonthefact dislocationcantraveldecreases,andsoonstartspile polycrystallinematerialrendersitharderand
thatcrystallographicorientationchangesabruptlyin upofdislocationsatgrainboundaries.Thisleadsto stronger.
passingfromonegraintothenextacrossthegrain increaseinyieldstrengthofthematerial. Reason(R):Grainboundariesprovideeasypathsto
boundary. dislocationmotion.
y Thusitisdifficultforadislocationmovingona y Grainsizereductionimprovesnotonlystrength,but
(a) BothAandRareindividuallytrueandRisthecorrect
commonslipplaneinonecrystaltopassovertoa alsothetoughnessofmanyalloys. explanationofA
similarslipplaneinanothergrain,especiallyifthe y Grainsizecanbecontrolledbyrateofcooling,andalso (b) BothAandRareindividuallytruebutRisnot the
orientationisverymisaligned.
i t ti i i li d b l i d f
byplasticdeformationfollowedbyappropriateheat
i f ll db i h correctexplanationofA
y Inaddition,thecrystalsareseparatedbyathinnon treatment. (c) AistruebutRisfalse
crystallineregion whichisthecharacteristicstructure
crystallineregion,whichisthecharacteristicstructure (d) AisfalsebutRistrue
Ai f l b tRi t
ofalargeanglegrainboundary.
Contd

IES 2010
IES2010 Solid Solution
SolidSolution
GATE1998 Assertion(A):Polycrystallinematerialisstronger y A solid solution is formed when two metals are
Decreasing
D i grain i size
i ini a polycrystalline
l t lli material
t i l thanordinaryone.
thanordinaryone completely soluble in liquid state and also completely
(a) Increases yield strength and corrosion resistance. Reason(R):Crystalsinpolycrystallinematerial soluble in solid state. In other words, when
homogeneous
g mixtures of two or more kinds of atoms
(b) Decreases
D yield
i ld strength
h andd corrosion
i resistance
i havedifferentorientationswithrespecttoeach
(of metals) occur in the solid state, they are known as
other. solid solutions.
(c) Decreases yield strength but increases corrosion
resistance
i t (a) Both A and R are individually true and R is the y The
Th more abundant
b d t atomic
t i formf i referred
is f d as solvent
l t
correct explanation of A and the less abundant atomic form is referred as
(d) Increases yield strength but decreases corrosion
resistance.
resistance (b) Both A and R are individually true but R is NOT the solute.
correct explanation of A y Example is brass. Brass is a solid solution of copper (64
((c)) A is true but R is false percent) and zinc (36 percent). In this case copper
atoms are solvent
l atoms whereas
h zinc
i atoms are solute
l
(d) A is false but R is true atoms.
For-2015 (IES, GATE & PSUs) Page 194 of 240 Rev.0
TYPES OF SOLID SOLUTIONS
TYPESOFSOLIDSOLUTIONS 1 Substitutional SolidSolutions
1.Substitutional Solid Solutions S lid l bili
Solidsolubility
y Solidsolutionsareoftwotypes. y If the atoms of the solvent or parent metal are replaced y Extent of solid solubility
y in a two element system
y can be
in
i the
h crystall lattice
l i by b atoms off the
h solute
l metall then
h predicted based on HumeRuthery conditions.
y Theyare:
the solid solution is known as substitutional solid y If the system obeys these conditions, then complete solid
(a)Substitutional solidsolutions. solution.
solution solubilityy can be expected.
p
HumeRuthery conditions:
(b)Interstitialsolidsolutions. y For example, copper atoms may substitute for nickel y Crystal structure of each element of solid solution must be
atoms without disturbing the F.C.C. F C C structure of the same.
same
nickel. y Size of atoms of each two elements must not differ by more
than 15%.
y In the substitutional solid solutions, the substitution
y Elements
l should
h ld not form
f compounds
d with h each
h other
h i.e.
can be either disordered or ordered. there should be no appreciable difference in the electro
y HumeRothery y formulatedcertainruleswhichgovern
g negativities of the two elements.
theformationofsubstitutional solidsolutions. y Elements should have the same valence.

2 Interstitial Solid Solutions


2.InterstitialSolidSolutions IES 2011
IES2011
y In interstitial solid solutions, the solute atom does not y In this system the carbon (solute atom) atom occupies Assertion (A) : Solid solutions of metal are
displace
di l a solvent
l atom, but
b rather
h it i enters one off the
h an interstitial position between iron (solvent atom) crystall whose
h propertiesi are close
l to those
h off
holes or interstices between the solvent atoms. atoms. the solvent.
y An
A excellent
ll t example l is
i ironcarbon
i b system
t which
hi h isi y Normally,
Normally atoms which have atomic radii less than one Reason (R) : They retain the same crystal lattice
shown in Fig. angstrom are likely to form interstitial solid solutions. and type of bond.
y Examples are atoms of carbon (0.77
(0 77 A
A)), nitrogen (0.71
(0 71 ((a)) Both A and R are individuallyy true and R is the
A), hydrogen (0.46 A), Oxygen (0.60 A) etc. correct explanation of A
(b) Both A and R are individually true but R is NOT
the
h correct explanation
l i off A
(c) A is true but R is false
(d) A is
i false
f l but
b t R is
i true
t
Contd

INTERMETALLIC COMPOUNDS
INTERMETALLICCOMPOUNDS IES 2010
IES2010
IES2001 Consider the following:
y Intermetallic compounds are generally formed when
one metall (for
(f example l magnesium)
i ) hash chemical
h i l Whichofthefollowingfactorsgovernsolubilityof
twononferrousmetalsbothinliquidstate,as 1. Crystal structure 2. Relative size
properties which are strongly metallic and the other
metal (for example antimony,
antimony tin or bismuth) has wellasinsolidstate? 33. Chemical affinityy 4
4. Valencyy
chemical properties which are only weakly metallic. 1.Crystalstructure 2.Relativesizefactor Which of these factors govern relative
y Examples of intermetallic compounds are Mg2Sn, Mg2Sn 3.Chemicalaffinityfactor 4.Relativevalence solubility of two metals in each other in the
factor
Mg2Pb, Mg3Sb2 and Mg3 Bi2. solid state?
Selectthecorrectanswerusingthecodesgivenbelow:
y These intermetallic compounds have higher melting (a) 1,
1 2 and 3 only
C d
Codes:
point than either of the parent metal.
(a) 1,2and3 (b) 2,3and4 (b) 2, 3 and 4 only
y This higher
g melting gppoint indicates the high
g strength
g
( ) 1and4
(c) d (d) 1,2,3and4
d (c) 1, 2 and 4 only
of the chemical bond in intermetallic compounds.
For-2015 (IES, GATE & PSUs) Page 195 of 240 (d) 1, 2, 3 and 4 Rev.0
IES 2010
IES2010
IES2006 Allotropictransformation An allotropic material has
Which
Whi h one off the th following
f ll i factors
f t is
i more y When metals solidify,
solidify they assume a crystalline structure; that
is, the atoms arrange themselves in a geometric lattice. (a) Fixed structure at all temperatures
relevant to represent complete solubility of two
y Many metals exist in only one lattice form. Some, however, can ((b)) Atoms distributed in random ppattern
metals in each other? exist
i t in
i the
th solid
lid state
t t in
i two
t or more lattice
l tti forms,
f th particular
the ti l
(a) Chemical affinity (b) Valency factor form depending on the conditions of temperature and pressure. (c)Different crystal structures at different
Such metals are said to be allotropic or polymorphic, and the
(c) Crystal structure factor (d) Relative size factor change
h f
from one lattice
l i form
f to another
h is i called
ll d an allotropic
ll i temperatures
transformation. (d) Fixed structure but random atom distribution
y The most notable example p of such a metal is iron, where the
allotropic change makes it possible for heattreating procedures
to produce a wide range of final properties.
y It is largely because of its allotropy that iron has become the
basis of our most important alloys.

Plain Carbon steel


PlainCarbonsteel IES 2005
IES2005
y Duetolackoftensilestrengthandhardnesspureiron
Considerthefollowingstatements:
isnotused.
i d
1. Strengthofsteelincreaseswithcarboncontent.
y Mostimportantalloyselementiscarbon.
2 Young
2. Young'sModulusofsteelincreaseswithcarbon
sModulusofsteelincreaseswithcarbon
y Maximumamountofcarbonthatcanbealloyedwith
content.
ironis6.67%.
3. Young
Young'sModulusofsteelremainsunchangedwith
sModulusofsteelremainsunchangedwith
y Alloycontainingupto
All i i 2%carbonissteelandabove2%
% b i l d b %
variationofcarboncontent.
arecausedcostIron.
Whichofthestatementsgivenaboveis/arecorrect?
g /
Hardness
(a) 1only (b) 2only

N
Strength Reduction area

BH
(c) 1and2 (d) 1and3
0.02 1.4
%Carbon 0.02 %Carbon

Low carbonsteel:(lessthan0 3%C)


Lowcarbonsteel:(lessthan0.3%C)
y Goodformabilityandweldabilitybutlackhardenability IES 2005
IES2005 IES 1995
IES1995
y Usedinhotforming,coldformingetc. g
Considerthefollowingstatementsaboutmedium MatchListIwithListIIandselectthecorrectanswer
MediumcarbonsteelorMildsteel(0.3%to0.8%carbon) carbonsteel: usingthecodesgivenbelowthelists:
y hightoughness&ductility ListI(Alloy) ListII(Use)
y Mostwidelyusedsteel
y 1. Itcanbequenchhardenedbutnotcasehardened.
y Heattreatable(austenitizing,quenchingandtempering). 2. Itcannotbequenchhardenedbutcasehardening A Lowcarbonsteel
A. L b l 1. B i
Bearing
y Hardenability isincreasedbyaddingNi,Cr,Mo. canbedone. B. Hadfieldmanganesesteel 2. Thermocouple
y Usedinvarioustemperedconditions
Usedinvarioustemperedconditions. 3. Itexhibitsdistinctyieldpointundertensiontest.
It hibit di ti t i ld i t d t i t t C Constantan
C. 3
3. Wirenails
Wirenails.
y Typicalapplications:gears,railwaytracks,machineparts. D. Babbittalloy 4. Bulldozer
Whichofthefollowingstatementsgivenaboveare
Highcarbonsteel(morethe0.8%C) blades.
y Hardness&wearresistancearehighbutToughness&
correct?
Code:A B C D A B C D
formabilityisverylow (a) 1and2 (b) 2and3
Note purestformofIroni.e.wroughtironhasleastcarbon (a) 1 2 3 4 (b) 3 4 1 2
content.
(c) 1and3 (d) 1,2and3
( ) 3
(c) 2 1 4 (d) 3 4 2 1

For-2015 (IES, GATE & PSUs) Page 196 of 240 Rev.0


IES 2005
IES2005 IES 2007
IES2007 IAS 2002
IAS2002
( ) ( pp )
MatchListI(Steel)withListII(Application)and MatchListI(Percentageofcarboncontentinplaincarbonsteel)with
Whichofthefollowingfactorsinfluenceinaplain ListII(Application)andselectthecorrectanswerusingthecodes
selectthecorrectanswerusingthecodegivenbelow carbonsteel? givenbelowthelists:
theLists: ListI ListII
ListI ListII g
1. Percentagecarbon ((Percentageofcarboncontent
g ((Application)
pp )
inplaincarbonsteel)
A. MildSteel 1. Ballbearing 2. Quenchingmedia A.010 020 1.Drophammers
B. ToolSteel 2. Coldchisels 3. Worksize B.030 040 2.Razors
C.060 070 3.Structures
C. HighCarbonSteel 3. Shaftandaxles Selectthecorrectanswerusingthecodegivenbelow D.110 140 4.Cranehooks
D. MediumCarbonSteel 4. Rolledsteelsections (a) 1and2only (b) 2and3only
Codes:A B C D A B C D
( ) 3
(a) 4 2 1 (b) 4 3 1 2
Codes:A B C D A B C D (c) 3 4 1 2 (d) 4 3 2 1
(c) 1and3only (d) 1,2and3
(a) 2 1 4 3 (b) 4 3 2 1
( ) 2
(c) 3 4 1 (d) 4
(d) 1 2 3

GATE 1992
GATE1992
Thetruestrainforalowcarbonsteelbarwhichis
doubledinlengthbyforgingis
((a)) 0.307
3 7
(b) 0.5
(c) 0.693
(d) 1.0

FigIronCarbonEquilibriumDiagram

Fe C equilibrium diagram
FeCequilibriumdiagram
y The structural form of pure iron at room temperature
is
i called f i or iron.
ll d ferrite i
y Ferrite is soft and ductile.
y Since ferrite has a bodycentred cubic structure, the
interatomic spaces are small and pronouncedly
oblate, and cannot readily accommodate even a small
oblate
carbon atom. Therefore, solubility of carbon in ferrite
is very low, of the order of 0.006% at room
temperature.
y The maximum carbon content in ferrite is 0.05%
5 at 77233
C.
For-2015 (IES, GATE & PSUs)
FigIronCarbonEquilibriumDiagram OrthorhombicFe
Page3C.Ironatomsareblue.
197 of 240 Rev.0 Contd
y In
I addition
dditi t carbon,
to b t i amountt off silicon,
a certain ili y In
I ironcarbon
i b ll
alloys, b
carbon i excess off the
in th solubility
l bilit
y The maximum solubility is only 2% of carbon at 11 limit must form a second phase, which is called iron
manganese and phosphorous may be found in ferrite.
30C. carbide or cementite.
y The face centred modification of iron is called
facecentred
austenite or iron. It is the stable form of pure iron at y Above 1400C, austenite is no longer the most stable y Iron carbide has the chemical composition of Fe3C . This
temperatures between 910C and 1400C. At its stable form of iron, and the crystal structure changes back to does not mean that iron carbide forms molecules of
temperature austenite i i soft
is f and d ductile
d il and d a bodycentred
b d d cubic
bi phase
h called
ll d delta
d l iron.
i Thi is
This i Fe3C but simply that the crystal lattice contains iron and
iron except for its carbon atoms in a three to one ratio.
consequently, is well suited for manufacturing the same phase as the
processes. y The compound Fe3C has an orthorhombic unit cell with
temperature range.
range twelve iron atoms and four carbon atoms per cell, and thus
y The facecentred cubic structure of iron has larger y The solubility of carbon in ferrite is small, but it is has a carbon content of 6.67%.
interatomic spacing than in ferrite. Even so, in FCC appreciably larger than In ferrite
ferrite, because of higher y As compared to austenite and ferrite,
ferrite cementite being an
structure the interstices are barely large enough to intermetallic compound, is very hard and brittle.
temperature. The maximum solubility of carbon in
accommodate carbon atoms, and lattice strains are
&iron is 0.1% at 1490C.
49 y The presence of iron carbide with ferrite in steel greatly
produced As a result,
produced. result not all the interstitial sites can increases the
h strength
h off steel.
l
be filled at any one time.
Contd Contd Contd

y In the reaction, the simultaneous formation of ferrite y Thealloycontaining0.80%ofcarboniscalledthe y FeFe3Cphasediagramischaracterizedbyfiveindividual


and cementite from austenite results at the eutectoidsteel. phases,:ferrite(BCC)FeCsolidsolution,austenite(FCC)
temperature of 723 C and composition of 0.80%
723C 0 80% FeCsolidsolution,ferrite(BCC)FeCsolidsolution,Fe
F C lid l ti f it (BCC)F C lid l ti F 3C
y Uponcoolingtheeutectoidsteelbelow723C,allof
carbon. (ironcarbide)orcementite anintermetalliccompoundand
theausteniteistransformedintopearlite.
y There are nearlyy 12% of iron carbide and slightly
g y more liquidFeCsolutionandfourinvariantreactions:
than 88% of ferrite in the resulting mixture. y Alloyswithlessthan0.80%Carecalledhypo
All i hl h 8 %C ll dh
y Since the ferrite and cementite are formed eutectoidsteelsandthosewithhighercompositionare y peritectic reaction at1495oC and0.16%C,ferrite+L
simultaneously,
i lt l th
they are i ti t l
intimately mixed.
i d calledhyper eutectoidsteels
calledhypereutectoidsteels. i (
iron(austenite)
i )
Characteristically, the mixture is lamellar, i.e., it is y monotectic reaction 1495oC and0.51%C,L L+iron
composed
p of alternate layers
y of ferrite and cementite. (austenite)
y This microstructure is called pearlite which is very y eutecticreaction at1147oC and4.3%C,L iron+Fe3C
important in iron and steel technology, because it can (cementite)[ledeburite]
b formed
be f d in
i almost
l all
ll steels
l by
b means off suitable
i bl y eutectoidreaction at723oC and0.8%C,iron ferrite+
heat treatments. Fe3C(cementite)[pearlite]
Contd Contd Contd

IES2004 IES1992
Three
Three phasereactions Considerthefollowingtemperatureranges:
C id th f ll i t t Themicrostructurecompositionofpearlite fora
y Suffix ic denotesatleastoneliquidphaseisthere 1.Roomtemperature 2.0to910C Fe3Cdiagramconsistsof
y Suffix
Suffix oid allphasesinvolvearesolid oC oCtobelowmelting (a) Carbondissolvedinalphaironhavingabody
3.910Cto1400
C 4.1400
C b l l i canteredcubicstructure.
point
(b) Carbondissolvedingama ironhavingaface
I hi h fth b t
Inwhichoftheabovetemperaturerangesferritewith
t f it ith canteredcubicstructure.
bodycenteredcubicstructureisindicatedin,theFe (c) Amixtureofbodycanteredalphaironandface
Fe3Cphasediagram? enteredgammairon
(a)1,2and4(b)2,3and4(c)1and3 (d)2and3 (d) Carbondissolvedinbodycanteredalphaironand
anFe,Fe3C.

For-2015 (IES, GATE & PSUs) Page 198 of 240 Rev.0


IES 2011
IES2011 IES 2010
IES2010 IES 2010
IES2010
Liquid + solid (1) on cooling converting solid (2) Ironcarbon equilibrium diagram Pearlite phase in an ironcarbide phase
reaction is known as: (a) Correlates the microstructure and properties of diagram
di is
i
(a) Eutectoid reaction steel and cast iron (a) Eutectic phase
(b) Eutectic reaction (b) Indicates the phase changes occurring during (b) Hypoeutectic mixture
(c) Peritectic reaction heatingg and coolingg (c) Eutectoidal mixture
(d) Peritectioid reaction (c) Is made by plotting carbon percentage along X (d) Hypereutectic phase
axis and temperature along Yaxis.
Yaxis
(d) All of the above

IES 1995
IES1995 IES 2004
IES2004 IES 1995
IES1995
Match List I with List II and select the correct y y 5 y g
Anironcarbonbinaryalloyhas0.5%Cbyweight. Eutectoidreactionoccursat
answer using the codes given below the lists: Whatisthisalloycalled? (a) 600C
List I (Name of Material) List II (% Carbon Range) (a) Eutectoidalloy ((b)) 7723C
3
A Hypoeutectoid
A. id steell 1. 4.3 6.67 (b) Eutecticalloy (c) 1147C
B. Hypereutectoid steel 2. 2.0 4.3
((c)) Hypoeutectoidalloy
yp y (d) 1493
1493C
C
C Hypoeutectic
C. H t ti castt iron
i 3. 0.8
8 2.0
(d) Hypereutectoidalloy
D. Hypereutectic cast iron 4. 0.008 0.8
Codes A B
Codes:A C D A B C D
(a) 4 3 2 1 (b) 1 3 2 4
(c) 4 1 2 3 (d) 1 2 3 4

IES 2005
IES2005 GATE 1992
GATE1992 IES 2006
IES2006
The eutectoid of carbon in iron,, above lower Matchthetermsusedinconnectionwithheattreatmentofsteelwith
themicrostructural/physicalcharacteristics:
Match ListI (FeFe3C Phase Diagram Characteristic) with
ListII
Li II (Phase)
(Ph ) and
d select
l the
h correct answer using
i the h code
d
critical temperature, when cooled, results in: Terms Characteristics given below the Lists:
(A) Pearlite (P)Extremelyhardandbrittlephase
(a) Ferrite and austenite ListI ListII
1. iron
(B) Martensite (Q)Cementite isfinelydispersedinferrite
A. Alpha () iron
(b) Ferrite and cementite (C) Austenite (R)Alternatelayersofcementite andferrite
(D) Eutectoid (S)Canexistonlyabove723C B. Iron carbide having crystal lattice 2.Eutectic
((c)) Cementite and austenite ( )
(T)Pertainingtostateofequilibriumbetweenthree
g q with
t 3 iron
o aandd 1 ca
carbon
bo ato
atom
solidphases C. BCC pure allotrope of iron is stable 3.Ferrite
(d) Ferrite, cementite and austenite (U)Pertainingtostateofequilibriumbetweenone
between 1388 C and is melting
liquidandtwosolidphase
Codes: A B C D A B C D point at 1535
1535C
C 4 Cementite
4.Cementite
(a) R P S T (b) R S P T Codes:A B C A B C
(c) T R P S (d) T R S P (a) 4 2 3 (b) 3 4 1
( ) 4
(c) 2 1 ( )
(d) 3 1 2

For-2015 (IES, GATE & PSUs) Page 199 of 240 Rev.0


IES 2002
IES2002 IES 1999
IES1999 IES 1993
IES1993
Match List I with List II and select the correct answer: Inaeutecticsystem,twoelementsarecompletely Eutecticreactionforiron carbonsystemoccursat
Eutecticreactionforironcarbonsystemoccursat
List I (Phase diagram) List II (Characteristic)
A. Isomorphous system 1.One liquid decomposes into another (a) Insolubleinsolidandliquidstates (a) 600C
liquid and solid
BE
B.Eutectic
i system 2.One
O liquid
li id and
d another
h solid
lid combine
bi to (b) Solubleinliquidstate (b) 723
723C
C
form a new solid (c) Solubleinsolidstate (c) 1147C
C.Peritectic system 3.Two metals are completely soluble in
liquid state And completely insoluble in (d) Insolubleinliquidstate (d) 1493
1493C
C
solid state
D.Monotectic system 4.Two metals, soluble in solid and liquid
state
Codes: A B C D A B C D
(a) 2 3 4 1 (b) 4 1 2 3
(c) 2 1 4 3 (d) 4 3 2 1

IES 2000
IES2000 IES 2007
IES2007 IES 2005
IES2005
Duringperitectic solidification,oneliquid Which one of the following g is the correct Increaseofferritephaseinsteelincreases:
(a) Combineswithonesolidtoformasecondnew statement? (a) Strength
solid Pearlite in ironcarbon system is a
(b) Hardness
(b) Solidifiesintotwodifferentsolids (a) Phase consisting of ferrite and cementite at room
temperature (c) Ductility
(c) Formsonesolid (b) Mechanical
M h i l mixturei t off ferrite
f it and d cementite
tit att (d) Brittleness
(d) Formsonesolidandanotherliquid room temperature
(c) Eutectic mixture ferrite and cementite at room
temperature
((d)) All the above three are correct

IES 2005
IES2005 IES 2000
IES2000 IES 1997
IES1997
A60C plaincarbonsteelhas,approximately:
A60Cplaincarbonsteelhas,approximately: Pearlite consistsof A given steel test specimen is studied under
(a) 75%ofpearlite and25%offerrite (a) 6.67%Cand93.33%ferrite metallurgical microscope. Magnification used is
(b) 25%ofpearlite and75%offerrite (b) 13%Feand87%cementite 100 X. In that different phases are observed. One
of them is Fe3C. The observed phase Fe3C is also
(c) 75%ofcementite and25%offerrite (c) 13%Cand87%ferrite known as
(d) 75%ofpearlite and25%ofcementite (d) 13%cementite and87%ferrite (a) Ferrite
(b) Cementite
(c) Austenite
(d) Martensite

For-2015 (IES, GATE & PSUs) Page 200 of 240 Rev.0


IES 1995
IES1995 IES 2001
IES2001 1 E i ( F C)
1.Eutectic(FeC)
Which one of the following sets of constituents is Martensite is a super saturated solution of carbon
supersaturated y (L1S1+S2)
expected in equilibrium cooling of a in y Two materials are completely soluble in liquid state
hypereutectoid steel from austenitic state? ((a)) Alpha
p iron and completely
p y insoluble in solid state.
(a) Ferrite and pearlite (b) Beta iron
((b)) Cementite and ppearlite (c) Gamma iron
L
(c) Ferrite and bainite (d) Delta iron + L
+L
((d)) Cementite and martensite
+

2 P i i (FeC)
2.Peritectic ( F C) 3 M i FeO
3.Monotectic F O2SiO
SiO2 4 S i NaZn
4.Syntectic N Z
y (L+S1S2) y (L1S1+L2) y (L1+L2S1)
y One Liquid and another solid combine to form a new y One Liquid decomposes into another liquid and solid.
solid. L L

L L1
L 1+L 2
L
L
L+ L1 L2


B
+
+L
L L2 + L2
L1 L1 L 2
L+ L2

L1+ L2+

5 E id F C
5.EutectoidFeC 6 P i id CuAl
6.Peritectoid C Al y Isomorphus
I h system: In
I a binary
bi h there
system when h i
is
complete intersolubility between components in all
y (S1S2+S3) y S1 +S2S3 phases,
phases the system is isomorphus.
isomorphus
Ex: CuNi, Al2O3Cr2O3, NiOMgO


y Azeotropic system: Some of isomorphus binary
system, the liquidus touches, the solid tangentially at a
minimum temperature which is lower then milting
+

+
temperature of either of the two components.

+r
+
AuCu,AuNi
L
+L
+ +L

+ T
+

+p
r

A B
For-2015 (IES, GATE & PSUs) Page 201 of 240 CompositionBw/o Rev.0
IES 2007
IES2007 IES 2004
IES2004 L R l
LeverRule
y Atapointinaphasediagram,phasespresentandtheircomposition(tieline
MatchListIwithListIIandselectthecorrectanswerusingthe Consider the following lead tin phase diagram
leadtin ) g p ( ) p
method)alongwithrelativefractionofphases(leverrule)canbecomputed.
codegivenbelowtheLists:
d i b l th Li t y Relativeamountofliquidandsolidphasesisgivenrespectivelyby:
ListI ListII given below: cV Uc
CL = CS = CL + CS = 1
(NameoftheInvariant (InvariantReactionduring For which one of the following g alloy
y compositions,
p , UV UV
Reaction) cooling) y Thereforeitisnotrestrictedtosolidphasesonly.
A. Monotectic 1.LIQUID.SOLID1+SOLID2 the alloy will have the lowest melting point at 185oC
B. Eutectic 2.LIQUID1..LIQUID2+SOLID ((a)) 20% Sn and 80% Pb byy weightg
C
C. E t t id
Eutectoid 3.SOLID1..SOLID1+SOLID2
SOLID SOLID SOLID
D. Peritectic 4.LIQUID+SOLID1..SOLID2 (b) 60% Sn and 40% Pb by weight
Code: A B C D A B C D ((c)) 97
97% Sn and 33% Pb byy weight
g
(a) 3 1 2 4 (b) 2 4 3 1 (d) 40% Sn and 60% Pb byweight
(c) 3 4 2 1 (d) 2 1 3 4

IES 2008
IES2008
Example
a pe
y In a binary system of A and B, if a liquid of 35% A (65%
Assertion (A): Lever Rule can be applied to determine B) is coexists with a solid of 75% A (25% B), for an
relative
l amounts off phasesh present at any overall composition of 40% A, the fraction of the liquid
temperature.
is given by
Reason (R): Lever Rule is restricted to estimate
relative phases, only if they are solid phases.
(a) Both A and R are true and R is the correct explanation
off A 75 40
(b) Both A and R are true but R is NOT the correct CL = = 0.875
explanation of A 75 35
(c) A is true but R is false
(d) A is false but R is true

F C ll l ifi i
FeCalloyclassification IES 2003
IES2003
y Fe Calloysareclassifiedaccordingtowt.%Cpresent
FeCalloysareclassifiedaccordingtowt.%Cpresent According to Gibbs
Gibbs' phase rule, the number of
inthealloyfortechnologicalconvenienceasfollows: degrees of freedom of an eutectic point in a binary
y Commercialpureirons
p %C<0.008 system is
y Lowcarbon/mildsteels 0.008 %C 0.3 (a) 1
y Mediumcarbonsteels 0.3 %C
0.3 %C 0.8 ((b)) 2
y Highcarbonsteels 0.8 %C 2.11 (c) 0
y Castirons 2 11<%C
2.11<%C ((d)) 3

For-2015 (IES, GATE & PSUs) Page 202 of 240 Rev.0


Cast Iron
CastIron
y The properties of cast iron which make it a valuable
y The cast iron is obtained by
y remelting
gp g iron with
pig
coke and limestone in a furnace known as cupola. material for engineering purposes are its low cost,
y It is primarily an alloy of iron and carbon. good
g casting
g characteristics, high
g compressive
p
y The carbon content in cast iron varies from more than strength, wear resistance and excellent machinability.
2 per cent to 4.5 per cent.
y The
Th compressive
i strength
t th off castt iron
i i much
is h greater
t
y The carbon in a cast iron is present in either of the
than the tensile strength.
following two forms:
1. Free carbon or graphite, and
2. Combined carbon or cementite.

Contd

IES 2010
IES2010 IES 2005
IES2005 IES 1999
IES1999
Assertion (A): A cast iron specimen shall fail due to
g
Considerthefollowingstatements: Castironisusedformachinebedsbecauseofits
shear when subjected to a compressive load.
load
1. CastIronhaspoorabilitytodampvibrations. high
Reason (R): Shear strength of cast iron in
g p
2. CastIronhashighercompressivestrength g (a) Tensilestrength
compression is more than half its compressive
strength. comparedtothatofsteel. (b) Endurancestrength
(a) Both A and R are individually true and R is the 33. CastIronpartsaresuitablewherepermanent
p p ((c)) Dampingcapacity
p g p y
correct explanation of A deformationispreferredoverfracture. (d) Compressivestrength
(b) Both A and R are individually true but R is NOT the Whichofthestatementsgivenaboveis/arecorrect?
correct explanation of A (a) 1,2and3 (b) 1and3
((c)) A is true but R is false ((c)) 33only
y ((d)) 2onlyy
(d) A is false but R is true

IES 1998
IES1998 IES 1997
IES1997 IAS 2003
IAS2003
g y
Assertion(A):Castironisgenerallyhard,brittleand ( ) y
Assertion(A):Thenotchsensitivityofcastiron Considerthefollowingstatements:
wearresistant. componentiszero. 1. Fromdesignconsiderations,itisalways
Reason(R):Castironcontainsmorethan2%carbon Reason(R):Castirondoesnothaveayieldpoint. advantageoustoplacecastironribsonthetension
andassuchthepercentagecementite
d h h i initishigher.
i i i hi h sideratherthanonthecompressionside.
sideratherthanonthecompressionside
(a) BothAandRareindividuallytrueandRisthe
(a) BothAandRareindividuallytrueandRisthecorrect 2. Castironisanexcellentchoiceformachinetool
correctexplanationofA guidesandframes.
explanationofA
(b) BothAandRareindividuallytruebutRisnot the 3. Castironpartshavelownotchsensitivity.
(b) BothAandRareindividuallytruebutRisnot the
p
correctexplanationofA
correctexplanationofA Whichofthesestatementsarecorrect?
(c) AistruebutRisfalse (c) AistruebutRisfalse (a) 1,2and3 (b) 2and3
((d)) AisfalsebutRistrue (d) AisfalsebutRistrue ((c)) 1and3
3 ((d)) 1and2

For-2015 (IES, GATE & PSUs) Page 203 of 240 Rev.0


IES 1992
IES1992 T pes of Cast Iron
TypesofCastIron 1 Gre cast iron
1.Greycastiron
g
Whichofthefollowingmetalshrinksmostfrom y Cast irons that were slowlyy cooled to room y Carbon = 3 to 33.5%;
5 ;
moltenstatetosolidstate? temperature consist of cementite, look whitish white y The grey colour is due to the fact that the carbon is
(a) Castiron (b) Caststeel cast iron. present in the form of free graphite.
(c) Brass (d) Admiraltymetal y If it contains graphite, look grayish gray cast iron. y It has a low tensile strength, high compressive strength
y It is heat treated to have graphite in form of nodules and no ductility.
malleable cast iron. y It can be easily machined.
y If inoculants are used in liquid state to have graphite y A very good property of grey cast iron is that the free
nodules
d l spheroidal
h d l graphite
h (SG)
( ) cast iron. graphite in its structure acts as a lubricant. Due to this
reason, it is very suitable for those parts where sliding
action
i isi desired.
d i d
Contd Contd

IES 1994
IES1994 IES 2005
IES2005
y The grey iron castings are widely used for machine tool Whichofthefollowingpairsarecorrectlymatched?
Assertion(A):Machinetoolbedsaregenerally
bodies,
bodies automotive cylinder blocks,
blocks heads,
heads housings,
housings madeofgreycastiron. (DesignationofSteel/CastIron)
(D i ti fSt l/C tI ) (Description)
(D i ti )
flywheels, pipes and pipe fittings and agricultural 1. FeE250 :Minimumtensile
Reason(R):Castironpossessesgoodself strengthof250
implements. lubricatingproperties.
lubricatingproperties N/mm2
2. 40C8 :Percentageof
y The grey cast iron is designated by the alphabets FG (a) BothAandRareindividuallytrueandRisthe Manganeseis0.7%
followed byy a figure
g indicating
g the minimum tensile correctexplanationofA 0.9%
strength in MPa or N/mm2. For example, FG 150 3. FG200 :Greycastironwith
(b) BothAandRareindividuallytruebutRisnot the ultimatetensilestrength
means grey cast iron with 150 MPa or N/mm2 as correctexplanationofA of200N/mm2
minimum tensile strength. S l tth
Selectthecorrectanswerusingthecodegivenbelow:
t i th d i b l
(c) AistruebutRisfalse (a) 1and2 (b) 2and3
(d) AisfalsebutRistrue (c) 1and3 (d) 1,2and3

GATE 2004
GATE2004 IES 2007
IES2007 IES 2003
IES2003
p g g y
Thepercentageofcarboningraycastironisinthe p g y
Vibrationdampinginmachineryisbestachieved Machinetoolmanufacturersprefergreycastiron
rangeof bymeansofbasestructuresmadeofwhichoneof grade40forproducingmachinecolumnsand
thefollowingmaterials? tablesbecausegreycastironis
(a) 0.25to0.75percent
(a) Lowcarbonsteel 1 Heavy
1. 2
2. Easilycastable
(b) 1.25to1.75percent
3. Easilyweldable 4. Havinggood
((c)) 33to4percent
4p (b) Nodulariron dampingcapacity
(d) 8to10percent (c) Greycastiron Selectthecorrectanswerusingthecodesgivenbelow:
(d) Whitecastiron C
Codes:
(a) 1and2 (b) 2and4
((c)) 1and33 ((d)) 33and4
4

For-2015 (IES, GATE & PSUs) Page 204 of 240 Rev.0


IES 1993
IES1993 2 White cast iron
2.Whitecastiron IES 2005
IES2005
Assertion(A):Fracturesurfaceofgreycastironis y Carbon = 1.75
75 to 2.3%.
3 g
Whichofthefollowingmaterialsisusedinthe
dark. y The white colour is due to fact that it has no graphite manufactureofextrusionnozzles?
Reason(R):Failuretakesplacealongtheweak and whole of the carbon is in the form of carbide (a) Greycastiron
cementite plates.
plates (known as cementite) which is the hardest constituent (b) Malleablecastiron
(a) BothAandRareindividuallytrueandRisthe of iron.
correctexplanationofA ((c)) Whitecastiron
y The white cast iron has a high tensile strength and a
(b) BothAandRareindividuallytruebutRisnot the (d) Nodularcastiron
correctexplanationofA low compressive strength.
(c) AistruebutRisfalse
(d) AisfalsebutRistrue

3 Chilled cast iron


3.Chilledcastiron 4 Mottled cast iron
4.Mottledcastiron 5 Malleable cast iron
5.Malleablecastiron
y It is a white cast iron p
produced byy q g of
quick cooling y It is a p
product in between g
greyy and white cast iron in y The malleable iron is a cast ironcarbon alloy
y which
molten iron. composition, colour and general properties. solidifies in the ascast condition in a graphite free
y The quick cooling is generally called chilling and the y It is obtained in castings where certain wearing structure, i.e. total carbon content is present in its
cast iron so produced is called chilled cast iron. surfaces have been chilled. combined
bi d form
f as cementite
i (Fe
( 3C).
C)
y Chills are used on any faces of a casting which are y It is ductile and may be bent without breaking or
required to be hard to withstand wear and friction. f t i the
fracturing th section.
ti
y The tensile strength of the malleable cast iron is
usuall higher than that of grey
usually gre cast iron and has
excellent machining qualities.

Contd

y It is used for machine parts for which the steel forgings


1 Blackheart process
1.Blackheartprocess 2 Whiteheart process
2.Whiteheartprocess
y In this process the white iron castings are heated in y In this process the castings are packed into airtight boxes
would be too expensive and in which the metal should g g
with iron oxide in the form of highgrade ore.
airtight boxes out of contact with air at 850 950 deg C for
850950
have
h a fair
f i degree
d off accuracy, e.g. hubs
h b off wagon y They are then heated to about 1000 deg C for between 70
50170 hours, depending upon the mass and thickness of
wheels, small fittings for railway rolling stock, brake and 100 hours, depending upon the mass and thickness of
the castings.
supports, parts of agricultural machinery, pipe fittings, the castings.
castings
door hinges, locks etc. y The effect of this prolonged heating is to break down the
y The ore oxidises the carbon in the castings and draws it
y In order to obtain malleable iron castings, it is first cast iron carbide (cementite) of the white cast iron into small
out, leaving a ferritic structure near the surface and a
into moulds
ld off white
h cast iron. Then
h byb a suitablebl heat
h rosettes of graphite.
graphite pearlitic structure near the centre of the casting.
treatment (i.e. annealing), the combined carbon of the y The name 'blackheart' comes from the darkened y There will also be some fine rosettes of graphite.
white cast iron is separated into nodules of graphite.
graphite appearance of the iron, when fractured, resulting from the y Whit h t castings
Whiteheart ti b h
behave muchh as expected
t d off a mild
ild
y There are two process: formation of free graphite. steel casting, but with the advantage of a very much lower
1. Black
Blackheart
heart process, y It is used in the wheel hubs, break drums, conduit fitting melting point and higher fluidity at the time of casting.
control levers and pedals. y It is used in the wheel hubs, bicycle and motor cycle frame
2. Whiteheart process
fittings, gas, water and steam pipe fittings.
For-2015 (IES, GATE & PSUs) Contd Page 205 of 240 Rev.0
IES 1992
IES1992 IES 1992
IES1992 6 Nodular or spheroidal graphite
6.Nodularorspheroidal graphite
g p yp p
Whichofthefollowingdisplaypropertiessimilar Forthepipefittinglikeelbow,tee,unionetc. castiron
tothatofsteel whichofthefollowingispreferred? y The nodular or spheroidal graphite cast iron is also
1. Blackheartcastiron ((a)) Pigiron
g called ductile cast iron or high
g strength
g cast iron.
2. Whiteheartcastiron (b) Malleableiron y This type of cast iron is obtained by adding small
33. Graycastiron
y (c) Spheroidal graphitecastiron amounts of magnesium (0.1 to 0.8%) to the molten
4. Pigiron grey iron.
(d) Highcarbonsteel
((a)) 1and2onlyy ((b)
) 33and4only
4 y y The addition of magnesium causes the graphite to take
form of small nodules or spheroids instead of the
(c) 2and4only (d) 1and3only
normal angular flakes.

Contd

y It has high fluidity, castability, tensile strength,


IES 2001
IES2001 IES 2009
IES2009
g
toughness, , wear resistance,, p g
pressure tightness, , g y g y
Nodulargreycastironisobtainedfromthegrey g
Whichoneofthefollowingcastironsconsistsof
weldability and machinability. castironbyaddingasmallamountof carboninrosetteform?
y It is ggenerallyy used for castings
g requiring
q g shock and (a) Manganese (a) Whitecastiron
impact resistance along with good machinability, such (b) Phosphorus (b) Graycastiron
as hydraulic cylinders, cylinder heads, rolls for rolling ((c)) Magnesium
g ((c)) Malleablecastiron
mill
ll andd centrifugally
f ll cast products.
d
(d) Chromium (d) Nodularcastiron
y SG 400/15 means spheroidal graphite cast iron with
400 MPa
MP as minimum
i i tensile
il strength
h andd 15 percent
elongation.

IES 1995
IES1995 Wro ght Iron
WroughtIron Effect of Imp rities on Cast Iron
EffectofImpuritiesonCastIron
g
Additionofmagnesiumtocastironincreasesits y It is the p
purest iron which contains at least 99 5 iron
99.5% 1. Silicon. It mayy be p p 4
present in cast iron upto 4%. It
(a) Hardness but may contain upto 99.9% iron. provides the formation of free graphite which makes
((b)) Ductilityandstrengthintension
y g y The wrought iron is produced from pig iron by the iron soft and easily machinable. It also produces
remelting it in the puddling furnace of reverberatory sound d castings
i f
free f
from bl
blowholes,
h l b
because off its
i
(c) Corrosionresistance high affinity for oxygen.
type.
(d) Creepstrength.
y The wrought iron is a tough, malleable and ductile
material. 2. Sulphur. It makes the cast iron hard and brittle. Since
y It can be
b easily
l forged
f d or welded.
ld d It is used
d for
f chains,
h too much sulphur gives
gi es unsound casting,
casting therefore,
therefore it
crane hooks, railway couplings, water and steam pipes. should be kept well below 0.1% for most foundry
purposes.
purposes

For-2015 (IES, GATE & PSUs) Page 206 of 240 Rev.0 Contd
3. Manganese. It makes the cast iron white and hard. It
IES 1995
IES1995 IES 2007
IES2007
p below 0.75%.
is often kept 75 p to exert a
It helps g
Considerthefollowingstatements: p g
Pistoncompressionringsaremadeofwhichone
controlling influence over the harmful effect of Additionofsilicontocastiron ofthefollowing
sulphur. g p
1. Promotesgraphitemoduleformation. (a) Castiron (b) Bronze
2. Promotesgraphiteflakeformation. (c) Aluminium (d) Whitemetal
4. Phosphorus. It aids fusibility and fluidity in cast 3. Increasesthefluidityofthemoltenmetal.
iron, but induces brittleness. It is rarely allowed to
4. Improvestheductilityofcastiron.
exceed 1%. Phosphoric irons are useful for casting of
i i
intricate d i
design and
d for
f many light
li h engineering
i i Selectthecorrectanswerusingthecodesgivenbelow:
castings when cheapness is essential. (a) 1and4 (b) 2and3
(c) 1and3 (d) 3and4

IES 1995
IES1995 IES 1994
IES1994
g
Considerthefollowingworkmaterials: Whichofthefollowingpairsarecorrectly
1. Titanium 2. Mildsteel matched?
1. LeadscrewnutPhosphorbronze
33. Stainlesssteel 4 4. Greycastiron.
y
2. Piston..Castiron.
i C i
Thecorrectsequenceofthesematerialsintermsof
3. Cam..EN31steel
increasingorderofdifficultyinmachiningis
g y g
4. Leadscrew..Wroughtiron.
L d W hti
(a) 4,2,3,1 (b) 4,2,1,3
Selectthecorrectanswerusingthecodesgivenbelow:
((c)) 2,4,3,1
,4,3, ((d)) 2,4,1,3.
, 4, , 3 Codes:
Codes
(a) 2,3and4 (b) 1,3and4
(c) 1,2and4
1 2and4 (d) 1,2and3
1 2and3

IAS 2002
IAS2002
p g
Acastironspecimeninatorsiontestgivesa
(a) Cupandconefracture
((b)) Fracturealongaplanenormaltotheaxisofthe
g p
specimen
((c)) Fracturealongahelixofapproximately45
g pp y 45
(d) Fracturealongaplaneinclinedat60 totheaxis

For-2015 (IES, GATE & PSUs) Page 207 of 240 Rev.0


All St l
AlloySteel 1 Ni k l
1.Nickel y It has proved to be of advantage in the manufacture of
y It increases the strength
g and toughness
g of the steel. boiler tubes,, valves for use with superheated
p steam,,
y Definition:
f A steell to which
h h one or more alloying
ll valves for I.C. engines and spark plugs for petrol
y These steels contain 2 to 5% nickel and from 0.1 to
elements other than carbon have been deliberately engines.
0.5% carbon.
added (e.g.
(e g chromium,
chromium nickel,
nickel molybdenum) to
y In this range, nickel contributes great strength and y A nickel steel alloy containing 36% of nickel is known
achieve a particular physical property.
hardness with high elastic limit, good ductility and as invar. It has nearly zero coefficient of expansion. So
good resistance to corrosion. it is in great demand
d d for
f measuring instruments and d
y An alloy containing 25% nickel possesses maximum standards of lengths for everyday use.
toughness
h and
d offers
ff the
h greatest resistance to rusting,
corrosion and burning at high temperature.

Contd

IES 1992
IES1992 IES 2008
IES2008 IES 2011
IES2011
g p p y
Invarisusedormeasuringtapesprimarilytheto p p y
CoefficientofExpansionispracticallynilina Which one of the following is the major alloying element
its particularalloy.Whatisthisalloy? in Invar?
(a) Nonmagneticproperties (a) HadfieldManganeseSteel (a) Aluminium
(b) Highnickelcontent (b) Invar (b) Nickel
((c)) Lowcoefficientofthermalexpansion
p ((c)) Vitallium (c) Vanadium
(d) Hardenability (d) Stellite (d) Copper

2 Ch i
2.Chromium 3 T t
3.Tungsten IES 2004
IES2004
y It is used in steels as an alloying element to combine y It p
prohibits g
grain g
growth,, increases the depth
p of p g g
Forimprovingthestrengthofsteelatelevated
hardness with high strength and high elastic limit. hardening of quenched steel and confers the property temperatures,whichoneofthefollowingalloying
y It also imparts corrosionresisting properties to steel. of remaining hard even when heated to red colour. elementisused?
y The
h most common chromeh steels
l contains
i from
f 0.5 to y It is usually used in conjunction with other elements. (a) Copper
2% chromium and 0.1 to 1.5% carbon.
y Steel containing 3 to 18% tungsten and 0.2 to 1.5% (b) Tungsten
y The chrome steel is used for balls,
balls rollers and races for carbon is used for cutting tools. (c) Aluminium
bearings.
y The principal uses of tungsten steels are for cutting (d) Zinc
y A nickel chrome steel containing
g 33.25%
5% nickel,, 1.5%
5%
chromium and 0.25% carbon is much used for armour tools,
l dies,
d valves,
l taps and
d permanent magnets.
plates. Chrome nickel steel is extensively used for
motor
t car crankshafts,
k h ft axles
l and
d gears requiring
i i greatt
strength and hardness.
For-2015 (IES, GATE & PSUs) Page 208 of 240 Rev.0
4 V di
4.Vanadium GATE 1997
GATE1997 IES 2000
IES2000
y It aids in obtaining
g a fine g
grain structure in tool steel. y g y p
Thealloyingelementmainlyusedtoimprovethe Additionofvanadiumtosteelresultsin
y The addition of a very small amount of vanadium (less endurancestrengthofsteelmaterialsis improvementof
than 0.2%) produces a marked increase in tensile (a) Nickel (a) Heattreatabilitybyquenching
strength and elastic limit in low and medium carbon (b) Vanadium (b) Hardenability
steels without a loss of ductility. ((c)) Molybdenum
y ((c)) Fatiguestrength
g g
y The chromevanadium steel containing about 0.5 to
(d) Tungsten (d) Resistancetooxidationatelevatedtemperature
1.5% chromium, 0.15 to 0.3% vanadium and 0.13 to 1.1%
carbon have
ha e extremely
e tremel good tensile strength,
strength elastic
limit, endurance limit and ductility.
y These steels are frequently used for parts such as
springs, shafts, gears, pins and many drop forged parts.

5 M
5.Manganese IES 6 Sili
6.Silicon
y It improves
p g of the steel in both the hot
the strength y
Alloysteelwhichisworkhardenable andwhichis y The silicon steels behave like nickel steels.
rolled and heat treated condition. usedtomakethebladesofbulldozers,bucket y These steels have a high elastic limit as compared to
y The manganese alloy steels containing over 1.5% wheelexcavatorsandotherearthmoving ordinary carbon steel.
manganese with a carbon range of 0.40 to 0.55% are equipmentcontainiron,carbonand
i i i b d y Silicon steels containing from 1 to 2% silicon and 0.1 to
used extensively in gears, axles, shafts and other parts (a) Chromium 0.4% carbon and other alloying elements are used for
where
h hi h strength
high t th combined
bi d withith fair
f i ductility
d tilit isi (b) Silicon electrical machinery, valves in I.C. engines, springs and
required. (c) Manganese corrosion resisting materials.
y The principal uses of manganese steel is in machinery
machiner (d) Magnesium.
parts subjected to severe wear. These steels are all cast
and ground to finish.
finish

7 C b lt
7.Cobalt IES 2010
IES2010 8 M l bd
8.Molybdenum
y It g
gives red hardness byy retention of hard carbides at
Some high speed steels have cobalt (Co) y A very
y small q
quantityy ((0.155 to 0.30%)
3 ) of molybdenum
y
high temperatures. added
dd d to them
h in
i amounts ranging i from
f 2%
% is generally used with chromium and manganese (0.5
y It tends to decarburise steel during heattreatment. to 15%, since this element improves the to 0.8%) to make molybdenum steel.
y It increases hardness and strength and also residual (a)Cutting efficiency, especially at high y These steels possess extra tensile strength and are used
magnetism and coercive magnetic force in steel for temperature for airplane fuselage and automobile parts. It can
magnets. replace
l t
tungsten
t in
i high
hi h speedd steels.
t l
(b) Depth hardening ability of the HSS tool
(c) Red hardness of the HSS tool
(d) Grain structure of the HSS tool

For-2015 (IES, GATE & PSUs) Page 209 of 240 Rev.0


9 B
9.Boron IES 1992
IES1992 10 l h
10.sulphur
y Boron (not exceeding 0.003%) is a very powerful p g
Smallpercentageofboronisaddedtosteelto y Itisanundesirableimpurityinsteelbecauseitsforms
p y
hardenability
h d bl agent, being
b from
f 250 to 750 times as ironsulphide,whichcanresultincracking.
effective as nickel, 75 to 125 times as effective as (a) Increaseshardenability
y
molybdenum, , and about 100 times as p powerful as ((b)) Reducemachinabilityy y However,inthepresenceofproperamountofMn,it
chromium.
(c) Increaseswearresistance formsMn Swhichimprovesthemachinability of
y Only a few thousandths of a percent are sufficient to steels.
produce the desired effect in lowcarbon
low carbon steels,
steels but the (d) Increaseendurancestrength
y Itscontentmayveryfrom0.06 0.30%.
results diminish rapidly with increasing carbon content.
y Since no carbide formation or ferrite strengthening
g g is
produced, improved machinability and coldforming
capability often result from the use of boron in place of
other hardenability additions.
additions
y It has no effect on tensile strength of steel.

11.Copper All St l t l
AlloySteelataglance (4) Tungsten,Molybdenum,Vanadium: hothardness
, ,
Donotformcarbide: nickel,Silicon,Aluminium Tungsten wearresistance,
y Copper has been known
kno n to resist atmospheric corrosion Vanadium:
V di endurancelimit
d li i
for centuries, but only recently has it been used as an Carbideformingorder:Manganese,chromium,
Molybdenum creepproperty
addition to steel ((in amounts from 0.10 to 0.50%)5 ) to Tungsten,Molybdenum,vanadium,titanium,
(5) Si&Al deoxidizer,restrictgraingrowth
deoxidizer restrictgraingrowth
provide this property. niobium.
Si Magneticpermissibility
y Lowcarbon steel sheet and structural steels often contain (1) Manganese: Toughness&ductility (6) Cobalt: hardenability
a copper addition to enhance corrosion resistance, but Machinability withsulphur Impactstrength
surface quality and hotworking behavior tend to
deteriorate somewhat.
somewhat (2) Chromium: Corrosionresistance (7) Phosphorus: reducestrengthtoimpact
conductivityofcopper
Wearresistance
(8) Copper: Raisesyieldpoint
(3) Nickel: toughness
g
(9) Magnesium: becauselightweightitisused
whereweightisimportant.
Contd

IES 2011
IES2011 IES 1996
IES
Superalloy: Isforhightemperatureuse[jetengine, Match List I with List II and select the correct answer using
gasturbinebladeetc] the code given below the lists : Whichofthefollowingpairsregardingtheeffectof
Ex: Hastelloy X alloyingelementsinsteelarecorrectlymatched?
ll i l t i t l tl t h d?
ListI ListII
C 0.1% 1. Molybdenum:Formsabrasionresistingparticles.
A.Copper
pp 1.Corrosion
Mn 1% 2 Phosphorus:Improvesmachinability infreecutting
2.
B.Nickel 2.Demagnetization steels.
Cr 21.8%
C M
C.Manganese 3.NonSparking
N S ki 3. Cobalt:Contributestoredhardnessbyhardening
Si
Si 1%
%
ferrite.
Ni balance D.Vanadium 4.Deformationrestriction 4. SiliconReducesoxidationresistance
C 2.5%
Co %
Codes Selectthecorrectanswerusingthecodesgivenbelow:
Mo 9%
A B C D A B C D (a) 2,3and4 (b) 1,3and4
W 0.6%
W 0 6% (a) 1 2 3 4 (b) 4 3 2 1 (c) 1,2and4 (d) 1,2and3
Fe 18.5% (c) 1 3 2 4 (d) 4 2 3 1
For-2015 (IES, GATE & PSUs) Page 210 of 240 Rev.0
IES 1992
IES1992 IAS 1995
IAS1995 IAS 2002
IAS2002
Matchthefollowing:g Assertion(A):Inhighspeedsteels,alloyingelements WatchListI(Alloyingelementsfortoolsteel)withListII
tungsten,chromiumandvanadiumareaddedto
t t h i d di dd dt (Improvedmechanicalproperty)andselectthecorrect
ListI(Alloyingelementinsteel) ListII(Effect) makethemsuitabletoworkathigherspeedsthan answerusingthecodesgivenbelowtheLists
A. Lead 1. Restrictsgraingrowth toolsteelorlowalloysteels. ListI ListII
R
Reason(R):Vanadiumaddstothepropertyofred
(R) V di dd h f d (All i l
(Alloyingelementsfortoolsteel)
t f t l t l) (I
(Improved d
B. Aluminium 2. Raisesyieldpoint mechanicalproperty)
hardnessandtungstenandchromiumaddtohigh
C. Copper 3. Reducesstrengthto wearresistance. A. Carbon 1. Hardness
impact (a) BothAandRareindividuallytrueandRisthecorrect B. Manganese 2. HotHardness
d
D. Phosphorus 4. Freemachining explanationofA C. Chromium 3. LowerCritical
(b) BothAandRareindividuallytruebutRis not the Temp
Codes:A
d B C D A B C D correctexplanationofA D. Vanadium 4. Toughness
(a) 1 2 3 4 (b) 2 3 4 1 (c) AistruebutRisfalse Codes:A B C D A B C D
(d) AisfalsebutRistrue (a) 1 3 4 2 (b) 2 4 3 1
( ) 3
(c) 4 1 2 (d) 4 1 2 3
(c) 1 4 3 2 (d) 2 3 4 1

St i l St l
StainlessSteel y Austenitic steels contain 18% Cr and 8% Ni plus minor y Austenitic stainless steels are nonmagnetic and are
alloying elements. Ni stabilizes the austenitic phase highly resistant to corrosion 304 alloy is 188 when 18%
y They
y typical
yp g with other
consists min.12% Cr along
assisted by C and N. chromium & 8% nickel used costly material.
material
alloying elements, thus highly corrosion resistant
y Austenitic stainless steels usually contain 18% Cr and
owing to presence of chromium oxide. y For, martensitic steels Ms is made to be above the
8% Ni in addition to other minor alloying elements. Ni
y Three kinds ferritic & hardenable Cr steels, austenitic room temperature. These
Th alloys
ll are heat
h treatable.
bl stabilizes the austenitic phase assisted by C and N.
and precipitation hardenable (martensitic, semi Major alloying elements are: Cr, Mn and Mo. Other alloying additions include Ti, Nb, Mo (prevent
austenitic)
t iti ) based
b d on presence off prominenti t micro
i y Ferritic
F iti and d austenitic
t iti steels
t l are hardened
h d d and d weld
ld decay),
d ) MnM and d CuC (helps
(h l i stabilizing
in t bili i
structural constituent. strengthened by cold work because they are not heat austenite).
y Typical
T pical applications cutlery,
cutler surgical knives,
kni es storage treatable.
treatable y These steels are very tough and can be forged and
tanks, domestic items. y Austenitic steels are nonmagnetic as against ferritic rolled but offer great difficulty in machining.
and martensitic steels, which are magnetic. y These steels cannot be hardened by yq quenching,
g in fact
y Ferritic steels are principally FeCrC
Fe Cr C alloys with 1214%
12 14%
they are softened by rapid cooling from about 1000C.
Cr. And small additions of Mo, V, Nb, Ni.
Contd Contd

IES 2002
IES2002 IES 2008
IES2008 IES 1997
IES1997
p
Thecorrectcompositionofausteniticstainless g p
Considerthefollowingstatementsinrespectof Assertion(A):Austeniticstainlesssteelcontains18%
chromiumand8%nickel.Sinceitretainsitsaustenitic
h i d8% i k l Si it t i it t iti
steelusedfordomesticutensilsis austeniticstainlesssteels: structureatroomtemperature,itiscalledaustenitic
(a) 0.08%C,18%Cr,.8%Ni,2%Mn,1%Si 1. Austeniticstainlesssteelsarehardenedand stainlesssteel.
strengthenedbycoldworking. R
Reason(R):Chromiumpresentinthesteelimprovesits
(R) Ch i i h li i
(b) 0.08%C,24%Cr,12%Ni,2%Mn,1%Si corrosionresistancebyformingathinfilmofchromium
((c)) 0.15%C,12%Cr,0.5%Ni,1%Mn,1%Si
5 , , 5 , , 2. Austeniticstainlesssteelscannotbequenchedand oxideonthesurface.
tempered. (a) BothAandRareindividuallytrueandRisthecorrect
(d) 0.30%C,12%Cr,0.4%Ni,1%Mn,1%Si explanationofA
Whichofthestatementsgivenaboveis/arecorrect?
(b) BothAandRareindividuallytruebutRisnotthe
(a) 1only (b) 2only correctexplanationofA
(c) Both1and2 (d) Neither1nor2 (c) AistruebutRisfalse
(d) AisfalsebutRistrue

For-2015 (IES, GATE & PSUs) Page 211 of 240 Rev.0


IES 2009
IES2009 IES 2009
IES2009 IES 2004
IES2004
g
Whichoneofthefollowingelementsisan g
Whichoneofthefollowingelementsisaferritic MatchListI(Nameofalloy)withListII(Major
alloyingelements)andselectthecorrectanswerusing
ll i l t ) d l tth t i
austeniticstabilizer? stabilizer? thecodesgivenbelowtheLists:
(a) Chromium (a) Nickel ListI ListII
(b) Tungsten (b) Manganese A. Invar 1. Manganese
B. Hadfieldsteel 2. Chromium
((c)) Nickel ((c)) Copper
pp C Stellite
C. 3
3. Nickel
(d) Molybdenum (d) Chromium D. Stainlesssteel 4. Tungsten
5. y
Molybdenum
Codes:A B C D A B C D
(a) 5 1 4 2 (b) 3 2 5 1
(c) 5 2 4 1 (d) 3 1 5 2

IES 2005
IES2005 IES IES 2008
IES2008
MatchListI(AlloyingElement)withListII(Effecton MatchListI(Alloyingelementinsteel)withListII g g
Whichofthefollowingelementsgivenbelow
Steel)andselectthecorrectanswerusingthecodegiven
S l) d l h i h d i (Propertyconferredonsteelbytheelement)and
(P t f d t lb th l t) d
belowtheLists: selectthecorrectanswerusingthecodesgivenbelow determine(s)themaximumattainablehardness
ListI ListII thelists: insteel?
A. Vanadium 1. Increasesendurancestrength Li I
ListI Li II
ListII 1. Chromium 2. Manganese
B. Molybdenum 2. Improvescreepproperties A.Nickel 1. Corrosionresistance
B.Chromium 2. Magneticpermeability
3. Carbon 4. Molybdenum
C Silicon
C. Sili 3. I
Increaseshardness
h d
C.Tungsten 3. Heatresistance electthecorrectanswerusingthecodegivenbelow:
D. Chromium 4. Increasesresistancetohigh
temperatureoxidation D.Silicon 4. Hardenability a) 1only (b) 1and2
Codes:A B C D A B C D Codes:A
d B C D A B C D
(c) 3only (d) 2and4
(a) 2 1 3 4 (b) 1 3 2 4 (a) 4 1 3 2 (b) 4 1 2 3
( ) 2
(c) 1 4 3 (d) 1 2 3 4 (c) 1 4 3 2 (d) 1 4 2 3

IES 2010
IES2010 DESIGNATION OF STEEL (INDIAN
DESIGNATIONOFSTEEL,(INDIAN (b) Based on Chemical Composition: This type of
Consider the following statements: STANDARD) designation is preferred if subsequent heat treatment
Alloying elements are added to y Two systems of notation are recommended by IS : is carried out.
1. Improve hardness and toughness. (a) Based on ultimate tensile strength. 1. Plain Carbon Steels: These are designated by letter
(b) Based on chemical composition. C followed
f ll d by
b a number b representing i the
h average
2. Corrosion and oxidation resistance improvement.
(a) Based on Ultimate Tensile Strength: This is percentage carbon content, for example, C 14 carbon
33. Improve
p machinabilityy and hardenability.
y steel with 0.14%,
0 14% C.
C
applicable
li bl to
t carbon
b and d low
l alloy
ll steels.
t l
4. Increase weight and volume. y The symbol consists of the letter St followed by the y Its new designation is 14 C4. Here, the first figure
Which of the above statements are correct? number representing the ultimate tensile strength in indicates 100 times the average of Carbon content,
content
kgf/mm2 , for example, St 32. The new coding consists then letter C, and the last figure indicates 10 times the
(a) 1, 2 and 3 only (b) 2, 3 and 4 only
of the letter Fe followed by the number representing average
g ppercentage
g of Mn content rounded off to the
( ) 1, 2 and
(c) d 4 only
l (d) 1, 2, 3 and
d4 the
h ultimate
li tensile
il strength
h in
i N/mm2
N/ , for
f example,
l next integer.
Fe 410.
For-2015 (IES, GATE & PSUs) Page 212 of 240 Contd Rev.0 Contd
2. Alloy Steels: Here the letter C is omitted and the
numbers representing the carbon content are followed by
IES 2001
IES2001 IES 1996
IES1996
y
chemical symbols for one or more of the p predominant y g 4 y
Thealloysteeldesignatedas40Cr18Ni2by 18/8stainlesssteelcontains
alloying elements followed by numbers indicating their BureauofIndianStandardscontains (a) 18%stainless,8%chromium.
average contents, for example, 15 Cr 65 chromium steel
with 0.15
0 15%
%,C
C and 0.65%
0 65% Cr.
Cr
(a) 0.4%C,18%Crand2%Ni ((b)) 18%chromium,8%nickel.
,
y 20 Cr 18 Ni 2 Nickel chromium steel with 0.2% C, 18% (b) 4.0%C,1.8%Crand0.2%Ni (c) 18%tungsten,8%nickel.
Cr and 2% Ni. ((c)) 0.4%C,1.8%Crand2%Ni
4 , (d) 18%tungsten,8%chromium.
y The coding of the alloy steels is given below : The average (d) 0.4%C,1.8%Crand0.2%Ni
alloy content upto 1 per cent, Alloy index number will be :
Average alloy content upto two decimal places,
places underlined
by a bar. For average alloy content one per cent and above,
alloy index number will be : rounded to the nearest whole
number upto 0.50 5 rounded down and above
abo e rounded up.
up

Plastics or pol mer


Plasticsorpolymer Properties of plastics
Propertiesofplastics
y Definition: A group of engineered materials g g
y Lightweight
y Goodresistancetocorrosion
characterized by large molecules that are built up by
y Easyoffabricationintocomplexshapes
the joining of smaller molecules.
y Lowelectricalandthermalconductivity
y They are natural or synthetics resins.
resins y Goodsurfacefinish
d f f h
y Goodopticalproperties
p p p
y Goodresistancetoshockandvibration.

IES 2010
IES2010 IES 2010
IES2010 IAS 2007
IAS2007
Consider the following properties for Plasticmaterialisusedforthecomponent Considerthefollowing: g
plastics:
l i whichrequirescharacteristicsof
hi h i h i i f
Whichofthefollowingpropertiesarepossessedby
1. Become hard on heating. (a)Lowdensity,machinability andhighstrength plastics?
2. Increasing plasticity. (b)Machinability,highstrengthandlargeplastic 1. Goodresistancetocorrosiveatmosphere

3 Ability to deform with rise in temperature.


3. temperature deformation 2. Easeoffabricationintocomplexshapes.
p p
(c)Highstrength,largeplasticdeformationand 3. Goodresistancetoshocksandvibrations.
4. Long chain structure.
lowdensity g g
Selectthecorrectanswerusingthecodegivenbelow:
Whi h off these
Which h propertiesi f
for plastics
l i are
(d) Low density, machinability and large plastic (a) 1,2and3 (b) 2and3only
correct?
deformation (c) 1and3only (d) 1and2only
(a) 1, 2, 3 and 4 (b) 3 and 4 only
(c) 1 and 4For-2015
only (IES,
(d) 2,GATE
3 and&4PSUs)
only Page 213 of 240 Rev.0
IES 2008
IES2008 Classification Polymers
Classification Pol mers
p y
Structureofapolymeris: y Classification based on their industrial usage:
(a) Longchain (b) Rhombic (a) plastics and
((c)) Cubic ((d)) Closedpackhexagonal
p g (b) elastomers.
elastomers
y Classification based on their temperature dependence:
((a)) thermoplasts
th l t and
d
(b) thermosets

Thermoplasts Thermoplastics y Fluorocarbons (PTFE


( or TFE,Teflon))
y Plastics which softens up on heating and hardens up y Acrylonitrilebutadienestyrene (ABS): Characteristics: Chemically inert in almost all
environments,
environments excellent electrical properties; low
on cooling where the softening and hardening are Characteristics: Outstanding strength and toughness, coefficient of friction; may be used to 260ooC; relatively
totally reversible processes. resistance to heat distortion; good electrical properties; weak and poor coldflow properties.
y Hence thermoplasts
h l can be
b recycled.
l d flammable and soluble in some organic solvents.
solvents Application:
l Anticorrosive seals,
l chemical
h l pipes and d
Application: Refrigerator lining, lawn and garden valves, bearings, anti adhesive coatings, high temperature
y They consist of linear molecular chains bonded
equipment, toys, highway safety devices. electronic parts.
p
together
h byb weak k secondary
d b d or by
bonds b interwinding.
i i di
y Acrylics (polymethylmethacrylate) PMMA y Polyamides (nylons)
y Crosslinking between molecular chains is absent in Characteristics: Good mechanical strength, abrasion
Characteristics:
C a acte st cs: Outsta
Outstanding
d g lightg t ttransmission
a s ss o aand d
th
theromplasts.
l t resistance,
i and
d toughness;
h l
low coefficient
ffi i off friction;
fi i
resistance to weathering; only fair mechanical properties.
y E.g.: Acrylics, PVC, Nylons, Perspex glass, etc. absorbs water and some other liquids.
Application: Lenses, transparent aircraft enclosures, Application: Bearings, gears, cams, bushings, handles,
drafting equipment, outdoor signs. and jacketing for wires and cables.
Contd Contd

y Polycarbonates y Polypropylene
Characteristics: Dimensionally stable: low water Characteristics: Resistant to heat distortion; excellent
absorption; transparent; very good impact resistance electrical properties and fatigue strength; chemically
and ductility. inert; relatively inexpensive; poor resistance to UV
Application: Safety helmets, lenses light globes, base light.
g
for photographic film Application: Sterilizable bottles, packaging film, TV
y Polyethylene cabinets, luggage
Characteristics: Chemically resistant and electrically y Polystyrene
insulating; tough and relatively low coefficient of Characteristics: Excellent electrical properties and
friction; low strength and poor resistance to optical clarity; good thermal and dimensional stability;
weathering. relatively inexpensive
Application: Flexible bottles, toys, tumblers, battery Application: Wall tile, battery cases, toys, indoor
parts, ice trays, film wrapping materials. lighting panels, appliance housings.
For-2015 (IES, GATE & PSUs) Contd Page 214 of 240 Contd Rev.0
IES 2011
IES2011 IES 2003
IES2003
Windows of aeroplane are made of : Teflonisa
(a) PVC (a) Thermosettingfluorocarbonpolymer
(b) PTFE ((b)) Thermoplasticfluorocarbonpolymer
p p y
(c) PMMA (c) Inorganiccompoundoffluorineandcarbon
((d)) PEEK (d) Laminatedphenolic material

IES 1992
IES1992 IES 2002
IES2002 IAS 2000
IAS2000
y y
Polyamidesarecharacterizedby Considerthefollowingstatements: yp p ( ) ( )
Weldable typeplastic(s)include(s)
Polytetrafluoroethene is
(a) Flexiblechain (a) Thermosets alone
1. Athermoplasticmaterial
((b)) Rigidchain
g 2 Havinghighfrictioncoefficient
2. ((b)) Thermoplasticsalone
p
(c) Amorphousstructure 3. Athermosettingmaterial (c) Boththermosets andthermoplastics
(d) Crystallinestructure 4. Havinglowfrictioncoefficient (d) Neitherthermosets andthermoplast
5. Anelectricinsulator
6. Nonstickingtosurfaces
Whichoftheabovestatementsarecorrect?
(a) 1,2and5 (b) 2,3and6
(c) 3,4and5 (d) 3,2and5

IES 1995
IES1995 Thermosets y Thermosets are strengthened by reinforcements .
p y g
Thestructureofapolymerisshowninthegiven y Plastics which are set under the application of heat y Different reinforcements are in use according to the
and/or pressure. necessity.
it Glass
Gl fibers
fib are mostt commonly l usedd to
t form
f
F F
structural and molding plastic compounds.
figure.Thispolymer
g p y C C y This process is not reversible, hence thermosets can y Two most important types of glass fibers are E (electrical)

F F
not be
b recycled.
l d andd S (high
(h h strength)
h) glasses.
l
y Eglass (limealuminiumborosilicate glass with zero or
y They consist of 3D network structures based on
Findsspecialapplicationin low sodium and p potassium levels)) is often used for
strong covalent
l b d to form
bonds f rigid
i id solids.
lid linear
li continuous fibers.
(a) Packaging (b) Adhesives molecular chains bonded together by weak secondary y Sglass (65%SiO2, 25%Al2O3 and 10% MgO) has higher
(c) Bearings (d) Fertilizer bonds or by interwinding.
interwinding strengthtoweight
strength to weight ratio and is more expansive thus
primary applications include military and aerospace
y Characterized by high modulus / rigidity /dimensional applications.
stability when compared with thermoplasts.
thermoplasts y Carbon fiber reinforced plastics are also often used in
aerospace applications. However they are very expansive.
y E.g.: Epoxies, Amino resins, some polyester resins, etc.
For-2015 (IES, GATE & PSUs) Page 215 of 240 Contd Rev.0 Contd
IES 2011
IES2011 Examples Thermosettingpolymers
Examples Thermo setting polymers
y The other classes of reinforcements include aramid (aromatic
y Epoxies
polyamide) fibers.
fibers
KevlarEpoxycompositeiswidelyusedin:
Characteristics: Excellent combination of mechanical
(a)Automobiles properties and corrosion resistance; dimensionally stable;
y They are popularly known as Kevlar. good adhesion; relatively inexpensive; good electrical
(b)Aerospace
properties.
ti
(c)Navy
Application: Electrical moldings, sinks, adhesives,
( )
(d)InteriorDecoration protective coatings,
p g , used with fiberglass
g laminates.
y Phenolics
Characteristics: Excellent thermal stability to over 150o C;
may beb compounded d d with h a large
l number
b off resins, fillers,
f ll
etc.; inexpensive.
Application: Motor housing
housing, telephones
telephones, auto
distributors, electrical fixtures.
Contd

Chemical Tradename characteristics Typical Phenol Bakelite Gooddimensional Industrialelectrical


classification application formaldehy Marblette Durez stabilityExcellent parts.
y Polyester(PETorPETE) Epoxy Aralditeoxiron Goodtoughness. Adhesiveand de Cataljn insulatingqualities. automotiveelectrical
Characteristics:Oneofthetoughestofplasticfilms;
Ch i i O f h h f l i fil Resistantto;acids.
R i id coatings,tools
i l Inert
I t components, t
alkalies and and tomostsolventsand paperimpregnated
excellentfatigueandtearstrength,andresistanceto solvents. dies,filament weakacids. battery
excellent woundvessels,, g
Goodstrengtharound p
separators.
humidityacids greases oilsandsolvents
humidityacids,greases,oilsandsolvents adhesiontometal, laminatesfor inserts. Electricalinsulation.
Application:Magneticrecordingtapes,clothing, glassandwood. aircraft,patching
compoundfor
automotivetirecords beveragecontainers
automotivetirecords,beveragecontainers. metaland
t l d Phenol
Phenol Durite Similarto Electricalinsulation.
Electricalinsulation
plastics. furfural Phenolfonnaldehyde. Mechanical
parts.Housingsand
Melamineformal Goodfor Tablcware,electric
containers.
dehyde application insulation
insulation,
requiringcycling automotIve Ignition Alkyd Glyptal Duraplex Canbemadeflexible, Boats,Tanks,Trailerand
betweenwetand parts,cutlery (Modified Beckosol Teglac resilientorrigid.Can Tractor
dryconditions. handles,jars and polyester) Rezly resistacidsbutnot components.Ducts,
Hardandabrasion
d d b b l
bowls. alkalies,withglassfibre shrouds.
resistant.Good reinforcementresistssalt Vaultingpoles.
dielectric. waterandfungusgrowth.

IES 1997
IES1997 IES 1992
IES1992 IES
MatchListIwithListIIandselectthecorrectanswer Assertion (A): Linear polymers are rigid at low g
Considerthefollowingstatements:
usingthecodesgivenbelowtheLists: temperatures but soft and mouldable at elevated Fibre ReinforcedPlasticsare
ListI ListII temperatures.
Reason (R): Linear polymers are thermosetting.
thermo setting g g
1. Madeofthermosettingresinsandglassfibre
A. Neoprene 1. Electricswitches
(a) Both A and R are individually true and R is the 2. Madeofthermoplasticresinsandglassfibre
B. Bakelite 2. Adhesive
correct explanation of A 3. Anisotropic
C. Foamedpolyurethane 3. Thermalinsulator
(b) Both A and R are individually true but R is not the 4. isotropic
D. Araldite 4. Oilseal correct explanation of A
Code:A
d B C D A B C D Selectthecorrectanswerusingthecodesgivenbelow:
(c) A is true but R is false
a) 4 1 2 3 (b) 1 4 2 3 (a) 1and4 (b) 1and3
(d) A is false but R is true
c)) 4 1 3 2 (d) 1 4 3 2 (c) 2and3 (d) 2and4

For-2015 (IES, GATE & PSUs) Page 216 of 240 Rev.0


IES 1994
IES1994 IES 2007
IES2007 IES 2006
IES2006
MatchListI(materials)withListII(applications)and MatchListIwithListIIandselectthecorrectanswer y
Phenolformaldehydeisa/an
selectthecorrectanswerusingthecodesgivenbelow
l tth t i th d i b l usingthecodegivenbelowtheLists:
h d b l h
theLists: (a) Thermoplasticpolymer (b) Thermoset polymer
ListI ListII
ListI ListII ((c)) Elastomer ((d)) Rubber
(Material) (Application)
A. Engineeringceramics 1. Bearings
B. Fibre reinforcedplastics 2. Controlrodsin A. Fibre reinforcedplastics 1. Automobiletyres
nuclearreactors B. Acrylics 2. Aircraft
C. Syntheticcarbon 3. Aerospaceindustry C. Phenolics 3. Lenses
D. Boron 4. Electricalinsulator D. Butadienerubber 4. Electricswitchcover
Codes:A
d B C D A B C D Code:A B C D A B C D
(a) 1 2 3 4 (b) 1 4 3 2 (a) 1 4 3 2 (b) 2 3 4 1
(c) 2 3 1 4 (d) 4 3 1 2
( ) 1
(c) 3 4 2 ( ) 2
(d) 4 3 1

IES IES 1999


IES1999 IES
Considerthefollowingstatements: gp p
Considerthefollowingpairsofplasticsandtheir MatchListIwithListIIandselectthecorrectanswer
Thermosettingplasticsare distinctcharacteristics: ListI(Material) ListII(Natureofproduct)
1. Formedbyadditionpolymerisation. 1. Acrylics..............Verygoodtransparencytolight A. Polyethylene 1. Adhesive
2. Formedbycondensationpolymerisation. 2. Polycarbonate..Poorimpactresistance B. Polyurethane 2. Film
3. Softenedonheatingandhardenedoncoolingfor 33. PTFE....Lowcoefficientoffriction. C. Cyanoacrylate 3. Wire
anynumberoftimes
b fti D. Nylon 4. Foam
4. Polypropylene..Excellentfatiguestrength
4. Moulded byheatingandcooling. Codes:A B C D A B C D
Selectthecorrectans erusingthecodesgi enbelo
Selectthecorrectanswerusingthecodesgivenbelow: Whichofthesepairsarecorrectlymatched?
p y
(a) 2 4 3 1 (b) 4 2 3 1
(a) 1and3 (b) 2and4 (a) 2and3 (b) 1and3
(c) 2 4 1 3 (d) 4 2 1 3
(c) 1and4 (d) 2and3 (c) 1and4 (d) 2and4

Polymersynthesis
IAS 2003
IAS2003 Elastomers y Processing of polymers primarily limits to synthesis

g
Considerthefollowingstatements: y These polymers are known for their high elongations, followed by forming.
1. Thermoplasticspossessastrongintermolecular which are reversible upon release of applied loads.
y Polymers are synthesized by process known as
bondingcomparedtothatofthermosettingplastics. y They consist of coillike molecular chains, which
straightens
h up on application
l off load.
l d polymerization.
l i ti
2. Plasticshaveahighcreepundercontinuousloading.
33. Embrittlement occursinplasticsatlowtemperature.
p p y Characterized by low modulus / rigidity / strength, but y Polymerization
y is p
process in which multifunctional
hi h toughness.
high h
Whichofthesestatementsarecorrect? monomers are attached to form linear/3D macro
y E.g.: natural and synthetic rubber.
((a)) 1and2 ((b)) 2and33
molecular
l l chains.
h
(c) 1and3 (d) 1,2and3

For-2015 (IES, GATE & PSUs) Page 217 of 240 Rev.0


AdditionPolymerization AdditionPolymerization
y This polymerization process involves single kind of
monomers. Resultant macromolecules composition is an E.g., d i l i i
CondensationPolymerization
p
exact multiplication p
of composition of individual polyethylene
y It involves more then one monomer species.
species This process
monomer. is also known as step growth polymerization.
y Process involves three stages g namelyy initiation, y In condensation polymerization,
polymerization smaller macromolecule
propagation and termination. byproduct such as water is eliminated.
y Initiation process will be started by an initiator (e.g.
Combination: y No resultant product has the chemical formula of mere
benzoyl peroxide)) which forms an reactive site where
one monomer.
carbon atom of another monomer is attracted, upon which
reaction site transfers to different place leading to y Repeat
p unit in condensation p
process itself is p
product of
molecular chain growth. polymerization involving basic constituents.
y As molecular chain grows longer, reaction rate decreases. y Reaction times for condensation p
polymerization
y is
However the growth process is terminated either by the usually longer than those for additional polymerization.
Disproportionation:
combination or disproportionation process.

C d i P l i i
CondensationPolymerization y Average molecular weight is however defined in
y Polyesters, phenolformaldehyde, nylons,
y Formation of a polyester from Ethylene glycol and Adipic y Weight
two ways. g g molecular weight
average g is
polycarbonates etc are produced by condensation
acid obtained by dividing the chains into size ranges
polymerization.
y Condensation polymerization reactions also occur in and determining the fraction of chains having
solgel processing of ceramic materials. molecular weights within that range.
y Polymers,
y , unlike organic/inorganic
g / g compounds,
p , do y Number average molecular weight is based on
not have a fixed molecular weight. It is specified in the
h number b f
fraction, rather
h than
h the
h weight h
terms of degree of polymerization number of fraction, of the chains within each size range. It is
repeat units in the chain or ratio of average molecular always smaller than the weight average molecular
weight of polymer to molecular weight of repeat unit. weight.

Contd

IES 2001
IES2001 y Cross
C li ki
linking: Th crosslinking
The li ki can occur due
d tot the
th presence
of some elements called vulcanizing agents, e.g. S, Se, Te, and
IES 2003
IES2003
The molecular weightg y chloride is 62.5.
of vinyl 5 O2. ,
Inthecaseofrubber,vulcanizationreferstothe
Thus the molecular weight of a polyvinyl chloride y In case of poly isoprene (natural rubber), the sulphur bridges processofproducinga
are formed between two macromolecules during vulcanization.
with a degree of polymerization of 20000 is y In this vulcanization pprocess sulphur
p bridge
g are formed at the (a) Linearpolymer
point of opening of double bonds. If the number of crosslinks (b) Branchedpolymer
20000 62.5 is small; the find product is soft and flexible. The stiffness of the
(a) (b) 20000 polymeric
p y material increases with the densityy of crosslines. ((c)) Crosslinkedpolymer
p y
62 5
62.5
When the sulphur content in rubber is as high as 32 weight (d) Networkpolymer
percent, the hard product is called ebonite.
(c) 62.5 20000 (d) 20000

For-2015 (IES, GATE & PSUs) Page 218 of 240 Rev.0


IES 2006
IES2006 IES 2000
IES2000 IES 1994
IES1994
Assertion (A) In Addition Polymerization method, y
Assertion(A):Additionpolymerizationisaprimary y g
Whichofthefollowingpairsofplasticsandtheir
polymer
l is
i produced
d d by
b adding
ddi a second d monomer to t summationofindividualmoleculesintolongchains, modesofformationarecorrectlymatched?
the first, then a third monomer to this dimmer and so
on. Reason(R):Inadditionpolymerization,thereaction 1. Polythene..Condensationpolymerization.
R
Reason (R) There
(R): Th must exist
i at least
l one double
d bl bond
b d producesasmallmoleculeasbyproduct.
d ll l l b d 2. Polycarbonate.............Additionpolymerisation.
in the monomer for Addition Polymerization (a) BothAandRareindividuallytrueandRisthecorrect
reaction. 3. Polystyrene...Additionpolymerisation.
explanationofA 4. Polyamide.Eitherbyadditionorby
(a) Both A and R are individually true and R is the correct
explanation of A (b) BothAandRareindividuallytruebutRisnot the condensationpolymerisation.
(b) Both A and R are individually true but R is not the p
correctexplanationofA S l tth
Selectthecorrectanswerusingthecodesgivenbelow:
t i th d i b l
correct explanation of A (c) AistruebutRisfalse
(c) A is true but R is false (a) 1and2 (b) 2and4
((d)) AisfalsebutRistrue (c) 1and4 (d) 3and4
(d) A is false but R is true

IES 2008
IES2008 IES 2003
IES2003 Additi es to Pol mers
AdditivestoPolymers
What is the p process by y which two or more y
Polyesterscanbedefinedasthecondensation y The properties of polymers can be further modified by
chemically different monomers are polymerised productsof
to form a cross link polymer together with a by the addition of agents which are basically of two types.
(a) Dicarboxylic acidswithdihydroxy alcohols
product
d such
h as water or ammonia,
i known
k as? (b) BisphenolAandepichlorohydrin y Those that enter the molecular structure are usually
(a) Addition polymerization ((c)) Phenolandformaldehyde
y called "additives"
additives , whereas those that form a clearly
(b) Copolymerisation (d) Benzeneandtoluene
(c) Linear polymerisation defined second phase are called "fillers".
(d) Condensation polymerization

Contd

1 Plastici ers
1.Plasticizers 2 Fillers
2.Fillers 3. Catalysts:
y A filler is used to economize on the quantity of polymer
y These are usually added to promote faster and more
y Plasticizers are liquids of high boiling point and low required and/or to vary the properties to some extent,extent for
example, mechanical strength, electrical resistance etc.
complete
l polymerization
l i i andd as suchh they
h are alsol
molecular weight, which are added to improve the called 'accelerators' and 'hardeners' e.g., ester is used
y A filler, whose function is to increase mechanical strength, is as a catalyst for Urea Formaldehyde.
plastic behaviour of the polymer. termed a "reinforcing filler".
4. Initiators:
y A filler is commonly fibrous in nature and is chemically inert
y They are essentially oily in nature.
nature Organic solvents,
solvents with respect to the polymer with which it is to be used.
used y As the name indicates,, the initiators are used to
y Common fillers are wood flour, cellulose, cotton flock, and initiate the reaction, that is, to allow polymerization to
resins and even water are used as plasticizers. paper (for improving mechanical strength); mica and asbestos begin. They stabilize the ends of the reaction sites of
(for heat resistance); talc (for acid resistance).Other filler the molecular chains.
chains H2O2 is a common initiator.
initiator
materials are : fabric, chippedwood moulding compound, 5. Dyes and Pigments:
wood veneer,, textile or g
glass fibres. y These are added,
added in many cases,
cases to impart a desired
y The commonly used "reinforcing filler agents" with plastics are : colour to the material.
fibres/filaments of glass, graphite or boron.
For-2015 (IES, GATE & PSUs) Page 219 of 240 Rev.0
6. Lubricants: 8 Solvents:
8.
y Solvents are useful for dissolving certain fillers or
IES 1992
IES1992
y Lubricants are added to the polymers for the following
purposes : to reduce friction during processing,
processing to prevent p
plasticizers and help p in manufacturing g byy allowing
g p
Fillersareaddedtoplasticsto
parts from sticking to mould walls, to prevent polymer processing in the fluid state, For example, alcohol is (a) Improveflow
films from sticking to each other and to impart an elegant added in cellulose nitrate plastics to dissolve Camphor.
fi i h to
finish t the
th final
fi l product.
d t Commonly
C l usedd lubricants
l bi t H
However, subsequently,
b tl the
th solvents
l t mustt be
b removed d ((b)) Reducebrittleness
include : oils, soaps and waxes. by evaporation. (c) Facilitateprocessability
77. Flame retardants: 9. Stabilisers and anti
antioxidants
oxidants are added to retard (d) Reducecost
y Most plastics will ignite at sufficiently high temperatures. the degradation of polymers due to heat, light and
The noninflammability of the plastics can be enhanced oxidation.
either by producing them from less inflammable raw 10. Elastomers are added to plastics to enhance their
materials or by adding "flame retardants". The common
flame retardants are : compounds of chlorine, bromine and
elastic properties.
phosphorous.
h h N t Above,
Note: Ab excepting
ti fillers,
fill all
ll other
th materials
t i l used,
d
fall under the category of "Additives.

IAS 2007
IAS2007 IAS 1998
IAS1998 IAS 1994
IAS1994
MatchListIwithListIIandselectthecorrectanswerusing MatchList I(Nameofmoulding compositiontoprepareplastics)
p
To reduce the consumption y
of synthetic resins,,
thecodegivenbelowtheLists: withList II(Propertyofmoulding composition)andselectthecorrect
withListII(Propertyofmoulding
answerusingthecodesgivenbelowthelists: the ingredient added is
ListI ListII List I List II
(AdditiveforPolymers) (Purpose) A. Binder 1. Reducecost,shrinkage (a) Accelerator
A. Plasticizer 1. Allowspolymerization B. Filler 2. Makethemoulding ofplasticeasier
tobegin C. Plasticizer 3. Cellulosederivatives (b) Elastomer
B. Filler 2. Colours thematerial D. Lubricant 4. Acceleratecondensationand ((c)) Modifier
polymerization
C. Initiator 3. Actsasinternal
lubricants
5. Toughnessandresistanceto (d) Filler
temperature.
4.
4 Improvesstrength
p g
Code:A B C A B C Codes: A B C D A B C D
(a) 1 4 3 (b) 3 2 1 (a) 3 1 2 5 (b) 3 1 5 2
(c) 1 2 3 (d) 3 4 1 ( )
(c) 5 3 1 4 (d) 3 5 l 4

Plastic Process
PlasticProcess Injection Mo lding
InjectionMoulding
y The common forms of raw materials for processing y The polymer is melted and than forced into a mould.
plastics into products are : pellets, granules, powders, y Thermoplastic pellets melted and melt injected under
sheet, plate, rod and tubing. high pressure (70 MPa) into a mold. Molten plastic
y Liquidd plastics
l are usedd especially
ll in the
h fabrication
f b off takes the shape of the mold,
mold cools,
cools solidifies,
solidifies shrinks
and is ejected.
reinforced plastic parts.
y Molds usuallyy made in two p
parts ((internal and external
y Thermoplastics
Th l i can be b processed d to their
h i final
fi l shape
h part).
by moulding and extrusion processes. y Use of injection molding machine mainly used for
y However,
H extruding
t di i often
is ft used d as an intermediate
i t di t thermoplastics
h l i (gears,
( cams, pistons,
i rollers,
ll valves,
l
process to be followed by other processes, for example, fan blades, rotors, washing machine agitators, knobs,
vacuum forming or machining.
machining handles, camera cases, battery cases, sports helmets Fig.Injectionmoulding
etc)
For-2015 (IES, GATE & PSUs) Page 220 of 240 Contd Rev.0
E tr sion
Extrusion y The process is continuous and provides a cheap and Compression mo lding
Compressionmoulding
y Long plastic products with uniform cross sections are rapid method of moulding. y A compression mould is made of two halves with one
readily
dil produced
d d byb the
th extrusion
t i process. each
h being
b i connected
d to the
h platens
l off the
h press.
y Common production shapes include a wide variety of
y Thermoplastic pellets & powders are fed through a hopper y The mould is electrically heated to maintain the
into the barrel chamber of a screw extruder. A rotating g
solid forms, as well as tubes, pipes, and even coated
wires
i and d cables.
bl required temperature.
temperature
screw propels the material through a preheating section,
where it is heated, homogenized, and compressed, and y Material is placed in the mould, and it is closed with a
then forces it through a heated die and onto a conveyor hydraulic
y cylinder,
y , or toggle
gg clamp.
p
belt. y The pressure maintained on the material is of the
y As the plastic passes onto the belt, it is cooled by jets of air order of 14 to 40 MPa of moulding area.
or sprays off water which
h h harden
h d it sufficiently
ff l to preserve y As the material comes in contact with the heated
its newly imparted shape. mould surface, it softens and fills the entire cavity and
y It continues to cool as it passes along the belt and is then at the same time initiates the chemical reaction which
either cut into lengths or coiled. cures the part.
Fig.Extrusion
Contd Contd

y Cure
C i
time i determined
is d i d by
b the
h thickest
hi k i
cross section, Transfer Mo lding
TransferMoulding
mould temperature, material type and grade.
y Transfer moulding is very similar to compression
y After
Aft curing,
i the
th mouldld opens and d the
th partt is
i ejected.
j t d moulding and is developed to avoid the disadvantages
y The most widely used plastic is phenol formaldehyde, found in that process.
commonly known as 'Bakelite
Bakelite. y In this
h method,h d thermosetting
h charge
h is heated
h d and
d
compressed in a separate chamber and then injected
into the closed mould where it is allowed to cool and
solidify.
y Transfer moulding is capable of moulding part shapes
that are more intricate than compression moulding
but not as intricate as injection
j moulding.
g

Contd

Blo mo lding
Blowmoulding
y Blow moulding is the process of inflating a hot,
hot hollow,
hollow
thermoplastic preform or parison inside a closed mould so
that its shape conforms to that of the mould cavity.
y Typical parts made are bottles, toys, air ducts of automobiles,
chemical and gasoline tanks, and a number of housholds
goods.
d

For-2015 (IES, GATE & PSUs) Page 221 of 240 Contd Rev.0
IES 2005
IES2005 Thermoforming
y In this process, a thermoplastic sheet can be formed into a
p p y
Thermoplasticmaterialscannotbeproducedby: three
three dimensional shape by the application of heat and
(a) Injectionmoulding process differential pressures.
y First, the plastic sheet is clamped to a frame and uniformly
((b)) Extrusionprocess
p heated to make it soft and flowable.
flowable
(c) Blowmoulding process y Then a differential pressure (either vacuum or pressure or
(d) Both(a)and(b)above both) is applied to make the sheet conform to the shape of
a mould ld or die
di positioned
ii d below
b l the h frame.
f
y It is possible to use most of the thermoplastic materials.
The starting g material is a p plastic sheet of uniform
thickness.
y It is a relatively simple process and is used for making such
parts as covers,, displays,
p p y , blister p
packaging,
g g, trays,
y , drinking
g
cups and food packaging.
Contd Contd

IES 2004
IES2004 IES 2009
IES2009
MatchListI(Typeofmoulding)ListII(Mechanisminvolved)and MatchListIwithListIIandselectthecorrectanswer
selectthecollectanswerusingthecodesgivenbelowtheLists: usingthecodegivenbelowtheLists:
ListI ListII
ListI ListII
A. Compressionmoulding 1. Mouldcavitymustbeheated
tocuretheplasticforced (Article) (ProcessingMethod)
i i
intoit. A. Disposablecoffeecups 1. Rotomoulding
B. Injectedmoulding 2. SimilartoHydraulic
extrusion B. Largewatertanks2. Expandablebead
C
C. Jetmoulding 3
3. Analogoustothehot moulding
pressingofpoweredmetals C. Plasticsheets 3. Thermoforming
D. Extrusionmoulding 4. Analogoustodiecastingof D. Cushionpads 4. Blowmoulding
metals
A B C D A B C D 5
5. Calendering
(a) 2 4 1 3 (b) 3 1 4 2 Code: A B C D A B C D
(c) 2 1 4 3 (d) 3 4 1 2 (a) 3 5 1 2 (b) 4 5 1 2
( ) 4
(c) 3 2 1 (d) 3 1 5 2

IAS 1999
IAS1999 IAS 2007
IAS2007 IAS 2004
IAS2004
g p
Whichoneofthefollowingaretheprocessesfor Whichoneofthefollowingstatementsisnot Whichofthefollowingarethecharacteristicsofthe
thermosettingmaterials? correct? injectionmoulding
ld ofplastics?
f l
(a) Ininjectiondiemoulding,exactamountof 1. Itisthemosteconomicalmethodofmassproducinga
1. Compression singleitem
materialtofillthecylinderisdelivered
2. Transfermoulding 2. Inmostcasesfinishedproductsareobtained
(b) Injectiondiemoulding isgenerallylimitedto
33. Injectionmoulding
j g formingthermoplasticmaterial
4. Extrusion 3. Thereislotofwasteofthermoplasticsincethe
(c) Thermosettingplasticsaremoresuitablefor runnersandsprues cannotbereused.
g g
Selectthecorrectanswerusingthecodesgivenbelow: extrusionmoulding
Selectthecorrectanswerbyusingthefollowingcodes:
(a) 1and4 (b) 1and2 (d) Extrusionmoulding processisusedforgiving (a) 1and2 (b) 2and3
shapes,suchasrods,tubes,pipes,ropesetc.
(c) 2and3 (d) 2,3and4 (c) 1and3 (d) 1,2and3

For-2015 (IES, GATE & PSUs) Page 222 of 240 Rev.0


IAS 2003
IAS2003 IAS 1997
IAS1997 IES 2002
IES2002
g
Considerthefollowingstatementsinrespectof Whichofthefollowingprocessescanbeusedfor g
Whichofthefollowingarefabricatedusing g
fabricationofplasticproducts: massproductionofplasticcontainers(withlid)of engineeringplastics?
1. Compressionmoulding isanalogoustohotpressingof 5litercapacity?
1. Surfaceplate
powderedmetals.
d d l 1 Injectionmoulding
1.
2. Gears
2. Jetmoulding isamodificationofcompressionmoulding. 2. Joltmoulding
3 Blowmoulding
3. 33. Guidewaysformachinetools
y
3. Injectionmoulding
I j ti ldi isanalogoustodiecastingofmetals
i l t di ti f t l
Selectthecorrectanswerusingthecodesgivenbelow: 4. Foundrypatterns
4. Transfermoulding issimilartohydraulicextrusion.
Whi h fth t t
Whichofthesestatementsarecorrect?
t t? Codes: g g
Selectthecorrectanswerusingthecodesgivenbelow:
(a) 1and2 (b) 1and3 (a) 1and2 (b) 2and3 (a) 1,2and3 (b) 1
(c) 1,2and4
1 2and4 (d) 2,3and4
2 3and4 (c) 1and3 (d) 1,2and3 (c) 2,3and4 (d) 1,2,3and4

IES 2004
IES2004 IES 2011
IES2011
MatchListI(Material)withListII(Typicaluse)and Assertion (A) : The plastic organic materials
thecorrectanswerusingthecodesgivenbelowthe
h h d b l h can be b easily
il shaped
h d or moulded
ld d by
b mechanical
h i l
Lists: action.
ListI ListII Reason (R): It is widely in use as it can be
A. Branchedpolyethylene 1. Bottles permanently moulded.
B. Polyester
y 2. Textilefibres ((a)) Both A and R are individuallyy true and R is the
C. Polyvinylidene chloride 3. Filmsforpackaging correct explanation of A
D. LinearPolyethylene 4. Transparentfilm (b) Both A and R are individually true but R is NOT
A B C D A B C D the
h correct explanation
l i off A
(a) 2 3 4 1 (b) 3 2 1 4 (c) A is true but R is false
( ) 2
(c) 3 1 4 (d) 3 2 4 1 (d) A is
i false
f l but
b t R is
i true
t

El t
Elastomers y When a force is applied, the polymer stretches by y The elasticity or rigidity of the product can be determined
y Elastomers are a special class, of linear polymers that uncoiling. When the load is removed, the molecules recoil by controlling the number of crosslinks within the
display an exceptionally large amount of elastic and the material returns to its original size and shape.
shape material.
t i l
deformation when a force is applied. y The relationship between force and stretch does not, y Small amounts of crosslinking leave the elastomer soft
however,, follow Hooke's Law. and flexible,
flexible as in a rubber band.
band
y Many can be stretched to several times their original
y In reality, the behaviour of elastomers is a bit more
length. Upon release of the force, the deformation can y Additional crosslinking restricts some of the uncoiling,
complex. While the chains indeed uncoil when placed
be completely
p y recovered,, as the material q quicklyy under load,
load they also tend to slide over one another to and the material becomes harder,, stiffer,, and more brittle,,
returns to its original shape. In addition, the cycle can produce a small degree of viscous deformation. When the like the rubber used in bowling balls.
be repeated numerous times with identical results, as load is removed, the molecules recoil, but the viscous y If placed under constant strain, however, even highly cross
with the stretching of a rubber band.
band d f
deformation
i i not recovered
is d andd the
h elastomer
l retains
i linked material will exhibit some viscous flow over time.
y In the elastomeric polymers, the linear chaintype some permanent change in shape. This phenomenon is known as stress relaxation.
molecules
o ecu es aaree ttwisted
sted o
or cu
curled,
ed, much
uc likee a cocoil y By cross
crosslinking
linking the coiled molecules, however, it is y The rate of this relaxation depends on the material,
material the
spring. possible to restrict the viscous deformation while retaining force, and the temperature.
the large elastic response.
For-2015 (IES, GATE & PSUs) Contd Page 223 of 240 Contd Rev.0
IES 2011
IES2011 R bb
Rubber y Natural rubber compounds are outstanding for their
During tensile testing it has been observed that for y Natural rubber, the oldest commercial elastomer, is made y g
flexibility, good electrical insulation, low internal
some material the deformation is fully recoverable from
f the
h processedd sap off a tropicall tree. friction, and resistance to most inorganic acids, salts,
and timeindependent, but does not obey Hooks y It could be vulcanized (crosslinked) by the addition of and alkalies.
l
law. Th material
The t i l is
i : about 30% sulphur followed by heating to a suitable
temperature. The crosslinking restricts the movement of y However, they have poor resistance to petroleum
(a) Elastomer the molecular chains and imparts strength. products, such as oil, gasoline, and naphtha.
(b) Rubber
R bb y Properties
P i couldld be
b further
f h improved
i d by
b various
i additives
ddi i y In addition,
dd they
h l
lose their
h strength
h at elevated
l d
(c) Polymer (e.g., carbon black) which act as stiffeners, tougheners, and temperatures, so it is advisable that they not be used at
antioxidants.
(d) Aluminium
l alloy
ll temperatures above 175
175F
F (80
(80C)
C).
y Accelerators have been found that speed up the
vulcanization process. These have enabled a reduction in y They also deteriorate fairly rapidly in direct sunlight
the amount of sulfur such that most rubber compounds unless specially compounded.
compounded
now contain less than 3% sulphur.
Contd Contd

Differenttypesofrubber Applications

y Rubber and similar synthetic materials such as


Naturalrubber Tires,gaskets,hose IES 2008
IES2008
Polyacrylate Oilhose, Orings
p
Neoprene have a varietyy of application
pp y
in machinery. EDPM(ethylenepropylene) Electricinsulation,footwear,hose,belts Whichmaterialisusedforbushesinthebushed
y Rubber should be protected from high temperature, Chlorosulfonated polyethylene Tanklining,chemicalhose,polyethyleneshoe, pintypeofflexiblecoupling?
solesandheels
oil and sunlight.
g Polychloroprene (neoprene) Wireinsulation,belts,hose,(neoprene)gaskets,
Wireinsulation belts hose (neoprene)gaskets
(a) Gunmetal (b) Plastic
seals,linings (c) Rubber (d) Aluminium
y It is an excellent material for seats and diaphragms, for
Polybutadiene Tires,solesandheels,gaskets,seals
water lubricated bearings, for parts subjected to Polyisoprene Sameasnaturalrubber
vibrations (such as vibration mountings, flexible Polysulfide Seals,gaskets,diaphragms,valvedisks
couplings and flexible bearing) and for tubes and SBR(styrenebutadiene) Mouldedmechanicalgoods,disposable
pharmaceuticalitems tyres
pharmaceuticalitems,tyres
hose.
Silicone Electricinsulation,seals,gaskets,Orings
y In industry, hard rubber is used for electric insulation, Epichlorohydrin Diaphragms,seals,mouldedgoods,low
switch
it h handles,
h dl bearings,
b i etc.
t ttemperatureparts
t t
Urethane Casterwheels,heels,foampadding
Contd Fluoroelastomers Orings,seals,gaskets,rollcoverings

IES 1997
IES1997 C i
Ceramic y Most have crystalline structures, but unlike metals, the
Which one of the following g materials is used for y Ceramic materials are compounds of metallic and bonding g electrons are g g ionic
generally captive in strong
car tyres as a standard material? nonmetallic elements (often in the form of oxides, or covalent bonds. The absence of free electrons makes
carbides, and nitrides) and exist in a wide variety of the ceramic materials poor electrical conductors and
(a) Styrenebutadiene rubber (SBR) compositions and forms.
forms results
l ini many being
b i transparent in i thin
hi sections.
i
(b) Butyl rubber y The American Ceramic Society has defined ceramic
y Because of the strength of the primary bonds, most
((c)) Nitrile rubber products as those manufactured" byy the action of heat
p
on raw materials, most of which are of an earthy ceramicsi have
h hi h melting
high lti temperatures.
t t
(d) Any of the above depending upon the need
nature (as distinct from metallic, organic etc.) while of y Ceramic articles of industry are : Dinner ware,
the constituents of these raw materials,
materials the chemical electrical and chemical porcelain,
porcelain refractory bricks and
element silicon, together with its oxide and the tiles, glass, porcelain enamels, abrasives, cutting tools,
compounds thereof (the silicates), occupies a bricks and tiles, cements and concretes, whitewares,
predominant position." mineral Ores, slags and fluxes and insulators etc.
For-2015 (IES, GATE & PSUs) Page 224 of 240 Contd Rev.0 Contd
y Ceramics can be natural or manufactured: P ti fC i
PropertiesofCeramics y Ingeneral,ceramicsarehard,brittleandhigh
meltingpointmaterialswith:
y Natural Ceramics : The most frequently
q y used, y The covalent bonding
g of ceramic materials,, alongwith
g
y desirableelectrical,magneticandoptical
desirableelectrical magneticandoptical
naturally occuring Ceramics we : Silica (SiO), Silicates their high melting point and relative resistance to properties,i.e.,lowelectricalandthermal
and Clay minerals. oxidation, make ceramics good candidates for high conductivity.
y Manufactured Ceramics : Such ceramics include : temperature applications.
li i y goodchemicalandthermalstability,thatis,high
SiC, Al2O3, Silicon Nitride (Si3N4) and many varieties y In addition, they are relatively cheap and abundant hotstrengthandhighcorrosionresistance,and
off Oxides,
O id C bid
Carbides, Nit id
Nitrides, B id
Borides andd more andd are nott dependent
d d t on import
i t for
f supply.l freedomfromoxidation.
complex ceramics. y goodcreepresistance,and
y Many ceramics retain strength to much higher
y Highcompressivestrengthandexcellent
g p g
temperatures than metals.
metals resistancetowear.
y There being virtual absence of ductility in ceramics, so, y Theirlowdensityisalsoanattractivefeatureto
in general,
general they can not be machined or built up from minimisecentrifugalstressesinpartsrotatingat
stock. highspeed.
Contd

IES 2008
IES2008 IES 2002
IES2002 P i fC i
ProcessingofCeramics
Considerthefollowingstatementsrelatingto g
Whichoneofthefollowingistrue?
mechanicalpropertiesofceramics:
h l f The processing of ceramics,
ceramics except glass,
glass follows the
(a) Structureofmetallicmaterialsconsistsofatoms
1. Tensilestrengthistheoreticallyhighbutinpractice Powder Metallurgy route, that is, consists of the
quitelow.
quitelow havingvalenceof5,6or7
2. Compressivestrengthismanytimeslowerthantensile (b) Ceramicmaterialshavelongrangeelectronmatrix following steps :
strength. bond
3. Shearstrengthishigh. 1 Preparation of powders
1.
(c) Polymersarecomposedoflongchainofrepeating
4. Transversestrengthiseasytoascertain. molecules 2. Mixing and Blending of powders
Whi h f h
Whichofthestatementsgivenabovearecorrect?
i b ? (d) Ceramicsareweakerthanmetalsbecauseofweak
(a) 1and3 (b) 1and4 electrostaticbond 3. Compacting of powders
(c) 2and3 (d) 2and4
4. Firing or Sintering.

M hi i fC i
MachiningofCeramics PRODUCT APPLICATIONS
PRODUCTAPPLICATIONS 2 R f t i
2.Refractories
1. Clayy pproducts : Clayy bodyy ceramics include y Refractory ceramics are the materials which are capable of
y Mostceramicsaresinteredtotheirfinish withstanding
ith t di highhi h temperature
t t in
i various
i situations.
it ti The
Th
whitewares and stoneware. refractory materials are of three types.
dimensions. y Whitewares includes such families of products as y Acidic refractories are based on aluminasilica
earthenwares, China and porcelain. composition,
ii varying
i f
from pure silica
ili to nearlyl pure
alumina, through a wide range of alumina silicates.
y However,sometimes,theyaremachinedtogetbetter y Whitewares are largely used as tile, sanitary ware, low y The basic constituent of basic refractories is magnesia,
g ,
dimensionalaccuracyandsurfacefinish. and high voltage insulators, and high frequency MgO. Basic refractories include chromemagnesite,
applications. dolomite, limestone and magnesite.
y MachiningofceramicscanbedonewithDiamond y Neutral refractories include substances which do not
y Stoneware applications
l are : Glazed
l d pipes, roofing
f tiles
l combine with either acidic or basic oxides. With increasing
abrasives,LBM,EBMandCHM. and tableware. alumina content, silicaalumina refractories may gradually
g from an acidic to neutral type.
change yp A typical
yp neutral
character is exhibited by such refractories as Carbon,
graphite, carbide, chromite, bauxite and forsterite.
For-2015 (IES, GATE & PSUs) Page 225 of 240 Rev.0 Contd
y Refractories are used in the construction or lining of
C bid f t
Carbiderefractory y Nitrides have only slightly lower melting points than carbides.
y Carbides have the highest melting point of all the y Cubic boron nitride, CBN, is the hardest material after diamond
furnaces,
furnaces boilers,
boilers flues,
flues regenerators,
regenerators convertors,
convertors substances.
b t and is used as cutting tool material.
material Silicon nitride,
nitride Si3N4,
Si3N4 is
used for ceramic engine components, turbine disks and rocket
y Silicon carbide, SiC, is difficult to sinter, but pressure
crucibles, dryers, pyrometer tubes and in many others, sintered or reactive sintered solid bodies of SiC are used as nozzles.
hi h
hightemperature resistanceheating
i h i elements,
l rocket
k y Sialon (Si Al O N), N) that is oxynitrides,
o nitrides have
ha e better
primarly to withstand the high temperature. oxidation resistance and is used for cutting tools and welding
Al2O3 nozzels and sand blast nozzles.
y Ceramics such as UO2,, UC and UC,, are used in nuclear pins.
y The most widely used oxide refractory ceramic is
applications as fuel elements, fuel containers, moderators, y Borides
d (of
( f Chromium,
h Zirconium and d Titanium)) are usedd as
alumina . It is sintered into cutting tool bits, control rods and structural parts. turbine blades, Rocket nozzles and Combustion chamber
y Boron carbide, B4C, is extremely hard and is used as a liners.
spark
k plug
l insulators,
l h h temperature tubes,
high b melting
l grinding grit. y Cermet is a composition of ceramic and metal. This material
y Other carbides (Tungsten Carbide, Tantalum Carbide and shows better thermal shock resistance than ceramics, but at the
crucibles, wear components and substrates for Titanium carbide) are used in the sintered form as cutting same time retains their high
g refractoriness.
electronic circuits and resistors. tool materials. y It is used as cutting tool material, as crucibles and as jet engine
Contd
nozzles.

3 Electrical and Magnetic


3.ElectricalandMagnetic 4 O ti l A li ti
4.OpticalApplications 5 Ph h
5.Phosphorescence
Applications y Ceramics are notably
y useful as a p g , because it is
pigment, y Ceramic p p
phosphors g of a characteristic wave
emit light
y Ceramics find wide applications in electrical and exceptionally durable. It is completely oxidised and not length when excited or pumped by some appropriate
electronic industries. subject to chemical attack and variation. energy source (an electric discharge or electron beam).
y As
A i
insulators,
l semiconductors,
i d di l
dielectrics,
i y Yttralox (a new ceramic material) is useful in optical y Light tubes, VDT's and colour T.V. rely on this
ferroelectrics, piezoelectric crystals. appIications, becuase it is as transparent as window phenomenon.
y Ceramics such as glass,
glass porcelain,
porcelain alumina,
alumina quartz and glass
l and
d can resist
i t very high
hi h temperature.
t t Ytt l is
Yttralox i y Of increasing interest are Laser materials, The most
mica, are getting heavy demands. completely free from pores. widely used Laser is ruby (an Al2O3 , crystal doped with
y Ceramics,, such as SiC,, are used as resistors and
y Generally,
Generall Ceramics are opaque, opaque because of the Cr ions).
ions)
heating elements for furnaces.
presence of tiny pores within them that scatter light. y They are being used for machining, welding and
y Ceramics, having semiconducting properties, are used
f thermistors
for h i andd rectifiers.
ifi B i
Barium titantate,
i f
for cutting etc.
etc
example, is used in capacitors and transducers.

IES 2002
IES2002 Gl
Glass y Vitreous materials or inorganic glasses are the fusion
MatchListIwithListIIandselectthecorrectanswer: y Glasses are,, by
y definition,, "Ceramics" because the products which during solidification from a liquid state
failed to crystallise.
crystallise
ListI(Material) ListII(Application) starting materials needed to produce glass are typical
y During the cooling process, the glasses exhibit no
A. Ceramics 1. Constructionof of ceramic materials. However, they are produced by discontinuous change g at anyy temperature
p and onlyy a
chemicalplants the
h melt l processing
i route, instead
i d off the
h powderd progressive increase in viscosity is noticed. In fact, glass is a
B. Refractory 2. Columnsandpillars metallurgy route used for other ceramics. hard liquid.
C. Stones 3. Liningoffurnaces y In
I ceramic i science,
i th word
the d "glass"
" l " signifies
i ifi any y Glass Forming Constituents : Silica,Silica which is obtained
amorphous component of ceramic mixture. from highpurity silica sand is the most widely used glass
D. Highsilicaglass 4. Tiles forming constituent.
Codes:A
d B C D A B C D y However,
Ho e er in general terms,
terms glass is a transparent silica y Other glass forming constituents are the oxides of boron,
(a) 4 3 2 1 (b) 2 1 4 3 product which may be amorphous or crystalline, vanadium, germanium and phosphorous. Some other
( ) 4
(c) 1 2 3 (d) 2 3 4 1
depending on heat treatment.
treatment elements and compounds such as tellurium, selenium and
BeF2 can also form glasses.
y Glasses may be either inorganic or organic.
For-2015 (IES, GATE & PSUs) Page 226 of 240 Contd Rev.0 Contd
y Along with oxides, fluxes are also added to the charge IES 2011
IES2011 IES 2008
IES2008
for a g
glass. Fluxes lower the fusion temperature of the Structure of common glass is g
Whichoneofthefollowingiscorrect?
glass and render the molten glass workable at (a) Amorphous When"devitrification"ofinorganicglassesisdone,
reasonable temperature. (b) Partially crystalline ((a)) Glasstransformsfromcrystallinetonon
y
y However, fluxes may reduce the resistance of glass to (c) Fully crystalline crystallinestate
chemical attack, render it water soluble or make it
((d)) None of the above ((b)) Glasstransformsintoafullytransparentmaterial
y p
subject
bj t tot partial
ti l or complete
l t devitrification
d it ifi ti (th t is,
(that i
crystallisation) uponcooling; Such a glass is (c) Glasstransformsfromnoncrystallinestateto
undesirable since the crystalline are extremely weak polycrystallinestate
and brittle. (d) Glassisrelievedofinternalstresses
y Stabilizers are therefore, added to the glass batch to
overcome these problems.

C it
Composites IES 2011
IES2011 IES 2009
IES2009
What are composites? Assertion (A) : A composite is a multiphase p g yp
Nano compositematerialsarehighlypreferablein
y Composites are the multiphase materials, which can be material
t i l which
hi h is
i artificially
tifi i ll made
d as one thatth t
occurs naturally. designconsiderationfortheir
defined as any multiphase material that is artificially made
and exhibits a significant proportion of the properties of Reason ((R): ) Technology gy of modern ageg requires
q a (a) Highresistancetocrackpropagation
the
h constituent
i phases.
h material with unusual combination of properties (b) Vibrationresistance
y The constituent phases of a composite are usually of macro that cannot be met by metal or alloys.
sized p
portions,, differ in form and chemical composition
p ((c)) Impactresistance
p
and essentially insoluble in each other. (a) Both A and R are individually true and R is the
correct explanation of A (d) Highresilience
Why do we need composites?
y Composites are the class of materials with special ((b)) Both A and R are individuallyy true but R is NOT the
properties. correct explanation of A
y Propertiesofthecompositecanbetailoredtomeetthe (c) A is true but R is false
requiredpurposesuchassuperiorpropertieslikehigher (d) A is
i false
f l but
b R isi true
strengthtoweightratio,highmodulusandhigh
temperaturestabilityalongwithgooddampingability.

TYPES OF COMPOSITE MATERIALS


TYPESOFCOMPOSITEMATERIALS y The
Th matrix
i material
i l should
h ld be
b : ductile
d il with
i h its
i A l t dM t i l
AgglomeratedMaterials
modulus of elasticity much lower than that of the
y Composite materials may roughly be classified as : y Agglomerated materials or particulate composites
dispersed phase.
phase Also,
Also the bonding forces between the consist of discrete particles of one material,
1. Agglomerated materials or Particulate Composites two phases must be very strong.
2. Reinforced materials surrounded by a matrix of another material. The
y Depending upon the nature of the reinforcing materials are bonded together into an integrated mass.
mass
3. Laminates materials (shape and size), the reinforced composites y Two classic examples of such a composite material are :
4. SurfaceCoated materials. can be classified as: Concrete formed byy mixing gg
gravel,, sand,, cement and
y The particulate composites and reinforced composites 1. Particle reinforced composites or particulate water and agglomeration of asphalt and stone
are constituted by just two phases, the matrix phase particles, that is used for paving the highway surfaces.
and the dispersed phase.
phase reinforced composites.
Other examples of particulate composite materials
y The matrix phase is continuous and surrounds the 2. Fibre reinforced composites. include :
dispersed
p phase. The aim is to improve
p p the strength
g y In p particle reinforced composites,
p , the dispersed
p phase
p 1.. GGrinding
d g aand d cutt
cutting
g wheels,
ee s, in whichc ab
abrasive
as e
properties of the matrix material. is in the form of exiaxed particles, whereas in fibre particles ( Al2O3 , SiC, CBN or diamond) are held
reinforced composites, together by a vitreous or a resin bond.
For-2015 (IES, GATE & PSUs) Contd Pageit227
is inofthe
240form of fibres. Contd Rev.0 Contd
C
2. Cemented d carbides,
bid i which
in hi h particles
i l off ceramic i IES 2009
IES2009 Reinforced Materials
ReinforcedMaterials
materials, such as WC, TaC, TiC and of Cobalt and nickle, y Reinforced materials form the biggest and most
are bonded together via Powder Metallurgy process, to g p
Whichofthefollowingcompositesare
produce
d cutting
i tooll materials.
i l Cobalt
C b l acts as the
h binder
bi d for
f important group of composite materials.
materials
ceramic particles. During sintering, the binder melts and dispersionstrengthenedcomposites?
y The purpose of reinforcing is always to improve the
forms a continuous matrix between the ceramic particles. ((a)) Particulatecomposites
p
Thi method
This th d is
i called
ll d as "Vitreous
"Vit sintering",
i t i " thatth t is,
i strength properties.
properties
sintering with the formation of liquid phase. (b) Laminarcomposites y Reinforcement may involve the use of a dispersed phase
3. Cermets (Ceramics + metals). Metals (W, Mo, Ni, Co (c) Fiberreinforcedcomposites
act as binders
bi d and d the
h product
d i made
is d by b Powder
P d or strong fibre,
fibre thread or rod.
rod
Metallurgy method. (d) Shortfiberdiscontinuouscomposites y The matrix material provides ductility and toughness
y The sintering
g temperature
p is the meltinggppoint of the metal. and supports and binds the fibres together and
y In the resulting composite material, the metal contributes transmits the loads to the fibres.
high toughness and thermal shock resistance, while the
ceramic
ce a c co contributes
t butes higher
g e refractoriness
e acto ess aand d ccreep
eep y The fibres carry
y most of the load.
resistance, superior chemical stability and abrasion
resistance.
Contd

y Reinforcing Fibres :A good reinforcing fibre should have :


IES 2010
IES2010
y The toughness of the composite material increases,
high elastic modulus, high strength, low density, reasonable Consider the following statements regarding
g will be needed to break or pull
because extra energy ductility and should be easily wetted by the matrix.
matrix composite materials:
out a fibre. y Metallic fibres such as patented steel, stainless steel, 1. Material is termed as advanced composite, if fibers are
y Also, when any crack appears on the surface of a fibre, tungsten and molybdenum wires are used in a metal matrix
directionally oriented and continuous.
continuous
only that fibre will fail and the crack will not such
h as aluminium
l andd titanium.
y Carbon fibres and whiskers are also used to produce ultra 2. Reinforced fiber glass products are strong and light
propagate catastrophically as in bulk material.
high strength composites.
composites weight.
g
y Woodandbambooaretwonaturallyoccurringfiber
d db b ll fb
y Fibres need not be limited to metals. Glass, ceramic and 3. Concrete is reinforced with steel rebar, the rebar becomes
composites,consistingofcellulosefibers inalignin polymer fibres are used to produce variety of composites matrix.
matrix.
matrix h i wide
having id range off properties.
i
4. Pearlitic steels are composite materials.
y Thecommonlyusedmatrixmaterialsare:Metalsand y The ductile matrix material can be aluminium, magnesium,
nickle or titanium and the reinforcing fibres may be of Which of the above statements are correct?
polymers suchas Al Cu Nietc andcommercial
polymers,suchas,Al,Cu,Nietc.andcommercial
polymers. boron, graphite, alumina or SiC. (a) 1, 2 and 3 only (b) 2, 3 and 4 only
Contd (c) 1, 2 and 4 only (d) 1, 2, 3 and 4

IES 2007
IES2007 IES 2002
IES2002 IES 1999
IES1999
p g
Woodisanaturalcompositeconsistingofwhich g
Whichofthefollowingfibre materialsareused g
Considerthefollowingstatements:
ofthefollowing? forreinforcementincompositematerials? Thestrengthofthefibre reinforcedplasticproduct
(a) Ligninfibres incollagenmatrix 1. Glass p p g
1. Dependsuponthestrengthofthefibre alone
(b) Ligninfibres inapatitematrix 2. Boroncarbide 2. Dependsuponthefibre andplastic
((c)) Cellulosefibres inapatitematrix
p 33. Graphite
p 3. Isisotropic
(d) Cellulosefibres inligninmatrix Selectthecorrectanswerusingthecodesgivenbelow: 4. Isanisotropic
((a)) 1and2 ((b)) 1and3
3 Whichofthesestatementsarecorrect?
(c) 2and3 (d) 1,2and3 (a) 1and3 (b) 1and4
(c) 2and3 (d) 2and4

For-2015 (IES, GATE & PSUs) Page 228 of 240 Rev.0


Whi k
Whiskers IES 2011
IES2011 A li i f i f d i l
Applicationsofreinforcedmaterials
y Whiskers are single
g crystals in the form of fine filaments, a Whiskers are 1. Glassfibre reinforced p plastics : Here,, we have gglass
few microns in diameter (2050 nm dia.) and short in (a) Very thin metallic particles fibres in a matrix of unsaturated polyester.
length (a few mm).
(b) Very thin single
g crystals y Glass fibrereinforced plastics are used to make : boat
y Th
These single
i l crystall whiskers
hi k are the
h strongest known
k hulls, Car bodies, truck, cabins and aircraft fittings.
(c) Very thin polycrystals
fibres.
((d)) Fiber p
particles of aspect
p ratio less than 10 2. CC Composites : These composites have graphite
y Their high strength is due to the high degree of perfection
fibres in a carbon matrix.
and the absence of dislocation in their structure.
y This material is being used to make : Nose cone and
y Their strength
g is manyy times g greater than that of the
normal metals. l d
leading edge
d off the
h missiles
l and d space shuttles,
h l racing
car disk brakes, aerospace turbine and jet engine
y Theyareintroducedintoresinormetallicmatrixforthe
purposeofhighstrengthandhighstiffnessathigh components rocket nozzles and surgical implants.
components, implants
temperatures.
Contd

3. Graphite fibrereinforced epoxy : (Organic or Resin


IES 2009
IES2009
p
matrix composites) ) : This material is being g used to g
Whichoneofthefollowingmaterialsisnota
make m y parts of a fighter plane. composite?
4. Automative uses : Bodyy p
4 panels,, drive shafts,, springs
p g (a) Wood
and bumpers, Cab shells and bodies, oil pans, fan (b) Concrete
shrouds, instrument panels and engine covers. ((c)) Plywood
y
5. Sports equipment : Golf club shafts, baseball parts, (d) Sialon
fishing rods, tennis rackets, bicycle frames, skis and
pole
l vaults.
l

H d T
HardnessTest IES 1992
IES1992 IAS 2001
IAS2001
Hardnessasafunctionofcarboncontentisshown With the
th increase
i off percentage
t off carbon
b in
i the
th
Definition: Hardness is a very important but hard to in steel, which one of the following properties does
define property of materials. ( ) g
(a)FigA increase?
(a) Modulus of elasticity (b) Ductility
Hardness
Hardness is the resistance offered by a material (b)Fig B
(b)FigB (c) Toughness (d) Hardness
to indentation.
(c)Fig C
(c)FigC

(d)Fig D
(d)FigD

For-2015 (IES, GATE & PSUs) Page 229 of 240 Rev.0


Brinell Hardnesstest
M h ScaleofHardness
Mohs S l fH d y Most commonly used tests.
y Itcannotbeusedonveryhardorverysoftmaterial.
Material Mohs hardness y Itisbestifthethicknessofthematerialisatleast10
y A 10 mm tungsten carbide or hardened steel ball
Talc 1 timesthedepth.
intended.
Gypsum 2 y Tensilestrength=kBHN MPa
y Gradually applied load.
load
Calcite 3 k =3.296foralloysteel
Fluorite 4 y Load applied at right angle to the specimen surface
3 34
=3.342forPlainCarbonsteel.
A tit
Apatite 5 y Indentation diameter made on the specimen is
measured. y Forsteel,flexuralendurancelimit e
Orthoclase 6
Quartz 7 BHN =
Load
oad
=
P
k f / mm2
kgf
e = 1.75 BHN MPa
Topaz
Corundum
8
9
Surface Areaof Indentation
D
(D D d2 2
) VHN BHN
2
Diamond 10 BHN
P Kgf ; D and d in mm Rc
Contd 10

IES 2010
IES2010 IES 1992
IES1992 R k ll H d
RockwellHardnesstest
Thehardnessoflathebedmaterialshouldbe
A carbon steel having Brinell Hardness y A sphere conical diamond cone of 120
120 angle and a
measuredby
db spherical apex of radius 0.2 mm is used
number 100 should ultimate tensile
(a)Rockwelltester y Depth
p of indentation t is measured.
strength closer it
(b)Brinell hardnesstester y Gradually applied load,
(a) 100 N/mm2 (b) 200 N/mm2
(c)ShoreScleroscope 2 2 y Load is applied at right angle to the specimen surface.
( ) 350 N/mm
(c) N/ (d) 1000 N/mm
N/
(d)Vickershardnesstester y R = 100 500 t
y Depending on the load used a scale A,
A B,
B C,
C etc.
etc used.
used
y Rockwell test should not be used on thin materials
(generally less than 0.16 mm, on rough surface or on
materials that are not homogeneous).

IAS 1999
IAS1999 Vi k h d
Vickershardnesstest Th S l
TheScleroscope
AmeasureofRockwellhardnessisthe (i) A square based diamond pyramid having 136 136 (i) Based on the rebound height of a ball from the
(a) Depthofpenetrationofindenter between the opposite faces is used. specimen.
(b) Surfaceareaofindentation ((ii)) Average
g Diagonal
g of the indention ((D)) is ((ii)) Harder the material,, higher
g is the height
g to which
(c) Projectedareaofindentation measured. the ball rebounds.
(d) Heightofrebound 1.854
1 854 p p in kgf ((iii)) Scleroscope
p hardness numbers are comparable
p
VHN = , only among similar materials. A comparison between
D2 D in mm.
steel and rubber would not be valid.
(iii) Even
E a light
li ht load
l d will
ill produce
d plastic
l ti deformation
d f ti
that so why we may use VHT on very hard material
likes Tungsten Carbide.
Carbide

For-2015 (IES, GATE & PSUs) Page 230 of 240 Rev.0


Knoop Test(MicroHardnessTest) IES 1992
IES1992 Durometer
y Various micro hardness tests have been developed for Whichofthefollowingwouldyoupreferfor
application where it is necessary to determine the checkingthehardnessofverythinsections? y When
Wh testing
i soft,
f elastic
l i materials,
i l such
h as
hardness of a very precise area of material, or where ((a)) Hebertcloudbursttest
rubbers and non rigid plastics, a durometer is
the material or surface layer is exceptionally thin. use
(b) Shore'sScleroscope
y Special machine have been developed for this purpose.
(c) Knoop hardnesstest
The location for this test is select in the high
(d) Vickershardnesstest Herbert Cloudburst hardness test:
magnification.
y A smallll diamond
di d penetrator is i then
h l d d with
loaded ih a y It is used to know the uniformity of hardness
predetermined load ranging fm 25g to 3000g. over a surface.

Charpy andIzod test


IES 1992
IES1992 y Toughness of a material is measured by means of impact y In the Charpy impact test, the specimen is held between
two grips whereas in the Izod impact test the specimen is
tests.
Herbert cloudburst Hardness test is conducted to held at one end like a cantilever .
y Notched bar prepared as per standard from the test
know y The standard test specimens used in the izod and Charpy
material, is held in a vice and a weight is allowed to swing
((a)) Uniformityy of hardness over a surface impact tests are made of bars with a square cross section of
from a known height in such a way that it hits the notched 10 mm.
(b) Softness of nonmetallic components bar in its path and breaks it.
y The impact resistance is dependent upon the material
(c) Hardness of non
nonmetallic
metallic components y Since the material has absorbed some amount of energy gy composition as well as the heat treatment process given to
during its fracture, the swinging mass loses part of its it.
(d) Hardness at specified depth inside the surface.
energy and therefore will not be able to reach the same y The annealed materials normally would have better
h i ht from
height f where
h it started.
t t d toughness
h than
h the
h corresponding
di normalized
li d or
y The loss in height (h) multiplied by the weight represents quenched specimens. Coarsegrained structure would tend
the energy absorbed by the specimen during fracture,fracture g
to have higher ductilityy compared
p to fine g
grain structure
which can be directly measured from the indicator on the and consequently better toughness.
tester. Contd

Sh F bili T
SheetFormabilityTests GATE 2006
GATE2006 IES 2002
IES2002
y During the various sheet metal forming processes, the MatchtheitemsinColumnIandColumnII. Assertion ((A):) The hardness test is a slow,, expensive
p
stresses and strains developed in the material are quite ColumnI ColumnII method of assessing the mechanical properties of
P. Charpy test 1. Fluidity materials.
complex. So, any measure of the formability of the
Q. Knoop test 2. Microhardness Reason (R): The hardness is a function of yield stress
sheet metal on the basis of material properties derived and the work hardening rate of material.
from a simple tension test( for example, % elongation R. Spiraltest 3. Formability
((a)) Both A and R are individuallyy true and R is the correct
as an index
i d off ductility
d tilit off the
th material)
t i l) is
i nott very S Cuppingtest
S. C i t t 4. T
Toughness
h explanation of A
accurate. 5. Permeability (b) Both A and R are individually true but R is not the
y So cupping tests have been developed to evaluate the correct explanation of A
formability of the sheet metals. (a) P 4,Q 5,R 3,S 2 (b) P 3,Q 5,R 1,S 4 (c) A is true but R is false
((c)) P 2,Q
, Q 4,4,R 3,
3,S 5 ((d)) P 4,
4,Q
Q 2,R
, 1,S
, 3 (d) A is false but R is true

For-2015 (IES, GATE & PSUs) Page 231 of 240 Rev.0


Duralumin IES 1993
IES1993
y It is an important and interesting wrought alloy. y
DuraluminAlloycontainsaluminium pp
andcopper
y Its composition is as follows: intheratioof
y Copper = 3.5 4.5%; Manganese = 0.4 0.7%; %Al %Cu
M
Magnesiumi = 0.4 0.7%,
% and d the
th remainder
i d i
is
aluminium. (a) 94 4
y This alloy possesses maximum tensile strength (upto ((b)) 990 8
400 MPa) after heat treatment and age hardening. (c) 88 10
After working, if the metal is allowed to age for 3 or 4 ((d)) 86 12
d
days, i will
it ill be
b hardened.
h d d This
Thi phenomenon
h i known
is k
as age hardening.
y It is widely used in wrought conditions for forging,
forging
stamping, bars, sheets, tubes and rivets.

IES 1992
IES1992 Magnalium Hindalium
g
Whichofthefollowingstatementisincorrect y It is made by melting the aluminium with 2 to 10% y Itisanalloyofaluminium andmagnesiumwitha
aboutduralumin? magnesium in a vacuum and then cooling it in a smallquantityofchromium.
(a) Itispronetoagehardening vacuum or under a p pressure of 100 to 200 atmospheres.
p
(b) Itcanbeforged y It also contains about 1.75% copper. Due to its light
((c)) Ithasgoodmachiningproperties
g gp p weight
g and g good mechanical p properties,
p it is mainlyy
(d) Itislighterthanpurealuminium used for aircraft and automobile components.

Copper zinc alloys (Brass)


Copperzincalloys(Brass) y The addition of zinc strengthens the material and IES 1992
IES1992
incidentally changes the colour to a yellow or gold g p
Additionofwhichofthefollowingimproves
y The most widely used copper zinc alloy is brass.
copperzinc
effect.
ff machiningofcopper?
y There are various types of brasses, depending upon the y The ratio of copper and zinc can be varied for
proportions
p p of copper
pp and zinc. (a) Sulphur
advantages and the addition of other elements gives
y This is fundamentally a binary alloy of copper with still more variety of combinations of properties such as (b) Vanadium
zinc each 50%.
5 machinability, strength, hardness, ductility (hot or ((c)) Tin
cold),
ld) conductivity
d and
d corrosion resistance as well
ll as
y By adding small quantities of other elements, the (d) Zinc
many others.
properties of brass may be greatly changed.
y Leadadditionsareusedtoimprovemachinability.The
Leadadditionsareusedtoimprovemachinability The
y ApplicationsofCualloysinclude:costumejewellery, leadisinsolubleinthesolidbrassandsegregatesas
coins,musicalinstruments,electronics,springs, smallglobulesthathelptheswarftobreakupinto
g p p
bushes,surgicalanddentalinstruments,radiators,etc. smallpiecesandmayalsohelptolubricatethecutting
toolaction.
For-2015 (IES, GATE & PSUs) Contd Page 232 of 240 Rev.0
IES 1992
IES1992 Copper tin alloys (Bronze)
Coppertinalloys(Bronze) y The hardness and strength of bronze increase with an
g
Cartridgebrasscanbe y The alloys of copper and tin are usually termed as increase in tin content.
(a) Coldrolledintosheets bronzes. y The ductility is also reduced with the increase in tin
((b)) Drawnintowires y The useful range of composition is 75 to 95% copper percentage above 5.
andd 5 to 25%% tin. y When aluminium is also added (4 to 11%), the
(c) Formedintotubes
y The metal is comparatively hard, resists surface wear resulting alloy is termed aluminium bronze, which
(d) Anyoftheabove.
andd can be
b shaped
h d or rolled
ll d into
i wires,
i rods
d andd sheets
h h a considerably
has d bl higher
h h corrosion resistance.
very easily. y Bronzes are comparatively costly compared to brasses
y In
I corrosion
i resistant
i t t properties,
ti bronzes
b are superior
i d to the
due h presence off tin
i which
hi h is
i an expensive
i metal.
l
to brasses. y The colour of aluminium bronze is similar to that of
22 caratt gold
ld and
d it is
i frequently
f tl called
ll d imitation
i it ti
gold.
Contd

IES 2011
IES2011 Phosphor bronze
Phosphorbronze IES 2006
IES2006
Aluminium Bronze is also known as : y When bronze contains phosphorus, it is called Incaseofpowerscrews,whatisthecombination
(a) Muntz metal phosphor bronze. ofmaterialsusedforthescrewandthenut?
(b) White metal y Phosphorus increases the strength, ductility and ((a)) Castironscrewandmildsteelnut
(c) Duraluminium soundness
d off castings.
(b) Carbonsteelscrewandphosphorbronzenut
y This alloy possesses good wearing qualities and high
((d)) Imitation g
gold (c) Castironscrewandcastironnut
elasticity.
l i i
(d) Aluminium screwandalloysteelnut
y A common type of phosphor bronze has the following
composition
iti according
di tot Indian
I di standards
t d d Copper
C =
8790%, Tin = 910%, and Phosphorus = 0.13%.
y The material is specified for pump parts,
parts gears,
gears
springs, power screw nuts and bearings.

IES 1992
IES1992 Gun Metal
GunMetal IES 2003
IES2003
p g p p p p
Thepercentageofphosphorousinphosphorbronze y It is an alloy of copper, tin and zinc. , j g ,
Gunmetal,whichisusedinjournalbearings,
is y It usually contains 88% copper, 10% tin and 2% zinc. contains
(a) 0.1 (b) 1 y This metal is also known as Admiralty g
gun metal. (a) 88%Cu,10%Sn,2%Zn
(c) 11.1 (d) 98 y The zinc is added to clean the metal and to increase its (b) 80%Cu,10%Zn,10%Al
fluidity. ((c)) 85%Cu,5%Mg,10%Al
5 ,5 g,
y It is not suitable for being worked in the cold state but (d) 85%Cu,5%Sn,10%Pb
may be forged when at about 600C.
y It is extensively used for casting boiler fittings, bushes,
bearings, glands, etc.

For-2015 (IES, GATE & PSUs) Page 233 of 240 Rev.0


IES 2011
IES2011 Monel metal
IES 1994
IES1994 MatchListIwithListIIandselectthecorrectanswerusing
gp
Whichofthefollowingpairsarecorrectly y thecodegivenbelowthelists: y It is an important alloy of nickel and copper.
matched? ListI ListII y It contains 68% nickel, 29% copper and 3% other
1. SiliconsteelsTransformerstampings constituents like iron, manganese, silicon and carbon.
A GunMetal
A.GunMetal 1 Wormwheel
1.Wormwheel It is superior to brass
b and
d bronze
b in corrosion resisting
2. DuraluminCookingutensils.
B.Phosphorbronze 2.Cylinderblock properties.
33. Gunmetal.................Bearings
g
y It
I is i usedd for
f making
ki propellers,
ll pump fittings,
fi i
Selectthecorrectanswerusingthecodesgivenbelow. C.Graycastiron 3.Piston condenser tubes, steam turbine blades, sea water
C
Codes: D Alallo
D.Alalloy 4 Bushings
4.Bushings exposed parts,
parts tanks and chemical and food handling
(a) 1,2and3 (b) 1and2 Codes plants.
A B C D A B C D
(c) 1and3 (d) 2and3
(a) 3 1 2 4 (b) 4 1 2 3
(c) 3 2 1 4 (d) 4 2 1 3

IES 2011
IES2011
Admirality Brass is used for
(a) Condenser Tubes
(b) Rivets
(c) Piston rods
((d)) Utensils

IES 2006
IES2006 IES 2003
IES2003 IES 2004
IES2004
MatchListI(Composition)withListII(Application)andselect y
Monel metalisanalloyof y pp
MatchListI(Alloy)withListII(Application)andselect
thecorrectanswerusingthecodegivenbelowtheLists:
thecorrectanswerusingthecodesgivenbelowtheLists:
List I ListII (a) Ironandcarbon
A. Commercialbronze(10%Zn) 1.Radiator ListI ListII
B
B. Redbrass(15%Zn) 2 Springmetal
2.Springmetal ((b)) Copperandzinc
pp A Siliconsteel
A. 1
1. Marinebearings
C. Aluminiumbrass(22%Zn,2%Al) 3.Forgingand (c) Aluminium andcopper B. Highcarbonsteel 2. Cuttingtools
stamping
D
D. Pbronze(11%tin)smallamountofP) 4 Powerplant
4.Powerplant (d) Copperandnickel C. Highspeedsteel 3. Springs
andchemical D. Monel metal 4. Transformer
equipment laminations
Codes: A B C D A B C D Codes:A B C D A B C D
(a) 2 4 1 3 (b) 3 1 4 2
(a) 1 2 3 4 (b) 4 3 2 1
(c) 2 1 4 3 (d) 3 4 1 2
(c) 4 2 3 1 (d) 1 3 2 4

For-2015 (IES, GATE & PSUs) Page 234 of 240 Rev.0


Inconel Nichrome Nimonic
y It consists of 80% nickel, 14% chromium, and 6% iron. y It consists of 80% nickel and 20% chromium.
y It consists of 65% nickel,
nickel 15% chromium and 20% iron.
iron
y This alloy has excellent mechanical properties at y It has high strength and ability to operate under
y It has high heat and oxidation resistance.
ordinary and elevated temperatures. intermittent heating and cooling conditions.
y It is used in making electrical resistance wire for
y It can be cast, rolled and cold drawn. y It is widely used in gas turbine engines.
electric furnaces and heating elements.
y It is used for making springs which have to withstand
high temperatures and are exposed to corrosive action.
y It is also used for exhaust manifolds of aircraft engines.

Babbit metal IES 2011


IES2011 IES 1995
IES1995
y The tin base and lead base babbits are widely used as a Babbit is an alloy of g g
Babbit liningisusedonbrass/bronzebearingsto
bearing material, because they satisfy most (a) Sn, Cu, Sb and Pb (a) Increasebearingresistance
requirements for general applications. (b) Sn and Cu ((b)) Increasecompressivestrength
p g
y The
h babbit
b bb is generally
ll used
d as a thin
h layer,
l 0.05 mm to (c) Sn, Cu and Pb (c) Provideantifrictionproperties
0.15 mm thick, bonded to an insert or steel shell. The
composition of the babbit metals is as follows: ((d)) Sn,, Cu and Sb (d) Increasewearresistance.
y Tin base babbits : Tin 90% ; Copper 4.5% ; Antimony
5% ; Lead 0.5%.
0 5%
y Lead base babbits : Lead 84% ; Tin 6% ; Anitmony
9 5% ; Copper 0.5%.
9.5% 0 5%

IES 2009
IES2009 IES 2008
IES2008 IES
y
Whyarebabbit y g
alloysusedforbearingmaterial? g
Whichoneofthefollowingiscorrect? g
Tinbasewhitemetalsareusedwherethebearings
(a) Theyhaveexcellentembeddability Babbittareusedfor aresubjectedto
((b)) Theyarerelativelystrongerthanotherbearing
y y g g ((a)) Gears ((b)) Bearings
g (a) Largesurfacewear
materials (c) Bolts (d) Clutchliners (b) Elevatedtemperatures.
((c)) Theydonotlosestrengthwithincreasein
y g ((c)) Lightloadandpressure
g p
temperature (d) Highpressureandload.
(d) Theyhavehighfatiguestrength

For-2015 (IES, GATE & PSUs) Page 235 of 240 Rev.0


IES 1998
IES1998 IES 2005
IES2005 IES 2007
IES2007
MatchListI(Alloys)withListII(Applications)and MatchListI(Alloy)withListII(MajorConstituent) MatchListIwithListIIandselectthecorrectanswerusingthecode
givenbelowtheLists:
selectthecorrectanswerusingthecodesgivenbelow
l h h d b l andselectthecorrectanswerusingthecodegiven
d l h h d ListI ListII
thelists: belowtheLists: (Component) (RequiredProperty)
ListII
List ListII
List II ListI ListII A. Bladesofbulldozer 1. Highwearresistanceand
g
hightoughness
A. Chromel 1. Journalbearing A. Babbitt 1. Nickel B. Gasturbineblades 2. LowYoungsmodulusand
highfatiguestrength
B. Babbit alloyy 2. Millingcutter
g B. Invar 2. Tinandlead C
C. Drillbit 3
3. Highwearandabrasion
C. Nimonic alloy 3. Thermocouplewire C. GunMetal 3. Aluminium resistance
D. Springsofautomobiles 4. Highcreepstrengthand
D. Highspeedsteel 4. Gasturbineblades D. Duralumin 4. Copper goodcorrosionresistance
Code:A B C D A B C D Code:A B C D A B C D Code: A B C D A B C D
(a) 3 2 1 4 (b) 1 4 3 2
(a) 3 1 4 2 (b) 3 4 1 2 (a) 2 4 1 3 (b) 3 1 4 2 (b) 3 4 1 2 (d) 1 2 3 4
( ) 2
(c) 4 1 3 (d) 2 1 4 3 ( ) 2
(c) 1 4 3 (d) 3 4 1 2

Col mbi m/Niobi m


Columbium/Niobium IES 2011
IES2011 Nimonic 90
y Columbium finds much use in largescale applications, Columbiumisa: y A precipitation hardenable nickelchromiumcobalt alloy,
suchh as steel
t l for
f automobile
t bil bodies
b di and d pipelines.
i li The
Th use having
h i highhi h stressrupture
t t strength
t th andd creep resistance
i t att
that probably will consume most of the columbium is (a)Nuclearmaterial
elevated temperatures up to about 950 C.
microalloying. (b)Automobilematerial y For springs exposed to lower loads,
loads the material can be used
y Relatively small amount of columbium lend high strength (c)Filmmaterial up to 700 C.
to steel. The microalloyed, or highstrenght, lowalloy
(HSLA) steels,
steels are used for automobile bodies,
bodies structures ( )
(d)Foammaterial y Nimonic 9 90 offers g
good resistance to corrosion and is non
of all kinds, and highpressure pipe, particulary in the oil magnetic.
and gas industry. y Applications include the aircraft industry, gas turbines,
y Columbium
l b with
h oxygen as dominant
d substiutitional
b l vehicle
h l components and d springs in highh h temperature
alloying atoms is used in the nuclear fusion reactor. environments, and thermal.
y Nuclear material refers to the metals uranium,
uranium plutonium,
plutonium y Operating temperature: 100
100 + 550 C
and thorium, in any form, according to the IAEA

Ferro electricity
Ferroelectricity Piezo electricity
Piezoelectricity IES 1993
IES1993
y Ferroelectricity is defined as the spontaneous alignment y Piezoelectricity, or pressure electricity, is defined as
polarization induced by the application of external force. QQuartzisa
off electric
l t i dipoles
di l by
b their
th i mutual
t l interaction
i t ti in
i the
th
absence of an applied electric field. y Hence, by reversing the direction of external force, direction (a) Ferroelectricmaterial
of the field can be reversed i.e. the application of an
y This arises from the fact that the local field increases in external electric field alters the net dipole length and causes ((b)) Ferromagneticmaterial
g
proportion to the polarization. Thus, ferroelectric a dimensional change. (c) Piezoelectricmaterial
materials must posses permanent dipoles. Ex.: BaTiO3, y This property is characteristic of materials having
complicated structures with a low degree of symmetry.
symmetry (d) Diamagneticmaterial
Rochelle salt (NaKC4H4O6.4H2O), potassium dihydrogen
phosphate (KH2PO4), potassium niobate (KNbO3). y Thus, piezoelectric materials can be used as transducers
devices that convert mechanical stress into electrical energy
y These
Th materials
t i l have
h extremely
t l high
hi h dielectric
di l t i constants
t t att andd vice
i versa.
relatively low applied field frequencies. y Application for these materials includes microphones,
y Thus,
Thus capacitors made from ferro ferroelectric
electric materials are ultrasonic generators, sonar detectors, and mechanical
strain
i gauges. Ex.:
E B i
Barium titanate,
i l d titanate,
lead i l d
lead
smaller than capacitors made of other dielectric materials. zirconate (PbZrO3), ammoinium dihydrogen phosphate
For-2015 (IES, GATE & PSUs) Page 236 of 240
(NH4H2PO4), and quartz. Rev.0
Welding cracks
Weldingcracks y Cracksinthebasemetalusuallyoccuratlow y Coldcrackingcanoccurdueanytothefollowing
y Cracksmayoccuratthefollowinglocations:
temperatures(around200C)andareknownasCold severalfactors: improperweldingconditions,the
(i)Intheweld(Fuse)MetalZone cracks. presenceofgasandotherimpuritiesintheweld,
f d h i i i i h ld
(ii)IntheBasemetalzone wrongchoiceoffillerrodandmetallurgicalfactors
y Ontheotherhand,thecracksintheweldmetalzone
suchasexcessivecoolingrateresultinginthe
(iii)S
(iii)Sometimes,thecracksoriginateinoneZoneand
ti th k i i t i Z d occurwhilethemetalisstillveryhot.Suchcracksare
hil h li ill h S h k formationofmartensiteandformationofbrittle
thenspreadtotheotherZone. calledHotcracks. phasesintheweldwhencoldortheformationof
y Cracksintheweldmaybeduetostructuralstressesin
C k i th ld b d t t t l t i phaseswhicharebrittleathightemperatures
h hi h b ittl thi ht t
themetal(forexample,theformationofmartensite), [Allotropictransformations].
heavyshrinkage extrahighamountofsulphur
heavyshrinkage,extrahighamountofsulphur, y Cracksinthebasemetalcanoccurduetothe
phosphorousorcarboninthemetal,excessivelyrigid followingreasons: Corrosion,Basemetaldefects,
clampingofthepartsbeingweldedorthepresenceof
p g p g p Basemetalcompositionvariations,hydrogen
gasesintheweldmetal. embrittlement
bi l andinternalstressessetupdueto
di l d
restrainedshrinkingafterwelding.
Contd Contd

IES 2005
IES2005 H bi l
Hembrittlement dP i i
andPassivity IES 1992
IES1992
ot c ac s occu t e e d a d us o o e as t e
Hotcracksoccurintheweldandfusionzoneasthe y Hydrogenembrittlement
yd oge e b tt e e t isformoffailurethan
s o o a u et a Presenceofhydrogeninsteelcauses
metalsolidifies.Whichofthefollowingarethecauses corrosion,but occursasaresultofhydrogenproduced (a) Reducedneutronabsorptioncrosssection
forhotcracks? duringcorrosion.Atomichydrogendiffusesintocrystals
andinhibitsdislocationmotion,causingfailure.
di hibi di l i i i f il (b)improvedweldability
1. Presenceofsulphur andphosphorusinthebasemetal
y Countermeasures:heattreatment;removalofhydrogen (c) Embrittlement
2. Highcarbonoralloycontentofthebasemetal
3. Moistureinthejointorelectrode
source.
source (d)corrosionresistance
y Passivity:Itisformprotectionagainstcorrosion.Itresults
4. Jointrestraint
, g y
fromthin,strongadherentoxidelayerformedoverthe
Selectthecorrectanswerusingthecodegivenbelow:
l h h d b l surface.UsuallyobservedinAl,Cr,Fe,Ni,Tiandtheir
(a) 1,2and4 (b) 1,2and3 alloys.Passivelayersmaygetdamagedduringmechanical
( ) 3and4
(c) d (d) 1,2,3and4
d vibrations,andsothesemetalsarepronetoerosion
ib i d h l i
corrosion.

IES 2006
IES2006 IES 1992
IES1992
Incaseofpowerscrews,whatisthecombination Forthepipefittinglikeelbow,tee,unionetc.
ofmaterialsusedforthescrewandthenut? whichofthefollowingispreferred?
((a)) Castironscrewandmildsteelnut ((a)) Pigiron
g
(b) Carbonsteelscrewandphosphorbronzenut (b) Malleableiron
Otherquestions
(c) Castironscrewandcastironnut (c) Spheroidal graphitecastiron
(d) Aluminium screwandalloysteelnut (d) Highcarbonsteel

For-2015 (IES, GATE & PSUs) Page 237 of 240 Rev.0


IES 1992
IES1992 IES 1992
IES1992 IES 2006
IES2006
g p yp p
Whichofthefollowingdisplaypropertiessimilar g p
Additionofwhichofthefollowingimproves p g
Disruptivestrengthisthemaximumstrengthofag
tothatofsteel machiningofcopper? metal,when
1. Blackheartcastiron (a) Sulphur (a) Subjectedto3principaltensilestressesatright
2. Whiteheartcastiron (b) Vanadium anglestooneanotherandofequalmagnitude
33. Graycastiron
y ((c)) Tin (b) Loadedintension
4. Pigiron (d) Zinc (c) Loadedincompression
((a)) 1and2onlyy ((b)
) 33and4only
4 y (d) Loadedinshear
(c) 2and4only (d) 1and3only

IAS 1996
IAS1996 IAS 1998
IAS1998 IES 1996
IES1996
MatchListIwithListIIandselectthecorrectanswer Whichofthefollowingmethodsaresuitablefor Thelimittothemaximumhardnessofawork
usingthecodesgivenbelowthelists:
h d b l h l theproductionofsuperalloys? materialwhichcanbemachinedwithHSStools
ListI(Cuttingtools) ListII(Majorconstituent) 1. Atomizationfrommoltenstateusinginertgas. evenatlowspeedsissetbywhichoneofthe
A Stellite
A. l
l. Tungsten 2. Atomizationusingplasmaarcandrotating
A i i i l d i f ll i
followingtoolfailuremechanisms?
lf il h i
B. H.S.S. 2. Cobalt electrode. (a) Attrition
C. Ceramic 3. Alumina 3 Reductionandcrushing.
3. Reductionandcrushing
D. DCON 4. Columbium
(b) Abrasion
Selectthecorrectanswerusingthecodesgivenbelow:
5. Titanium (c) Diffusion
Codes:
Codes:A B C D A B C D (d) Plasticdeformationundercompression.
(a) 1and2 (b) 2and3
(a) 5 1 3 4 (b) 2 1 4 3
(c) 1and3 (d) 1,2and3
( ) 2
(c) 1 3 4 ( )
(d) 2 5 3 4

GATE 2002
GATE2002 IES 2009
IES2009 IES 1992
IES1992
y
Theductilityofamaterialwithworkhardeningg p g yp
Nano compositematerialsarehighlypreferablein Machinetoolframeshouldhave
(a) Increases (b) Decreases designconsiderationfortheir (a) Highrigiditytoweightratio
((c)) Remainsunaffected ((d)) Unpredictable
p (a) Highresistancetocrackpropagation ((b)) Graphiteintheformofnodules
p
(b) Vibrationresistance (c) Lowhardness
((c)) Impactresistance
p (d) Highworkhardness
(d) Highresilience

For-2015 (IES, GATE & PSUs) Page 238 of 240 Rev.0


GATE 1995
GATE1995 IES 2009
IES2009 JWM 2010
JWM2010
Considerthefollowingpropertiesofengineering
g
Machinetoolstructuresaremade..forhigh gp p p y
Whichoneofthefollowingpossessestheproperty
materials
processcapability.(tough/strong/rigid) ofnonsparking character?
1.Density
(a) Hadfield'smanganesesteel (b) Springsteel
2.Conductivity
C d ti it
(c) Stellite (d) Invar
3.Elasticity
4.Hardness
H d
5.Ductility
Whichofthesearemechanicalpropertiesofa
material?
( ) d l (b) d
(a)1,2and4only(b)1,2,3and4
(c)3,4and5(d)2,4and5

IES 2011
IES2011
IES 2011
IES2011 IES 2011
IES2011 Match List I with List II and select the correct answer using
Materialswhichshowdirectiondependentpropertiesare Lead is widely used in: the code given below the lists :
called: (a) Transformers ListI ListII
(a)Homogeneous (b) Switch gear
g A.System
y 1.Freeenergyisaminimum
gy
(b)Viscoelastic (c) Galvanized pipes B.Phase 2.Chemicalelementsorchemical
(c)Isotropic ((d)) Batteries compounds
(d)Anisotropic C.Phase 3.Consistsofsolids,liquidsorgassesortheir
equilibrium combination
D.Components
Codes 4.Homogeneousportionofasystemthat
A B hasuniformphysicalcharacteristics
C D A B C D
(a) 2 1 4 3 (b) 3 1 4 2
(c) 2 4 1 3 (d) 3 4 1 2

IES 2011
IES2011
GATE2005 IAS1998 Match List I with List II and select the correct answer using
the code given below the lists :
When
Wh the th temperature
t t off a solid
lid metal
t l increases
i Magnesiumisextrudedandnotrolledbecause
M i i t d d d t ll db
ListI ListII
(a) Strength of the metal decreases but ductility (a) Ithasalowmeltingpoint
A.Elasticityy 1.Deformnonelasticallywithoutfracture
y
increases (b) Ithasalowdensity
I h l d i
(b) Both strength and ductility of the metal decrease B.Malleability 2.Undergoplasticdeformationundertensile
(c) Itsreactivitywithrollmaterialishigh load
( ) Both
(c) B th strength
t th andd ductility
d tilit off the
th metal
t l increase
i ( ) Ithasadosepackedhexagonalstructure
(d) C.Ductility 3.Undergoplasticdeformationunder
(d) Strength of the metal increases but ductility compressiveload
decreases D.Plasticity 4.Returntoitsoriginalshapeonunloading
Codes
A B C D A B C D
(a) 1 2 3 4 (b) 4 2 3 1
(c) 1 3 2 4 (d) 4 3 2 1
For-2015 (IES, GATE & PSUs) Page 239 of 240 Rev.0
IES 2011
IES2011 IES 2011
IES2011 IES 2010
IES2010
Injection moulding process used to produce Assertion (A) : Solid solutions of metal are The correct statement is
thermoplastic matrix composites with fibre crystall whose
h propertiesi are close
l to those
h off (a) Characteristic of any series of alloys cannot be
reinforcement normally gives: the solvent.
found by phase diagram.
( ) Short
(a) h fibre
f b composites Reason (R) : They retain the same crystal lattice
and type of bond. (b) Phase diagram does not give amount of
(b) Two layer structure composites ((a)) Both A and R are individuallyy true and R is the phases which are a function of composition,
p p ,
(c) Continuous fibre composites correct explanation of A temperature and pressure.
(d) Single layer composites (b) Both A and R are individually true but R is NOT
the
h correct explanation
l i off A (c) The phase may be liquid or vapour with
(c) A is true but R is false ordered crystal structure.
(d) A is
i false
f l but
b t R is
i true
t (d) Phase diagram provides the information on
how rapidly equilibrium is reached.

JWM 2010
JWM2010 IES 2010
IES2010
Assertion(A):Electricarcfurnacecanbeusedfor Consider the following:
acidandbasicmethodofsteelmaking.
acidandbasicmethodofsteelmaking
1. Water
Reason(R):Impuritiesareeliminatedextensively
inacidareprocess.
inacidareprocess 2. Ice
3. Brine solution
4 Oil
4.
Which of these is/are used as quenching
The End
TheEnd
media
di ini case off Alloy
All steels?l ?
(a) 1, 2 and 3 only (b) 2, 3 and 4 only
(c) 1 and 4 only (d) Only

For-2015 (IES, GATE & PSUs) Page 240 of 240 Rev.0

You might also like