Letters To Nature: Corrections
Letters To Nature: Corrections
17. Fülöp, V., Moir, J. W. B., Ferguson, S. J. & Hajdu, J. Crystallisation and preliminary crystallographic
study of cytochrome cd1 nitrite reductase from Thiosphaera pantotropha. J. Mol. Biol. 232, 1211–1212
(1993).
18. Berger, H. & Wharton, D. C. Small angle X-ray scattering studies of oxidised and reduced cytochrome
cAMP-induced switching in turning
oxidase from Pseudomonas aeruginosa. Biochim. Biophys. Acta 622, 355–359 (1980).
19. Moore, G. R. & Pettigrew, G. W. Cytochromes c: Evolutionary, Structural and Physicochemical Aspects
direction of nerve growth cones
(Springer, Berlin, 1990).
20. Pettigrew, G. W. & Moore, G. R. Cytochromes c: Biological Aspects (Springer, Berlin, 1987). Hong-jun Song, Guo-li Ming & Mu-ming Poo
21. Harutunyan, E. H. et al. The binding of carbon monoxide and nitric oxide to leghaemoglobin in
comparison with other haemoglobins. J. Mol. Biol. 264, 152–161 (1996).
22. Edwards, S. L., Kraut, J. & Poulos, T. L. Crystal structure of nitric oxide inhibited cytochrome-c
Nature 388, 275–279 (1997)
..................................................................................................................................
peroxidase. Biochemistry 27, 8074–8081 (1988). The order of panels in Fig. 3 of this Letter is incorrect as published.
23. Adman, E. T., Godden, J. W. & Turley, S. The structure of copper nitrite reductase from Achromobacter
cycloclastes at five pH values, with NO−2 bound and with type II copper depleted. J. Biol. Chem. 270, Figure 3a–e should be labelled as f–j, and Fig. 3f–j should be
27458–27474 (1995). labelled a–e. M
24. Williams, P. A. thesis, Oxford Univ. (1996).
25. Poulos, T. L. Ligands and electrons and haem proteins. Nature Struct. Biol. 3, 401–403 (1996).
26. Wittung, P. & Malmstrom, B. G. Redox-linked conformational changes in cytochrome c oxidase. FEBS
Lett. 388, 47–49 (1996).
27. Pascher, T., Chesick, J. P., Winkler, J. R. & Gray, H. B. Protein folding triggered by electron transfer. corrections
Science 271, 1558–1560 (1996).
28. Kraulis, P. J. MOLSCRIPT: a program to produce both detailed and schematic plots of protein. J. Appl.
Crystallogr. 24, 946–950 (1991).
29. Merritt, E. A. & Murphy, M. E. P. Raster3D Version 2.0. A program for photorealistic molecular
graphics. Acta Crystallogr. D 50, 869–873 (1994). Synthesis and X-ray structure of
30. Brünger, A. T. The free R value: a novel statistical quantity for assessing the accuracy of crystal
structures. Nature 355, 472–474 (1992). dumb-bell-shaped C120
Acknowledgements. We thank the ESRF and SRS Daresbury for data collection facilities; the EMBL
outstation, Grenoble, for use of an image plate detector; M.L.D. Page for expert advice; R. Bryan and R. Guan-Wu Wang, Koichi Komatsu, Yasujiro Murata
Esnouf for computing; K. Harlos for help with in-house data collection; F. Armstrong and J. Hirst for & Motoo Shiro
providing electrochemically reduced methyl viologen. This work was supported by MRC, BBSRC and EU-
BIOTECH. The Oxford Centre for Molecular Sciences is funded jointly by BBSRC, EPSRC and MRC. Nature 387, 583–586 (1997)
..................................................................................................................................
N.F.W.S. was supported by a Wellcome Trust prize studentship. V.F. is a Royal Society university research
fellow. In this Letter, we overlooked a citation of G. Oszlanyi et al., Phys.
Correspondence and requests for materials should be addressed to P.A.W. (e-mail: [email protected]),
Rev. B 54, 11849 (1996), who reported the observation of covalently
V.F. (e-mail: [email protected]) or J.H. (e-mail: [email protected]). bound (C60)2− 2 dianions from the X-ray powder diffraction patterns
of the metastable phases of KC60 and RbC60. M
Helicobacter pylori, strain 26695, has a circular genome of 1,667,867 base pairs and 1,590 predicted coding
sequences. Sequence analysis indicates that H. pylori has well-developed systems for motility, for scavenging iron,
and for DNA restriction and modification. Many putative adhesins, lipoproteins and other outer membrane proteins
were identified, underscoring the potential complexity of host–pathogen interaction. Based on the large number of
sequence-related genes encoding outer membrane proteins and the presence of homopolymeric tracts and
dinucleotide repeats in coding sequences, H. pylori, like several other mucosal pathogens, probably uses
recombination and slipped-strand mispairing within repeats as mechanisms for antigenic variation and adaptive
evolution. Consistent with its restricted niche, H. pylori has a few regulatory networks, and a limited metabolic
repertoire and biosynthetic capacity. Its survival in acid conditions depends, in part, on its ability to establish a positive
inside-membrane potential in low pH.
For most of this century the cause of peptic ulcer disease was Table 1 Genome features
thought to be stress-related and the disease to be prevalent in
General
hyperacid producers. The discovery1 that Helicobacter pylori was
Coding regions (91.0%)
associated with gastric inflammation and peptic ulcer disease was Stable RNA (0.7%)
initially met with scepticism. However, this discovery and sub- Non-coding repeats (2.3%)
sequent studies on H. pylori have revolutionized our view of the Intergenic sequence (6.0%)
gastric environment, the diseases associated with it, and the RNA
appropriate treatment regimens2. Ribosomal RNA Coordinates
23S-5S 445,306–448,642 bp
Helicobacter pylori is a micro-aerophilic, Gram-negative, slow- 23S-5S 1,473,557–1,473,919 bp
growing, spiral-shaped and flagellated organism. Its most charac- 16S 1,209,082–1,207,584 bp
teristic enzyme is a potent multisubunit urease3 that is crucial for its 16S 1,511,138–1,512,635 bp
5S 448,041–448,618 bp
survival at acidic pH and for its successful colonization of the gastric
Transfer RNA
environment, a site that few other microbes can colonize2. H. pylori 36 species (7 clusters,12 single genes)
is probably the most common chronic bacterial infection of Structural RNA
humans, present in almost half of the world population2. The 1 species (ssrD) 629,845–630,124 bp
presence of the bacterium in the gastric mucosa is associated with DNA
chronic active gastritis and is implicated in more severe gastric Insertion sequences
diseases, including chronic atrophic gastritis (a precursor of gastric IS605 13 copies (5 full-length, 8 partial)
IS606 4 copies (2 full-length, 2 partial)
carcinomas), peptic ulceration and mucosa-associated lymphoid
Distinct G þ C regions Associated genes
tissue lymphomas2. Disease outcome depends on many factors, region 1 (33% G þ C) 452–479 kb IS605, 5SRNA and repeat 7; virB4
including bacterial genotype, and host physiology, genotype and region 2 (35% G þ C) 539–579 kb cag PAI (Fig. 4)
dietary habits4,5. H. pylori infection has also been associated with region 3 (33% G þ C) 1,049–1,071 kb IS605, 5SRNA and repeat 7
region 4 (43% G þ C) 1,264–1,276 kb b and b9 RNA polymerase, EF-G (fusA)
persistent diarrhoea and increased susceptibility to other infectious region 5 (33% G þ C) 1,590–1,602 kb two restriction/modification systems
diseases6. Coding sequences
Because of its importance as a human pathogen, our interest in its 1,590 coding sequences (average 945 bp)
biology and evolution, and the value of complete genome sequence 1,091 identified database match
499 no database match
information for drug discovery and vaccine development, we have .............................................................................................................................................................................
1,200,000
500,000
1,100,000
600,000
1,000,000
700,000
900,000 800,000
HP1243 MKKHILSLALGSLLVSTLSAED———DGFYTSVGYQIGE-AAQMVTNTKGIQQLSDNY-476—QTINQELGRNPFRK-VGIVN-SQTNNGAMNGIGIQVGYKQFFGQ———KRKWGARYYGFFDYNHAFIKSSFFN———SASDVWTYGFGADALYNFINDKATNFLG——
HP0317 MKKHILSLALGSLLVSTLSAED———DGFYTSVGYQIGE-AAQMVTNTKGIQQLSDNY-488—QTINQELGRNPFRK-VGIVN-SQTNNGAMNGIGIQVGYKQFFGQ———KRKWGARYYGFFDYNHAFIKSSFFN———SASDVWTYGFGADALYNFINDKATNFLG——
HP0896 MKKTLLLSLSLSLSFLLHAED———DGFYTSVGYQIGE-AAQMVKNTKGIQELSDNY-452—QTINQELGRNPFRK-VGIVN-SQTNNGAMNGIGIQVGYKQFFGQ———KRKWGARYYGFFDYNHAFIKSSFFN———SASDVWTYGFGADALYNFINDKATNFLG——
HP1342 MKKSLLLSLSLIASLSRAED———DGFYTSVGYQIGE-AVQQVKNTGALQNLADRY-436—QTIAQELGKNPFRR-FGVID-FQNNNGAMNGIGVQVGYKQFFGK———KRNWGLRYYGFFDYNHAYIKSNFFN———SASDVWTYGVGMDALYNFINDKNTNFLG——
HP0227 MKKSLLLSLSLIASLSRAED———DGFYTSVGYQIGE-AVQQVKNTGALQNLADRY-436—QTIAQELGKNPFRR-FGVID-FQNNNGAMNGIGVQVGYKQFFGK———KRNWGLRYYGFFDYNHAYIKSNFFN———SASDVWTYGVGMDALYNFINDKNTNFLG——
HP1177 MKKTKKTILLSLTLAASLLHAED———NGVFLSVGYQIGE-AVQKVKNADKVQKLSDTY-385———QELGNNPFRN-MGMIASSTTNNGALNGLGVQVGYKQFFGE———KKRWGLRYYGFFDYNHAYIKSNFFN———SASDVWTYGVGSDLLFNFINDKNTNFLG——
HP0722 MKKTILLSLSLSL_SSLLHAED———NGFFVSAGYQIGE_AVQMVKNTGELKNLNEKY-392—NQALAAMSNNPFKK-VGMIS-SQNNNGALNGLGVQVGYKQFFGE———SKRWGLRYYGFFDYNHGYIKSSFFN———SSSDIWTYGGGSDLLVNIINDSITR———-
HP0725 MKKTILLSLSL_ASSLLHAED———NGFFVSAGYQIGE-AVQMVKNTGELKNLNEKY-401—NQALAAMSNNPFKK-VGMIS-SQNNNGALNGLGVQVGYKQFFGE———SKRWGLRYYGFFDYNHGYIKSSFFN———SSSDIWTYGGGSDLLVNIINDSITR———-
HP0009 MKKTLLLSLSLSLS_SSLLNAED———NGFFISAGYQIGE-AAQMVKNTGELKKLSDTY-420—LSATQELGHNPFRR-VGLIS-SQTNNGAMNGIGVQIGYKQFFGE———KRRWGLRYYGFFDYNHAYIKSSFFN———SASDVFTYGVGTDVLYNFINDKAT————
HopD HP0025 MKKKFLSLTLGSLLVSALSAED———NGFFVSAGYQIGE-SAQMVKNTKGIQDLSDSY-457—QSRSQELGSNPFRR-AGLIAASTTNNGAMNGIGFQVGYKQFFGK———NKRWGARYYGFVDYNHTYNKSQFFN———SDSDVWTYGVGSDLLVNFINDKAT————
HopA HP0229 MKKTILLSLMVSSLLAEN———DGVFMSVGYQIGE-AVQQVKNTGEIQKVSNAY-245—QTTTKEFGHNPFRS-VGLIN-SQSNNGAMNGVGVQLGYKQFFGK———NKFFGIRYYAFFDYNHAYIKSNFFN———SASNVFTYGAGSDLLLNFINGGSD————
HopC HP0912 MIKKNRTLFLSLALCASISYAED———DGGFFTVGYQLGQ-VMQDVQNPGGAKSDELAR-266—NALNNQVRSMPYLPQFRAGN—SRSTNILNGFYTKIGYKQFFGK———KRNIGLRYYGFFSYNGASVGFRSTQ———NNVGLYTYGVGTDVLYNIFSRSY————-
HopB HP0913 MKQNLKPFKMIKENLMTQSQKVRFLAPLSLALSLSFNPVGAEE———DGGFMTFGYELGQ-VVQQVKNPGKIKAEELAG-262—TALNNELKANPWLGNFAAGN—SSQVNAFNGFITKIGYKQFFGE———NKNVGLRYYGFFSYNGAGVGNGPTY———NQVNLLTYGVGTDVLYNVFSRSF————-
HP1156 MQNFVFSKKWLICSSLLPLFFLNPLAAED———DGFFMGVSYQTSL-AIQRVDNSGLNASQAAST-443—QTKVNQVYQMGFARNFLE-H—NSNSNNMNGFGVKMGYKQFFGK———KRMFGLRYYGFYDFGYAQFGAESSL———VKATLSSYGAGTDFLYNVFTRKR————-
HP0252 MKNHSFKKTIALSLLASMSLCRAEE———DGAFFVIDYQTSL-ARQELKNPGFTQAQELRQ-238—ESSASSLYKISYIPNLFSLK—DYQSASMNGFGAKMGYKQFFTH———KKNVGLRYYGFLDYGYANFGDTNLK———VGANLVTYGVGTDFLYNVYERSR————-
HP1157 MIKKARKFIPFFLIGSLLAED———NGWYMSVGYQIGG-TQQFINNKQLLENQNIIN-975—QNQANNYGSQPVLSQYAAAK—STQHGMSNGLGVGLGYKYFFGK———ARKLGLRHYFFFDYGFSEIGLANQS———VKANIFAYGVGTDFLWNLFRRTY————-
HP0254 MKNTNTKEIKNTRMKKGYSSIPRAQKRAFKNALLFSLPLSVALAED———DGFYMGVGYQIGG-AQQNIDNKGSTLRNNVIN-204—————-EPYLPQFGPGT—SSQHGVINGFGIQVGYKQFFGN———KRNIGLRYYAFFDYGFTQLGSLSSA———VKANIFTYGAGTDFLWNIFRRVF————-
HP1395 MKKIFSQSLLALVVSVNALLAMDG———NGVFIGAGYLQGQ-AQMHADIN—————————————————-SQKQATSATIKGFDALLGYQFFFG————KYFGLRLYGFFDYAHANSIRLKNP—30—FEPNMLTYGGAMDVMVNVI——————-
HP0472 MIKRIACILSLSTSLALAGEV———NGFFMGAGYQQGR-YGPYNSN——————————————————YSDWRHGNDLYGLNFKLGFVGFA————NKWFGARVYGFLDWFNTSGTEH————-TKTNLLTYGGGGDLIVNLI——————-
HP0923 MQFQKALLHSSFFLPLFLSFCIAEE———NGAYASVGFEYSI-SHAVEHNNPFLNQERIQI-113——-QIAAISNSLNA-LDPNS-YSKNISSMYGVSLSVGYKHFFTK———KKNQGLRYYLFYDYGYTNFGFVGNG—-4—GKMNNHLYGLGIDYLYNFIDN—————-
HP0477 MQKALLHSSFFLPLFLSFCIAEE———NGAYASVGFEYSI-SHAVEHNNPFLNQERIQI-113——-QIAAISNSLNA-LDPNS-YSKNISSMYGVSLSVGYKHFFTK———KKNQGLRYYLFYDYGYTNFGFVGNG—-4—GKMNNHLYGLGIDYLYNFIDN—————-
HP0079 MKKSFKKLGFVSLAASGVLLGSMNATD———LETYAALQKSSHV-FGNYAEKDKDSKLTSDSP-278—HKNIQTAVAQAQETYTPSVI-NTNNYGQMYGVDAMAGYKWFFGK———TKRFGFRSYGYYSYNHANLSFVGSQ—-7—SQVNNFTYGVGFDVLYNFYES—————-
HP1501 MLNFMTKKKNRMQDCKMVCKNFNRKESVLIAQS—47—NAYKNGELFQVPF-GDVSANDDGKVPDGQTGG—17————VVNWTSRTMLSTNKNIPGRNQPMYGLGVMTGYKHFIGK———KRWFGLRYYGFFDYGHTNFSNSRAA—10—QKADMYTYGFGTDMLFNII——————-
HP1469 MLKRMILLGALGVLASAEE———SAAFVGVNYQVSM-IQNQTKMVNDN——————————————-GLQK-PLIKFPPYAGAGFEVGYKQFFGK———KKWFGMRYYGFFDYAHNRFGVMKKG—29—YYVNLFTYGVGLDTLWNFV——————-
HP0671 MKKFVVFKTLCLSVVLGNSLVAAEG—21—NAWYLGISYQVGQ-ASQSVKN———————————PPKSSEFNYPKFPVGKTDY-LAVMQGLGLTVGYKQFFGE———KRWFGARYYGFMDYGHAVFGANALT—21—NLSDMFTYGVGIDTLYNVI——————-
HP0324 MKLNLQEIQLRTLLKMLVGASLLTHALIAKEE—-7—KNLYMGVNYQTGS-INLMTN———————-5—EVTNYQTGYTNIITSVNSVK—KLTNMGSNGIGLVMGYNHFFHP———DKILGLRYFAFLDWQGYGMRYPKGY—-1—GGNNMITYGVGVDAVWNFFQGSFYQ———-
HP1107 MNKTTVKILMGMALLSSLQAAEA—14—NTFYLGVGYQLSA-INTSFST—————————————————-ESVDKSYFMTGNGFGVVLGGKFVAKTQA——VEHVGFRYGLFYDQTFSSHKSY————-ISTYGLEFSGLWDAFN————————
HP1113 MKRALYLILGLFYTLNAES—27—SAFYLGLGYQLGS-IQHNSSNLN—————————LSQQFNKSQIIFSDSLSPVFKNSYVSNGLGVQVGYKWVGKHEE——TKWFGFRWGLFYDLSASLYGQKES———-QSVIISTYGTYMDLLLNAY——————-
HP0127 MKKSVIVGAISLAMTSLLSAET—17—NAAFIGIDYQLGM-LSTTAQN——————-22—TASNPTGGFTHGALGTRGYKGLSNQQYAINGFGFVVGYKHFFKK———SPQFGMRYYGFFDFASSYYKYYTYN—10—SQSFMFGYGAGTDVLFNPAIF—————-
HopE HP0706 MKKFVALGLLSAVLSSSLLAEG———DGVYIGTNYQLGQ-ARLNSNIYN—————-11—PPGLTANKHNPGGT-NINWH-AKYANGALNGLGLNVGYKKFFQFKSFDMTSKWFGFRVYGLFDYGHATLGKQVYA—-3—IQLDMVSWGVGSDLLADII——————-
members of this family have one domain of similarity at the amino-terminal end
of these OMPs share extensive similarity over their entire length. Four of the
and seven domains of similarity at their carboxy-terminal end. Note that the first 11
protein family of H. pylori. These proteins were identified as OMPs based on the
characteristic alternating hydrophobic residues at their carboxy termini. All
Figure 3 Multiple sequence alignment of members of the outer membrane
terminal sequences, represented at the top of the alignment50. The most likely
OMPs were identified as porins (Hops) based on identity to published amino-
HP0796 MNKLLKRGFLAFFLSVYLRADD—-5—IIKEKDLGYQRFL-AKK————————-29—YYGTSVVQMSWLQSREKFENHSKYRDIPFAEVSLIYGYKQFFPK———KERYGFRFYVSLDYAYGFFLKNKGV—23—TFINAIFYGAGADFLY————————
HP0638 MKKALLLTLSLSFWLHAER———NGFYLGLNFLEGS-YIKGQGS——————-28—IRDAQNALNAVKDSNKIASRFAGNGGSGGLFNELSFGYKYFLGK———KRIIGFRHSLFFGYQLGGVGSVPGS———GLIVFLPYGFNTDLLINWTNDKRASQKY—30
shifts are associated with the presence of dinucleotide repeats (Table 3).
HP0638 —HVFRKSSGLVIGMELGGSTWFASNN—————————-LTPFNQVKSRTIFQLQGKFGVRWNNDEYDIDRYGDEIYLG—GSSVELGVKVPAFKVNYYSDDYG———DKLDYKRVVSVYLNYTYNFKNKH 329
cagII
2
NCTC 11638 The rest of this Genbank entry corresponds to sequences between 483000
ORF# 1 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 in the genome of strain 26695
Cag I cagTCagS IS605 IS605
TnpA TnpB picB picA cagA
~97% 533 ? X ?X
26695
515 516 517 518 519 521 523 524 525 526 527 528 529 530 531 532 534 535 536 537 538 539 540 541 542 543 544 545
546 547 548/549 550 551
HslV HslU Era VirD4 VirB11/ VirB10/axoneme- VirB9/TraO/ cagT cagS VirB4/TraB/PtlC DNA glr rpl31
520 522 associated protein PtlG Lipo
TraG helicase
IM IM IM IM IM IM IM IM
R
CCUG 17874
NCTC 11638 cag # T S Q PO M N L I H G F E D C B A W glr
is 605
/ /
tnpA tnpB tnpA tnpB cagI
IS 605 IS 605
Figure 4 Comparison between the Cag pathogenicity islands of the sequenced (IM)47. Although the two PAI are ,97% identical at the nucleotide level, there are
strain, 26695 and the NCTC11638 strain. The twenty nine ORFs of the contiguous several notable and perhaps biologically relevant differences between the two
PAI in strain 26695 are represented together with the corresponding ORFs from sequences. Four of the genes differ in size. In the PAI of strain 26695, HP 520 and
the PAI present in NCTC11638 (AC000108 and U60176). The PAI in NCTC11638 is 521 are shorter, whereas HP523 is longer, and HP 527 actually spans both ORF13
divided by the IS 605 elements into two regions, cagI and cagII. The PAI in and 14. In addition, the N-terminal part of HP527 is 129 amino acids longer than the
NCTC11638 is flanked by a 31-bp (TTACAATTTGAGCCCATTCTTTAGCTTGTTTT) corresponding region in ORF14. HP548/549 contains a frameshift and is therefore
direct repeat (vertical arrows) as described11. Some of the genes encode proteins probably inactive in strain 26695. The stippled box preceding ORF13 represents
with similarity to proteins involved either in DNA transfer (Vir and Tra proteins) or in an N-terminal extension not annotated in the Genbank entry for the PAI of
export of a toxin (Ptl protein)10. However, these genes do not have the conserved NCTC11638. The ‘x’ indicates ORFs that are neither GeneMark-positive nor
contiguous arrangement found in the VirB, Tra and Ptl operons, suggesting that GeneSmith-positive, so were not included in our gene list. However, these
this PAI is not derived from these systems. Most genes of the PAI have no ORFs may be biologically significant. We do not represent cagR as an ORF,
database match, contrary to a previous suggestion11. Thirteen of the proteins have because it is completely contained within ORFQ, and is GeneMark-negative.
a signal peptide (squiggle line), three of them with a weaker probability (squiggled
line+?). The average length of the signal peptides is 25 amino acids, suggesting
that this PAI is of Gram-negative origin. Eight proteins are predicted to have at
least two membrane-spanning domains and to be integral membrane proteins
1,974 aa
HP0610
2,529 aa
HP0922
2,932 aa
HP0289
1,306 aa
HP0887
(VacA) CC
37K 58K 33K
hydrophilic cleavage hydrophobic
domain domain domain
Figure 5 Conserved domains of VacA and related proteins. HP887 is the AKNDKXES) and is not conserved in the other three VacA-related proteins. The
vacuolating cytotoxin (vacA) gene from H. pylori 26695 strain. HP610, HP922 and cleavage domain (black boxes) of VacA contains a pair of Cys residues 60
HP289 are related proteins. Blocks of aligned sequence and the length of each residues upstream from the site at which the C terminus is cleaved. These
protein are shown. Arrows designate the extents of each VacA domain. The residues are not conserved in the other three proteins. The 33K C-terminal
hydrophilic domain (blue boxes) contains the site in VacA at which the N-terminal hydrophobic domain (red boxes) in VacA is thought to form a pore through which
domain is cleaved into 37K and 58K fragments. The putative cleavage site the toxin is secreted. The other three proteins show 26–31% sequence similarity
(ANNNQQNS) differs from that of three cytotoxic strains (CCUG 1784, 60190, G39; to VacA in this region. The other coloured boxes represent regions of similarity.
betaine, proline
oppA ectoine, glycine
dipeptid proWX
es Fe3+
feuA
oppC
A
gluta dpp
min
e dppC Cu2+
H
gln
oppD fec
P B proV D
gln pp dppF
P)
d
op
) (c
pD Fe2+
Q dp fec
gln
pA
E
xA
ni
(co
nM
e
as
gl
P
nQ
AT
gl
oB
Na+
pe
fe
ty
P-
H+ Serine Cysteine
Hpn- Glycine
Ent
hyd Proline
ABCD like Folic acid Glutamate
ner
Tryptophan
LPS
udo
? Tyrosine + Mg2+
Chorismate corA
2 e- PEP Phenylalanine
rof
f
Quinone ppc
e- Methionine
pps
Pool Threonine
Lactate
e- Pyruvate
e - + FADH 2
dld + FAD Lactate Oxaloacetate
aspC
Aspartate Lysine
H+ Pool
kefB
Aspartate Valine dld Pyruvate
Cytochrome Ethanol gltA
aceEF
Cytochrome Citrate
por
Dihydroxy-acetone-P
pfl
+ FADH2 acnB K+
? Fatty Acid Biosynthesis Biotin Biosynthesis Pathway
Pantothenate CoA Acetyl-CoA ? Biotin
glpD pta NO3-
Pantothenate / Malate
Acetyl-CoA Pathway Isocitrate
fumA Purine
glycerol-3-P + FAD Acetyl phosphate icd De novo Purine Biosynthesis
Salvage
frdABC Pathway IMP G GdR nar
succinate ackA XMP GMP K
2-oxoglutarate NO2-
Acetate
frd gdhA
ABC HCO3- Aspartate PRPP
2H+ + Fumarate HI1
60
4 PO42-
ADP, Pi Pyrimidine Biosynthesis
H+ e modA
as MoO42-
TP fumarate
-A pnuC
F1
F0
malate
cE
ro
nupC
pro
Nicotinamide
mononucleotide
gA
ith e
ine
kgtP
ornginin
da
ec tain e
Pyrimidine
toi e
be olin
S
ne
glt
tP
nucleosides
ar
dcuA
gly serin e
pu
pr
SODiT1
D- alanin
lctP
cin e
sda
a-keto-
gluP
e
glutarate
ate
line
D-
succinate
tam
e
pro
serin
oxoglutarate L-lactate
glu
glucose,
galactose
Figure 6 Solute transport and metabolic pathways of Helicobacter pylori. import under anaerobic conditions for cytochromes, catalase). An integrated
Transporters identified by sequence comparisons are characteristc of Gram- view of the main components of the central metabolism of H. pylori strain 26695 is
negative bacteria. Colours correspond to transport role categories defined by presented. The use of glucose as the sole carbohydrate source is emphasized.
Riley15: blue, amino acids, peptides and amines; red, anions; yellow, carbohy- Urease, a multisubunit Ni2+-binding enzyme, is crucial for colonization and for
drates, organic alcohols and acids; green, cations; and purple, nucleosides, survival of H. pylori at acid pH, and is indicated as a complex (purple circle) with
purines and pyrimidines. Numerous permeases (ovals) with specificity for Hpn, a Ni2+-binding cofactor, and a newly identified Hpn-like protein (HP1432). A
amino acids (recE, proP, dagA, gltS, putP and sdaC) or carbohydrates (SODiTl, question mark is attached to pathways that could not be completely elucidated.
gluP, lactP, cduA, kgtP) import organic nutrients. Structurally related permease Pathways or steps for which no enzymes were identified are represented by a
proteins maintain ionic homeostasis by transporting HPO2− 2−
4 (HI1604), NO3 (narK), red arrow. Pathways for macromolecular biosynthesis (RNA, DNA and fatty
and Na+ (nhA, napA). Primary active-transport systems, independent of the acids) have been omitted. ackA, acetate kinase; acnB, aconitase B; aspC,
proton cycle, are also apparent. Included in this group are ATP-binding protein- aspartate aminotransferase; dld, D-lactate dehydrogenase; gdhA, glutamate
cassette (ABC) transporters (composite figures of 2 diamonds, 2 circles, 1 dehydrogenase; glnA, glutamine synthetase; gltA citrate synthase; HydABC,
oval) for the uptake of oligopeptides (oppACD), dipeptides (dppABCDF), proline hydrogenase complex; icd, isocitrate dehydrogenase; pfl, pyruvate formate
(proVWX), glutamine (glnHMPQ), molybdenum (modABD), and iron III (fecED), P- lyase; por, pyruvate ferredoxin oxidoreductase; ppc, phosphoenolpyruvate car-
type ATPases that extrude toxic metals from the cell (copAP and cadA), and the boxylase; pps, phosphoenolpyruvate synthase; pta, phosphate acetyltransfer-
glutathione-regulated potassium-efflux protein (kefB). Transporters for the accu- ase; gldD, glycerol-3-phosphate dehydrogenase; NDH-1, NADH–ubiquinone
mulation of ionic cofactors are encoded by nixA (Ni2+ for urease activation), corA oxidoreductase complex.
(Mg2+ for phosphohydrolases, phosphotransferases, ATPases) and feoB (Fe2+
AMINO-ACID BIOSYNTHESIS HP0841 pantothenate metabolism flavoprotein (dfp) 31.3% HP0855 alginate O-acetylation protein (algI) 41.8%
General HP0326 CMP-N-acetylneuraminic acid synthetase
HP0695 hydantoin utilization protein A (hyuA) 28.6% Pyridoxine (neuA) 31.9%
HP1583 pyridoxal phosphate biosynthetic protein HP0230 CTP:CMP-3-deoxy-D-manno-octulosonate-
Aromatic amino-acid family
A (pdxA) 34.2% cytidylyl-transferase (kdsB) 36.2%
HP1038 3-dehydroquinase type II (aroQ) 99.4%
HP1582 pyridoxal phosphate biosynthetic protein J HP1392 fibronectin/fibrinogen-binding protein 25.7%
HP0283 3-dehydroquinate synthase (aroB) 38.1%
(pdxJ) 42.6% HP0379 fucosyltransferase 39.2%
HP0134 3-deoxy-D-arabino-heptulosonate
Riboflavin HP0651 fucosyltransferase 39.2%
7-phosphate synthase (dhs1) 54.6%
HP0802 GTP cyclohydrolase II (ribA) 47.2% HP0044 GDP-D-mannose dehydratase (rfbD) 62.1%
HP0401 3-phosphoshikimate
HP0804 GTP cyclohydrolase II/3,4-dihydroxy-2-butanone HP0867 lipid A disaccharide synthetase (lpxB) 32.0%
1-carboxyvinyltransferase (aroA) 53.6%
4-phosphate synthase (ribA, ribB) 44.0% HP0159 lipopolysaccharide 1,2-glucosyltransferase
HP1279 anthranilate isomerase (trpC) 47.0%
HP1505 riboflavin biosynthesis protein (ribG) 33.1% (rfaJ) 28.9%
HP1282 anthranilate synthase component I (trpE) 47.9%
HP1087 riboflavin biosynthesis regulatory protein HP0208 lipopolysaccharide 1,2-glucosyltransferase
HP1280 anthranilate synthase component II (trpD) 42.5%
(ribC) 28.9% (rfaJ) 26.7%
HP1281 anthranilate synthase component II (trpD) 40.2%
HP1574 riboflavin synthase alpha subunit (ribC) 32.8% HP0805 lipooligosaccharide 5G8 epitope biosynthesis-
HP0663 chorismate synthase (aroC) 47.2%
HP0002 riboflavin synthase beta chain (ribE) 52.4% associated protein (lex2B) 36.9%
HP1380 prephenate dehydrogenase (tyrA) 30.2%
HP0826 lipooligosaccharide 5G8 epitope biosynthesis-
HP1249 shikimate 5-dehydrogenase (aroE) 36.6% Thioredoxin, glutaredoxin and glutathione
associated protein (lex2B) 39.2%
HP0157 shikimic acid kinase I (aroK) 36.1% HP1118 gamma-glutamyltranspeptidase (ggt) 53.2%
HP1416 lipopolysaccharide 1,2-glucosyltransferase
HP1277 tryptophan synthase, alpha subunit (trpA) 46.5% HP1458 thioredoxin 38.3%
(rfaJ) 29.2%
HP1278 tryptophan synthase, beta subunit (trpB) 66.1% HP0824 thioredoxin (trxA) 51.5%
HP0679 lipopolysaccharide biosynthesis protein
Aspartate family HP1164 thioredoxin reductase (trxB) 28.5%
(wbpB) 42.8%
HP0649 aspartate ammonia-lyase (aspA) 55.5% Thiamine HP1475 lipopolysaccharide core biosynthesis protein
HP1189 aspartate-semialdehyde dehydrogenase HP0814 thiamin biosynthesis protein (thiF) 34.6% (kdtB) 49.0%
(asd) 45.7% HP0843 thiamin phosphate pyrophosphorylase/ HP0279 lipopolysaccharide heptosyltransferase-1
HP1229 aspartokinase (lysC) 48.0% hyroxyethylthiazole kinase (thiB) 35.7% (rfaC) 31.7%
HP0106 cystathionine gamma-synthase (metB) 47.7% HP0845 thiamin phosphate pyrophosphorylase/ HP0619 lipopolysacharide biosynthesis glycosyl
HP0290 diaminopimelate decarboxylase hyroxyethylthiazole kinase (thiM) 37.9% transferase (lic2B) 37.2%
(dap decarboxylase) (lysA) 42.7% HP0844 thiamine biosynthesis protein (thi) 41.0% HP1105 LPS biosynthesis protein 28.7%
HP0566 diaminopimelate epimerase (dapF) 30.0% Pyridine nucleotides HP1578 LPS biosynthesis protein 28.1%
HP0510 dihydrodipicolinate reductase (dapB) 95.3% HP0329 NH(3)-dependent NAD+ synthetase (nadE) 37.5% HP1581 methicillin resistance protein (llm) 29.2%
HP1013 dihydrodipicolinate synthetase (dapA) 39.5% HP1355 nicotinate-nucleotide pyrophosphorylase HP0857 phosphoheptose isomerase (gmhA) 44.5%
HP0822 homoserine dehydrogenase (metL) 37.7% (nadC) 36.3% HP1275 phosphomannomutase (algC)
HP1050 homoserine kinase (thrB) 27.7% HP1356 quinolinate synthetase A (nadA) 34.2% {Pseudomonas aeruginosa} 39.6%
HP0672 solute-binding signature and mitochondrial HP1429 polysialic acid capsule expression protein
signature protein (aspB) 47.3% CELL ENVELOPE (kpsF) 46.0%
HP0212 succinyl-diaminopimelate desuccinylase HP0366 spore coat polysaccharide biosynthesis
Membranes, lipoproteins and porins
(dapE) 42.3% protein C 35.3%
HP1450 60 kDa inner-membrane protein 40.0%
HP0626 tetrahydrodipicolinate N-succinyltransferase HP0178 spore coat polysaccharide biosynthesis
HP0180 apolipoprotein N-acyltransferase (cute) 28.0%
(dapD) 36.1% protein E 36.2%
HP0175 cell binding factor 2 34.9%
HP0098 threonine synthase (thrC) 32.9% HP0421 type 1 capsular polysaccharide biosynthesis
HP0078 Hypothetical protein 28.4%
Glutamate family HP0567 membrane protein 26.4% protein J (capJ) 29.0%
HP0380 glutamate dehydrogenase (gdhA) 59.0% HP1456 membrane-associated lipoprotein (lpp20) 98.9% HP0196 UDP-3-0-(3-hydroxymyristoyl) glucosamine
HP0512 glutamine synthetase (glnA) 48.6% HP1564 outer membrane protein 39.9% N-acyltransferase (lpxD) 39.5%
HP1158 pyrroline-5-carboxylate reductase (proC) 28.9% HP0009 outer membrane protein (omp1) 0.0% HP1052 UDP-3-0-acyl N-acetylglcosamine deacetylase
Pyruvate family HP0324 outer membrane protein (omp10) 0.0% (envA) 44.6%
HP0941 alanine racemase, biosynthetic (alr) 32.4% HP0472 outer membrane protein (omp11) 99.5% HP1375 UDP-N-acetylglucosamine acyltransferase
HP1468 branched-chain-amino-acid HP0477 outer membrane protein (omp12) 0.0% (lpxA) 41.8%
aminotransferase (ilvE) 63.5% HP0638 outer membrane protein (omp13) 0.0% Surface structures
HP0330 ketol-acid reductoisomerase (ilvC) 48.1% HP0671 outer membrane protein (omp14) 36.0% HP0840 flaA1 protein 60.2%
Serine family HP0706 outer membrane protein (omp15) 33.5% HP0325 flagellar basal-body L-ring protein (flgH) 32.7%
HP0107 cysteine synthetase (cysK) 45.7% HP0722 outer membrane protein (omp16) 43.3% HP0351 flagellar basal-body M-ring protein (fliF) 34.4%
HP0096 phosphoglycerate dehydrogenase 31.0% HP0725 outer membrane protein (omp17) 43.3% HP0246 flagellar basal-body P-ring protein (flgI) 37.9%
HP0397 phosphoglycerate dehydrogenase (serA) 32.5% HP0796 outer membrane protein (omp18) 0.0% HP1557 flagellar basal-body protein (fliE) 37.0%
HP0736 phosphoserine aminotransferase (serC) 30.7% HP0896 outer membrane protein (omp19) 36.6% HP1559 flagellar basal-body rod protein (flgB)
HP0652 phosphoserine phosphatase (serB) 36.5% HP0025 outer membrane protein (omp2) 0.0% (proximal rod protein) 31.0%
HP1210 serine acetyltransferase (cysE) 98.2% HP0912 outer membrane protein (omp20) 0.0% HP1558 flagellar basal-body rod protein (flgC)
HP0183 serine hydroxymethyltransferase (glyA) 54.0% HP0913 outer membrane protein (omp21) 38.2% (proximal rod protein) 46.0%
HP0923 outer membrane protein (omp22) 0.0% HP1092 flagellar basal-body rod protein (flgG) 35.5%
BIOSYNTHESIS OF COFACTORS, PROSTHETIC GROUPS, HP1107 outer membrane protein (omp23) 0.0% HP1585 flagellar basal-body rod protein (flgG) 47.7%
AND CARRIERS HP1113 outer membrane protein (omp24) 36.0% HP1041 flagellar biosynthesis protein (flhA) 43.1%
HP1156 outer membrane protein (omp25) 0.0% HP1035 flagellar biosynthesis protein (flhF) 35.5%
General HP0684 flagellar biosynthesis protein (fliP) 43.4%
HP1157 outer membrane protein (omp26) 23.0%
HP0220 synthesis of [Fe-S] cluster (nifS) 48.0% HP0770 flagellar biosynthetic protein (flhB) 38.7%
HP1177 outer membrane protein (omp27) 37.0%
Biotin HP1243 outer membrane protein (omp28) 0.0% HP0685 flagellar biosynthetic protein (fliP) 55.6%
HP0598 8-amino-7-oxononanoate synthase (bioF) 34.9% HP1342 outer membrane protein (omp29) 0.0% HP1419 flagellar biosynthetic protein (fliQ) 52.3%
HP0976 adenosylmethionine-8-amino-7-oxononanoate HP0079 outer membrane protein (omp3) 0.0% HP0173 flagellar biosynthetic protein (fliR) 26.4%
aminotransferase (bioA) 49.2% HP1395 outer membrane protein (omp30) 0.0% HP0353 flagellar export protein (fliH) 29.1%
HP1140 biotin operon repressor/biotin acetyl coenzyme HP1469 outer membrane protein (omp31) 0.0% HP1420 flagellar export protein ATP synthase (fliI) 47.6%
A carboxylase synthetase (birA) 36.9% HP1501 outer membrane protein (omp32) 0.0% HP0870 flagellar hook (flgE) 98.9%
HP0407 biotin sulfoxide reductase (bisC) 42.7% HP0127 outer membrane protein (omp4) 0.0% HP0908 flagellar hook (flgE) 30.5%
HP1254 biotin synthesis protein (bioC) 32.1% HP0227 outer membrane protein (omp5) 36.8% HP1119 flagellar hook-associated protein 1
HP1406 biotin synthetase (bioB) 36.2% HP0229 outer membrane protein (omp6) 38.4% (HAP1) (flgK) 27.6%
HP0029 dethiobiotin synthetase (bioD) 36.0% HP0252 outer membrane protein (omp7) 30.6% HP0752 flagellar hook-associated protein 2 (fliD) 28.9%
Folic acid HP0254 outer membrane protein (omp8) 37.6% HP0815 flagellar motor rotation protein (motA) 32.9%
HP1036 7, 8-dihydro-6-hydroxymethylpterin- HP0317 outer membrane protein (omp9) 36.3% HP0816 flagellar motor rotation protein (motB) 29.7%
pyrophosphokinase (folK) 34.6% HP0839 outer membrane protein P1 (ompP1) 23.3% HP0352 flagellar motor switch protein (fliG) 37.0%
HP0587 aminodeoxychorismate lyase (pabC) 32.4% HP0955 prolipoprotein diacylglyceryl transferase (lgt)34.4% HP1031 flagellar motor switch protein (fliM) 34.4%
HP1232 dihydropteroate synthase (folP) 34.5% HP0655 protective surface antigen D15 27.5% HP0753 flagellar protein (fliS) 32.3%
HP1545 folylpolyglutamate synthase (folC) 35.2% HP1571 rare lipoprotein A (rlpA) 37.6% HP0327 flagellar protein G (flaG) 23.3%
HP0928 GTP cyclohydrolase I (folE) 50.9% HP0610 toxin-like outer membrane protein 26.3% HP0797 flagellar sheath adhesin hpaA 98.5%
HP0577 methylene-tetrahydrofolate dehydrogenase HP0922 toxin-like outer membrane protein 29.5% HP0584 flagellar switch protein (fliN) 39.7%
(folD) 48.4% HP0289 toxin-like outer membrane protein 30.6% HP0601 flagellin A (flaA) 99.8%
HP0293 para-aminobenzoate synthetase (pabB) 35.1% Murein sacculus and peptidoglycan HP0115 flagellin B (flaB) 99.0%
Haem and porphyrin HP0830 amidase 40.6% HP0295 flagellin B homologue (fla) 32.9%
HP0163 delta-aminolevulinic acid dehydratase HP0738 D-alanine:D-alanine ligase A (ddlA) 28.5% HP1575 flhB protein (flhB) 40.5%
(hemB) 50.5% HP0549 glutamate racemase (glr) 36.6% HP1030 fliY protein (fliY) 29.3%
HP0376 ferrochelatase (hemH) 33.4% HP0772 N-acetylmuramoyl-L-alanine amidase (amiA)26.8% HP0907 Hook assembly protein, flagella (flgD) 25.5%
HP0306 glutamate-1-semialdehyde 2,1-aminomutase HP0597 penicillin-binding protein 1A (PBP-1A) 33.7% HP1274 paralysed flagella protein (pflA) 23.9%
(hemL) 51.3% HP1565 penicillin-binding protein 2 (pbp2) 35.0% HP0751 polar flagellin (flaG) 21.9%
HP0239 glutamyl-tRNA reductase (hemA) 32.7% HP1125 peptidoglycan associated lipoprotein precursor HP0410 putative neuraminyllactose-binding
HP0665 oxygen-independent coproporphyrinogen III (omp18) 42.6% haemagglutinin homologue (hpaA) 24.2%
oxidase (hemN) 42.4% HP0493 phospho-N-acetylmuramoyl-pentapeptide- HP1192 secreted protein involved in flagellar motility72.5%
HP1226 oxygen-independent coproporphyrinogen III transferase (mraY) 45.2% HP1462 secreted protein involved in flagellar motility96.2%
oxidase (hemN) 37.9% HP0743 rod shape-determining protein (mreB) 37.7% HP0232 secreted protein involved in flagellar motility99.2%
HP0237 porphobilinogen deaminase (hemC) 45.7% HP1373 rod shape-determining protein (mreB) 51.9%
HP0381 protoporphyrinogen oxidase (hemK) 35.9% HP1372 rod shape-determining protein (mreC) 33.6% CELLULAR PROCESSES
HP0604 uroporphyrinogen decarboxylase (hemE) 46.3% HP0645 soluble lytic murein transglycosylase (slt) 32.2% General
HP1224 uroporphyrinogen III cosynthase (hemD) 27.6% HP1543 toxR-activated gene (tagE) 37.2% HP0019 chemotaxis protein (cheV) 26.8%
Menaquinone and ubiquinone HP1544 toxR-activated gene (tagE) 31.2% HP0393 chemotaxis protein (cheV) 31.7%
HP1360 4-hydroxybenzoate octaprenyltransferase HP1155 transferase, peptidoglycan synthesis HP0616 chemotaxis protein (cheV) 27.9%
(ubiA) 26.6% (murG) 28.2% HP1067 chemotaxis protein (cheY) 99.2%
HP0929 geranyltranstransferase (ispA) 39.8% HP0740 UDP-MurNac-pentapeptide presynthetase HP0517 GTP-binding protein (era) 95.6%
HP0240 octaprenyl-diphosphate synthase (ispB) 31.6% (murF) 25.7% HP1490 haemolysin 39.2%
HP1494 UDP-MurNac-tripeptide synthetase (murE) 36.0% HP1086 Haemolysin (tly) 40.2%
Molybdopterin HP1418 UDP-N-acetylenolpyruvoylglucosamine HP0599 haemolysin secretion protein precursor
HP0768 molybdenum cofactor biosynthesis reductase (murB) 32.7% (hylB) 45.4%
protein A (moaA) 31.4% HP0648 UDP-N-acetylglucosamine enolpyruvyl HP0392 histidine kinase (cheA) 41.4%
HP0798 molybdenum cofactor biosynthesis protein C transferase (murZ) 46.7% HP0099 methyl-accepting chemotaxis protein (tlpA) 32.8%
(moaC) 97.9% HP0623 UDP-N-acetylmuramate-alanine ligase HP0103 methyl-accepting chemotaxis protein (tlpB) 30.7%
HP0172 molybdopterin biosynthesis protein (moeA) 36.3% (murC) 37.3% HP0082 methyl-accepting chemotaxis transducer
HP0755 molybdopterin biosynthesis protein (moeB) 32.2% HP0494 UDP-N-acetylmuramoylalanine-D-glutamate (tlpC) 28.2%
HP0799 molybdopterin biosynthesis protein (mog) 50.8% ligase (murD) 31.1% HP0391 purine-binding chemotaxis protein (cheW) 34.3%
HP0801 molybdopterin converting factor, subunit 1
(moaD) 31.1% Surface polysaccharides, lipopolysaccharides and antigens Cell division
HP0800 molybdopterin converting factor, subunit 2 HP0003 3-deoxy-d-manno-octulosonic acid 8-phosphate HP0331 cell division inhibitor (minD) 50.2%
(moaE) 31.1% synthetase (kdsA) 53.4% HP0749 cell division membrane protein (ftsX) 25.7%
HP0769 molybdopterin-guanine dinucleotide biosynthesis HP0957 3-deoxy-d-manno-octulosonic-acid transferase HP0978 cell division protein (ftsA) protein 31.9%
protein A (mobA) 28.3% (kdtA) 35.9% HP0748 cell division protein (ftsE) 37.6%
HP0858 ADP-heptose synthase (rfaE) 40.6% HP0286 cell division protein (ftsH) 41.2%
Pantothenate HP1191 ADP-heptose-lps heptosyltransferase II HP1069 cell division protein (ftsH) 98.6%
HP1058 3-methyl-2-oxobutanoate hydroxymethyltransferase (rfaF) 33.2% HP1556 cell division protein (ftsI) 30.6%
(panB) 43.7% HP0859 ADP-L-glycero-D-mannoheptose-6-epimerase HP1090 cell division protein (ftsK) 39.8%
HP0034 aspartate 1-decarboxylase (panD) 50.0% (rfaD) 32.7% HP1560 cell division protein (ftsW) Escherichia coli 32.7%
HP0006 pantoate-beta-alanine ligase (panC) 44.2% HP0763 cell division protein (ftsY) 46.6%