Wargames Illustrated #114
Wargames Illustrated #114
-Lqqq
14   ilililuft|il[ililill|
 THE SG'UTH                        LONE'GIN WAFILG'FIEISi PFIESENT
5AL
                                                                                  -
                                                        tEftDtN
                                                     rHECAVAIRY
                                             SaturdayApril 12lh
                                                                           trcE l0.!| to lpn
                                            llcnalatlcr     .nd Ch.b..        foun Hrll, llcrntcn Str..l,          lcrdon     Wt
Salutehasthe rlght mi* aroundtilty otthe besttraders,well overthirty gameswith the usualmix
of peliods.And, as ever,Saluteplacesan emphaslson panicipationgamesso yOU get to play.
In addliion,allofthe regularfeaturesof Salutewill bethereincludingthefigurepaintingcompetition
and the Bar and Buftet.
Becauseof it's location,salute offers   Tdd.E .t sEtut€w t t.ct!d.:
easv accesslo travellers- tube and
rair;ay
     sra.ons,
          buses
              and
                an_                     ilillil"y'3iffi*i::;:.::&ffS",Ij'Hl"."nT::i"3J::ffiil?.':lJlilfffi:il?:"
extensive car park undemeath. By way    Ene.bumanies, NMr Miniatures,
                                                                   Museom  Mintabres,p6lerpiq,
                                                                                   snap&aqonstudio,      xth Legion,
ofachange, GuestofHonouron the          LanlionMiniatues,
                                                        Bnhnnia
                                                              Mlniarures,
                                                                       Adls Miniarures,             (GHo),Dalkslar,
                                                                                      chinemMiniatuGs
DavwillbeJason Salkev - Rffema,         P€ndrakonMiniatures,
                                                          Baccusauitdinos,
                                                                        k@g!t4Miniatures,Frqures,
                                                                                               Anour & AnileryLKM,
Hall,s
    rrom
       ihervserieJsra,pe Sflllifl;f,
                                 lll/"t?i;#""?fFiJ"",:l
                                                 i,il'^[:#i"",ll",fff[tli::ffi:JTl"J:J:1"]i
                                        S€tices,Dixo.Miniatures,
                                                             OldGloryColporalion,
                                                                               FedoublMi.iatures.
                                                                                               Second Chancecames,
Cometo Saluie 97and experience          waedes Foundry  andGlemseyFoundry scoliaMidoModels, caliverBooks,Grou.dzero
some ofthe bes hat wargaminghas         Gam€s,llebe$ DeshmrskyaiderMini.tlGs,HallmukFiguressrartunModels,
                                                                                                        R&AModers,
to oie.                                 unpprrqB€di.Gtadiatorcames8
                                                                 MairtyMiila,"y
                                                                              tonamFou alew
                                        and, 6 Mr pursuinqour polict of cifculalinqtrade*, nm al S.ld€ this yeaf wiil be: Red O6Oon,
                                        TheL2st\Alley,lT Fiqu@.,Magnelic Oisplayand   Coto.iatMiniatu€6!      a
                                                    "iti;'
                                        :'''''                  ;; l;rc-'j;iriiri'ii'ijri'rr
                                                                                           iir'c'
                                                                                               ;fil'.r;
                                        :                                    collectabl....*
                                        :             ^
                                        :            Qucuc BustcrBadgc
                                        : Sendf3.OOperbadge,in an envelope markedSalute96,witha chequeor
                                        : postalordermadepayableto ihe SoulhLondonWarlordsto JohnMerritt,
                                        : HonSec.The SouthLondon   Warlords
                                                                          16 Gainsborough
                                                                                        Square,CrookLog,
     HGHSTNEEIKENSINGTON                : BexleyheathKentDA68BU
                                        :               -
                                        : Pleasesend me L_lqueue      busterbadges.lenclosea cheoue/postal
                                        : ordermadepayableto theSouthLondonWarlordsfor I f        I anda
                                        : STOUT,stamoed, selladdressed enveloDe.
                                        : 'whie srocr.s
                                                     rarnobadseswi,
                                                             -post            t nArA     I
                                        '    be senl out lo applicalions
                                        :    markedlatertran Apdl4lh
                                        :
           'When
                     replying to adverts please nention lfargames Illustrated.
                       GeunsSpncrecuhR
                                     VI
                              OPENINGIIOURS:FridayApril 46: 12.00- 18.00 .
                        SaturdayApril 56: 09.30- 18.00 . Surd4yAprit 6rh:09.30- 18.00
EI{TMN(EIEE!
One day            f 15,00                         (Au.n At{D
                                                            BooKYouR
                                                                   RooM...
ENGIJSIITRADDNS      ATTENDINGINCITJDE:            Dookdir€ct n $p€r e.onomy1116(passwor( can6 Sp61aqJzr/
OldGlory                 Thufllerbolt Mountalo     999 GarD€.) NB: io. risitoB ad tr.ders:
Gho6tI'ltdatufes         Ra*&f      e Mtoiatures               Hoktty Im lhole +3040.233222
rnferor's Press          Stratagem/                             I pstls.110,2 p€rs.l4O,3 p€rs.195,4pc'j. zfr.
idayhemMldanri€s           m.gaoesuu$rafed                     Ircation:t20Onlr. frm show'Pool,ouBideperti4
Pl@secotne & sceus!                                            Doiba Phone+314G2326Ur
                                                               1pas.98,2 p€6 150,3pcrs.22t
Also free ables ior playes to s€tr{| iheh own                  tocnion:t5C'Ootr. AoDshow.P,ihnggrnge
games.
                                                               D.ys Intr +r1 24DE40100
                                                               I p..s. 7q 2 p€rs.100.
oRGI{TSATION,
            909ctrcs. nciolam70.                               Location:  5 mir Aon shw (ftc€shuttlca€rviccl
the Ndhcrhd! r3a?Jz
                  VEESP                                        PoolSonshcilitiG:bowtirg,tcorb .nd fm€s6.
Phoae+ 312911rry9,tu+3r291113525                         lI pric€sindudiog t r, lip, br€:ltur buff€rln htch Gild6
hstdc$ houtr mo.L-it 09.qH7.m
                            t       l
                            ml                                                            34 Copland Close
                                                                                          Basingstoke
                                                                                          Harts RG22 4JX
                                                                                          Ibl/Pa.x O1256817746
    Come and see us at "WMMS" Alufiwel V,/alsall, 9th March 97                                          IRIPI-ES97 Sheffield 15&16March97
         \= tl 20     B   € 1 6 0 c t 2 0 0 D = 1 2 2 5 E = ! 0 5 0 Pon& tackmg tI= l0o! m i n a 0 5 0 m a \ f 2 . 5 0 I E C 2 0 o o R c s . f $ o r l d          :]0oo
                          lrrm.ntbyLliCheque.Lt PoslOideE-           Intemariond \Ion.r Oidc6 .r F.urNhequ.s in ! !i pounds elYling
t{Ew      r..r.tfi   fi fi *r itEw     BwU5Lin6btn.ch8lgins                    FRE CHNAPOI€OXTCS-             Abo avdil6bl6in the folldins
8ffIlSH W lEit@                               I'ltfigs)..........,,,,....,,,
                                                                     fi a8o
              - llt Bd.@
II|APOIIOIII(Xi                        BWU6Linebtn.adv/chq.      hix           FC, Cui6$isr officgl           RNUI1 CossckBgimgnt
BWl U.e@[email protected]                                                    t16.80
                                              1401i9.1..,,,,.,...,,,,,,...,    FC8 CuiEsi6. trumpotor                   130fi         epso
                                                                                                                           suG).........
                                       AWUT6pdi loot baflsry13guns.            FC36 C!i6$isr Eagl6b€are.                 {f3t10     ftofr   1it Agdll
BW2 Un. cenrr€cohpany                         t2cr4)..,,,,,....,,.......
                                                                     t1460     FC46 CuiEsior campaignd|*
                                       BWU8gpdr,f@t batery(3gons,                                             NEW *ftfifii.ran.r*                 Ew
BW3 [email protected]                             l2 cr6w1...,,,,,,...,,,,,...
                                                                     f 146i)   Fqt   Cuirasier @mpaigndress
                                                                                                       PAUSS|A|{N^PTEOI$CS
                                       Al ng!reswoaring   ih€8!lgicsh.ko                               tdBtSt5
BW4 Linefrankconpany                   asisuedfbml8l2 FiguBen      FC4a Cuira$iercarnpdigndres         LRl2 B@rve infanry standing
                                       in€rrfoE beo*d ior lhe lan€rpart                                       li.ing,slovopip. shato
                                                                   A$.v.il!bl€ inlhetollding           lP33 R66N€ inlanrryb.ding
                                    tr ruiliA$$inf,UOtrgx)|l'fr                                               srovspips.hato
                                                                   FNU59    Cujrasierregimenl          !P34 R€setuoinlantrytulling
                                    A EAICAI{CMLWAR_                                                          mu.d.d, srovepipo
                                                                            F2 ng!r€.) ,..,..,,.f34.50
BWg Linetun*companyfidng                                                    {137.50rrom    t5t   Apil)
BWl0 Lineflankcompanyloading AC1i33 Anill.rypullinglanyard,                                            tlh€so fisu6s, rlo.g with othsr
8W1l Foot.nilbryoffier                                                                                 E6.NBh      ou.6.96,al6
BWl2 Foordrtillorywith potdire      AC1V34Anillery pullinglanya.d, NEW                           t{Ew suir.bl€forth6tsr & 2nd
BW13Foot6dillorywith 6mmor                                         RUSSTN tlAtiolaot{rcs               Eattalions20thR€gimontandth.
BW14Foorartjllgrywirh ound          AC1lt35Anillory$andingwith     tdlttSt5
BWl5 Footarlillerysbnding                                                                              LPC10  Hu$arwearinqforEgo
BWl6 F@tsrlallery {nh handspi*s ACW36Artill6rysianding      with
BWlt Footanill€ry  sighring gun                                                                        LPC1r Drsgoonw€Eringforag€
aW18Footanil.rypu$hing      wheel ACW37Artillerysponinqf.ll of
BWCI Moontedlineolfrcsr                                            Allarerearingrypi@l€mpaign
Ako d.iLbL inth.lollof,lng          ACW38Anillory spottingfall of
                                                                   dr€$ of @lpackandlaftan. d5
8WU1Ljnsbi.. adv..cino              ACW39Artill6rywilh hand5pike, womrhroughoutrhe      Napol6onic
                                                                                                              PRICEINCREASE
                                                                   warss.d ar€op€n-handsd      to
      {30fi9s1.....................
                            f 16.80                                r€ceiv€wiF  lan@ (not  suppli€d).     EFFECNVE    IST APRIL1997
BWU2tin6 hn. charging               ACW/OArtillerywirh ha.dspit.,                                         (Our trrd tor !E monrh.,
                                                                   Th€thr.€ troopeFarc all i.
      {30frgs)....,,,..........-...
                            416.80                                 diff€rcntposs wih varyinq           Fisur6,...,.............-........
                                                                                                                               [email protected]
BWU3line brn,ddv/d|g,mix            AFNU.EBYEOUIPMEIIT             oquiph.ntandre.ponsto qivs          HoF6.....,,,,....,,,,...,,,,,...,
                                                                                                                               m,70..ch
      (30fsd.....................               'Napoleon'
                            f i6.80 AE3t 12pdr,                    yourunitrharirr€gu16.  look,        EG1..................,,.....,,,,....
                                                                                                                               44,/{,eh
BWU4Linebtn,.dvancing                                                                                  SPKS..,,,,...,.,,..._......_.......
                                                                                                                               86.@@h
      (4Ongs),,,...,,,,...,,,,,..,
                            t16,80 AE32 lopdr Parott rifle                                             Anill.ry.quipmenr..,,,...
                                                                                                                               famech
HF,rSt**
g3Y"*:-**.-
S€ HBE**
HR. Bi*Ff;-'
IRt ffil--,b
flsr*H:-**,
UF *gHfd
ug l&s.vh
ruPF."*;,**
u#ffiP^,!*.**,-                                                       ftisl*-#r,*.,*".-"* *, *.
                                                                      s.*nlt";*"*,.**
                                                                      :l**-*-^"*--
                          & ROSFIGURES
                    HEROICS
      Unit12,Semington
                    Turnpike,
                            Semington,       WiltsBA146LB,England.
                                    Trowbridge,
                     Tel:01380             871045
                             870228Fax:01380
> b N.a rlrL., fisuc u rld i. lsb rorlh. dolbtpd! !t h, rtdd &nolird gdtti! > b ib U.l. f4use Dldildilitult ford. pris od.tt u i! bodot, d&!A QDliiid
             REDOI'BT                                      ENTERPRISES
          49 CHANNEL
                   VIEWROAD,EASTBOURNE,
                                      EASTSUSSEXBN227LN
                  TEL:01323738022 FAX:01323738032
     ffimq
         Ah
                                                                 R610 Qapakulu    (courtslaves).Superiorarmoured
                                                                                                               Spahi,
                                                                         ddingwith uprightlance
                                                                 R 6 t 1 FeudalSpahiiding with uprightlance
                                                                 R612 FeudalSpahicharging     wiihlance
                                                                 R613 FeudalSDahiwithbow
                                                                 R614 FeudalSpahiwilh sword
  DELLIS(Madmen)lightcavalrywilh lanceor spear,
  panzslschrechtsword,bow,leopardskinhatandcloakwith
  eaglelsalher decorations,shield,alsowith 6aglEfeather
  decoration,
                                                                           ffi###
  R615 Delliddingopen-handed     totakelanceor sp€ar
  R616 Delliwith Danzerschrecht   swordin seoaraleam
  R617 Dellishootingbow,lwo-partcastingso figuremaybe
         fum€din variousdiections
RX36 Warwagon
 Pl6e-sd 42,00_(!3,()l)
                      EECa R6siol th€world)Jormeldly rttusrnoddd ompEh€nstre €rabgu. ol aI our25hm @96 induding:T6js wd, vihngs
  andvjkingship,R€nds5d@. Ih@ Mcketee6, Pir.l6 dd PiEr. sn,p,Engrrsh    Civitws, Amt@ wa ot hd6Fnd.n@, w€ltingtontn India,poninsut;
Napol@nic,Napol@nrc Lnqbo.r, AbborENapor@nic  NavalRango,Suds (1880s andcodd R.ti€t Els€d,ron', Suda paddr€$.!ftr, zutu wc. Bo,io!
           '                              DdttBuitding6andFMch Fosiqn L€gion(Marcnor Dte).
                              EslcfgqEpd6iorourhngBt           aot torioor &d.nhd tq' d et.to ior h.@..
                       PL.s $nd. rtary.d.dd6.d         mv.top.ld.ny     !trrd@hr d.e.ftat      or io. our pn6 .t
                                     P & P FTGURES  uKr t 0% ot ordff pn€ uptDa80.00,trd ,€t trs.
                  EEC:30%olodorpice,mhimume2.S0. RESTOFttE wOBrDA|BMA|L:50%                 otddd vdtu6,   mininln !3.s0.
wea@prpaym. in cesh.po9al o'd6, cheques(blnml p€Md dl€qu6 tm mes                pt.e), EuEheqs aid sI mdd cEdil c€rds,od6F r@n€d bv
                                           bbr'nme wil rcm8ly b€d${Etch€d within24 l€!8.
                     af,EnrcA: M|N|ATURE     CENIER.1525Sndge163.yubECily,CAL|FOFN|A95993.Tet 916.67351@.
                                       SEFVTCE
                     ausTBAuA: ESSEXMTNTAIURES AUSTMLTA22Sldnev Rod, Honsby H.ighE, N.S.W2077.Tet:(02,4z 56s6 /
                     gCOILAID: MACS MOoELS,13s135C@ngate, FoyatMrt.. EdinburghT6t:0131-5575551.
                     ITAIY:PANOPLTA DtL AGOST|NT S.a3..M. Nuhid'ai ool33,FOMA-Te|:
                                                                                06Z/2 01012
                     SPAN: Act.l SAC/P6n$.ds 5, 2&2A,Meilnd.rd:174e254nn5.
                     Flllalo:VANHAr\aaRTt,shatie5.3,!t50Jdinhphohja.Tet35634423a5.
                     GEBIAIY: G MESFLEET,  Bcdid 12,go!o3 Nlmburq.911 r,5€004
      -Wargamet
      d^q    (J   I                                           U . K . P O S T& P A C K I N G      EXPOBTPOS'E PACKING
               B C E 7 C o m p r i s i n gR    : - a m e s e sl l . H i s c h a r i o t e e"rM e n n a '
                            C h a r i o tr u n n e r / s a n d a l - b e awr ei trh b o w ,
                  L i o n & l i o n - h a n d l eC              t 2 h o r s e . P r i c ee 1 1 . 5 0
                                                   r .h a r i o &
                           NEWCANAANITE/SYRIANMOUNTED SCOUTS
                                   (usehorses11or 12)
                                            Fiqsres70p Horses85p
                  BC 254 Scoutin robes.shortswordin belt.Use shieldBss8 o|l l
                  BC 255 Scoutin kilt wilh bow
                   , NE W '
      NAP OLE O NI C BRITISHCAVALRY
                 2 n d ( R o y aN
                                l o r t hB r i t i s hD
                                                      ) ragoons
                    "SCOTS GREYS' 1812-181s
                           DesignedW Akn & MichaelPeny            Fiq:urcs70p. HoBes 85p
       Worgor,rro%ounlrrtr                                                                      f E-l
                                                                                                L+J
                                                                                                             swnccrow
                                                                                                              ,rc.ErYED
                                                                            Mlnlmum credlt card order - es.oo
T h e F o u n d r y .M o u n t S t , N e w B a s f o r d ,         P h o n s 0 1 1 5 9 7 9 2 O O 2O t F A X 0 1 1 5 9 7 9 2 2 0 9 .
                                                                   Pl€as€Include the expiry date dnd type of card
 Nottingham.NG7 7HX.United Kingdom                               A L L U S A C R E D I T C A R D SE X C E P TA M E X A C C E P T D D
                          25mm                          w              25mm
                                                                                                                        stocKtsTs
INFANTRY
       IN KEPI& SACKCOAT
Figures wlth head veliants E e sold randomly assoded.
AcW Kl.Mount€d  Oflicerluseho€e H.1]
ACWK2.Oficer,  oDensackcoal,standino,    swod shouldered
ACWK3Otfic€radvancino    oeslenna   loNardwithswod
AcW K4 OIfic€rrunnino.awid dra'in.
ACWKs,SlandardBeaid standino
ACw K6 SiandardBeareradvancino.   - oo€nsackcoat
ACWK7 Srandard  B€arerrunnino
ACWK8.Drumn€r   bovslandino.ilavino    drum.
AcW Kg.Drumnor.  od€nsack;oai.edv;ndno
ACWK1oDrummer    funnino.hotdino    k€Dion.-
ACWK11Inlanbyman    staniiing, ord;rcdams {8 headsvananlsl
ACWK12Inlantriman   standino.  tullDack.
ACWK13Intanhiman    marchin-liadvancino,  tullpack,
        ighl shoulder shlfi[8 headvadanlsj.
AcW K14Inlanlryman  advancrns.   should€rams18headvadantsl                           ACWK14
ACWK15Inlanttmanadvancino       l8 h€advariamsl
ACWKl6Inlanhimd advancina       iulloack
ACWK17Inlanhinanadvanchg.        op€nsackcoati8 headvananlsl.
ACWK18Inlantd,man   runnino.i-ohishould€rsnittiS  headvanantsj
ACWK19Inldliman charqiig,ievelled      musketts headvaiantsj
ACWK2oInlanlimanfiind
ACWK21Inlanrd,man   readhino  intocanddo€  box.
ACWK22Inlsnvimanbrtinodnndo€
ACWK23lnlanlimanload-mo     bulleisinlomuzzle
ACw K24Inlanlriman  hneeriolinno
AcW K25lnianl.imanhneern;rea;hinointocaobor
ACWK26hianlrimanD'oner;achnoriro caDtioi
ACWK27Inlantinanivinoon bac(rammino         muskel
ACWK28Inlantd,han   lallinowounded
ACWK29 Inlantrimsnwounidedintanlruman
ACWK3OO€adiitantryman
INFANTRYIN GREATCOAT
                   AND KEPI
Figureswilh headvarianlsaresold randomlyassorted.                          ACW K44               ACWK2
ACWK3l.Mount6doffc€rlus€nolssH.1]
ACWK32 Office.standino.dEwinoswod
Acw X33Otlicoradvanciriq  sworii.dEwn.oderno   m€n
ACw (34 Srandard Beareisrandino
ACWK35 Standad Beareradvancino
ACWK36Drunmerslandino
AcW K37Drummeradvancho
ACw <38Inlanvyr4an  standrnl.orderedams 18h€adva antsl
ACWK30Inlanlimenmerchin;/advan.nd      - ridhr
                                          '
        shoLrld€rsniflt8 headvanantsl
ACWK4Olnldwman advdcrno 13h6advananlsl
ACWK41lnlanbi,man   standino  lidio
Acw K42lnlanlrimanloadinolamitno    - aown
ACWK43Inlantd/han   kneeliiir
ACWK.l4 S€ntv: in Gun Blan-k€t.siandrno
ACWK4shlanth/manmarchino/advancino:    - doht
                                           -
        should€rshifl.In  Gui Blanker
ACWK46ShotInlantrvman     tattlno
                               -
ACWK47Wound€d     Inlantryman
ACWK48 D6adinlanlryman
HORSES
ACWHl Walkinghorse-
                                                                           ACWK40
                                           l2l8S&oolduGlSl@1,Gad6nGrcve,
                                           Phono(714)636.35€0
                                                                         CAA640 U.S.A.
                                                           or6e our24hr.tar (714)
                                                                                63&9150
                                                                                           YoutDisttibutor
                                                                                                        tor Waryanes
                                           hlelPl 8r@khothyoaor
                                                            @morI ca?21276zocomi9r.en       Foundry in NodhAmertca!
           When replying to adverts please mention Wargarnes lllustrated.
 1l
 AUSTTRLITT,
   The year is 1805, and William Pitt thc Younger of Great Britain has formed fhe Third
Coalition, an alliance of Britain, Austria, Prussia and Russia - an alliance doomed to failure.
 In 1806 the might of Napoleon and Imperial France crushed Austria and her allies at the
   battle ofAusterlitz. Europe was laid wicle open for conquest! Austerlitz offers you the
 chance to play the wargame of your dreams. Commanil almies of over 100 battalions in the
 field! Try your strategy across a1l the olil battlefields ofHurope and the colonies. and fight
ne\r'battles that histoly never sawlA tactical rvargame in grarid scale with a distinct fantesy
 flavour, Austerlitz is fhe ultimate challenge, a thinkiog mans dream of conquesl flnd world
                                         domination.
M A I \ F E A T U R E So F T H E , G A ] \ I II.\]C L I D E
                                                              .$H.s
                                                                                                                     SKYTFEX
                                                    tnpbx'?7                                                      COMPETTT|oN
                                                                                                                       PLIJS
                                                                                                               THEFUTLANDHOTEI
                                                                                                                     IEAM
                                                                                                                 WARGAME OUIZ
                             - SHEFFIELD
                    THEOCTAGON                                                                                 LARGEARNGANOBt'Y
                    Saturday'15th
                               & Sunday16thMarch'97                                                             slt+ TRADESTANDS
                                         OooRS OPEN 10!0.n - 5!0Fn S€bnhy
                                                    10tOM - 4i30pr Sunday                                      30+ DISPLY t
                                                                                                               PARTICIPATION
                                                                                                                           GAMES
                                                 ADMISSION
                      ,*"*- f 3.00                              roaoePs! 1 .50
                                                            unoen
                    ntRTfiER DErAIIS: Mr L. Po$t!, 19(h .n Rd S{EFFIELD 55 4QL
                    liijtfrlfiiroi        tEr ri ft; i;ujrd HcL Gh$Dr4 slo2tYT.l(01l4)2654'u
 Y$f;"*S$o*-:#lff
             f"Fm"""'"',
     Alat9erelecrionoltopqualitymrqn?ti..ndnelpapermareriaBtoaid
     st!birityandavoid
                     dafragetofigurceintraBport.Veryfl
                                                   exibte,eatty                                                 HOVELSLtd
      MAGN€n(MATERIAIS:     TradlionallvoLl unde'erb( nocrd bdseito
      h.lpk.!pngues uprighrwhen     cried r rt€eltooLboxaialso-redlo              Leadins
                                                                                        ManulacrudotHishOualily,
                                                                                                              Fineryo€i.iled
                                                                                                                          F6in CaslBuildinss
            lrnerarryrnqbo(.sro' liqurermounted onneelwasheu.                            andA..soriesinaliWaEamingSca16and Pe.iods.
                                                                                                Av.irablePainredand
                                                                                                                 Unpainred.
 0.8nnthi.k,
          alladheveb€ded
                                0.5nmthi4,
                                        nonrdh6iwbarked
 rMd$       2 met6 5meta 10mdE         rrtxl00nn 200x l50mm
  3nh        f2.00 f4.00 f 7.00 Padol5     f3.00    f6.00
 :qTI         l:9       fl:g         !.119 lieh$eiehrM4neli(rhs
         ll9Y   l? 19 !'v19              055r.i\id,adh.riv-ba.l.d
                                                    rrr- , .mFn 2C0\ t50mm                                           MiddleEasllM€dit€mn€an)
 )0r-    f400 1300 II500                 pa.rots         rj\ii                     MiddleEasr{Medneranean)
 Magnelkns-50rr^rqu's -,                 _glth.,qhhrq.nate atrara,tdb  e,r
                                         orhe'jrer lo$er dlorder
                              STEELPAPERIIANGE                                                                          Fo4e's
     whenB.d inbo! fler pl.ni( bor€,etc, @.raa ru.Le rowhi.hEagnertsillbe                LaHavesainE                        Diin
      .trrddedc.nalsb€urdu.d.rrmall.sl.fiauc(wirlm&ne!.mrtdalinthe                                2omnB.ld.!rou.d n.nlE
                   oryinqb.x)toM'd addinq dulvrothen*iqhr                                  PrimalydesignedforlwentielhCenrurywa6:
               2mmmx l50hh                          2/onm x 1t$nn
     PlainSrsdPaper 0.2mmlhirk               (2rheeant nort ^4 Jilebo6)
     Padof2f2.00          Padot5f4.00 Padoi2f3.00              pa.tof10fl4.00       MiddleEasllvledireranean          MiddleEai/Medileranean
     AdhsiFb€[email protected]
                          Pa*ofstt.oo     Parlof26,t0          Padoll0f15.50
        BothveEionrol $el P.per@. beluppliedin otherei:erto ,p€d.l odei         Fot our Catalosuepla@ stt1,5! ptusa taryestampedaddres*d
                                                                                qvelooe.Ovet@s tusron.B oledn ffid 4lBC's.
                          IVOVEIUEI'ITTRAYRANGE
        viiyllaed rtel pap€rtormdemen r.ys/[email protected],et( Adhe,ive           Mast tdt tryin hold.tsun phone orfd in otders on 01472-760552
             ba.ked,50c.b.hounledonordorplyil€xtr.srift    e$i5Dquicd.          MoFFn 9an spn. Minihutu redn 6td otde6 t5.0t
     6rc.nSreglPap.r0.l5nmthi4200nn   x 150fr
                                            m                                            Post a^d packagihg 15% lp ro 125.00; 10%ovet f25.
                          Pa(kof516.50 Al5oavailablein5AN0                       HOVELSLtd, 18 GLEBEROAD,SCAFTHO,GRIMSBY,
      lorligurcrb.Fdonnelra eR,stelpap€r,et.,nMn.firayn .n.l6nb€
                  whhgEenvinylonI naqnedr
           supplied                        [email protected],                   NORTH.EAST    LINCOLNSHIRE  DI{332HL.
       ATRIAI PACK(<ontaininqlurtherinfomation and samplerof                         Sole DistrjbutorUSA:Wargames,Box 278,
                        all ranqet isavailabl€at f2.50
                                                                                   Route40 EastTriadelphia,\Mr'26059-0278,
                                                                                                                        USA.
                                            chequeGterlingonly)wirhoder,
                                            payable
                                                  to: MAGNETIC
                                                             DISPIAYS
     - Renol World+20% per ord€r
     TheEnclrclement                                                                             WARGAMESRESEARCH
                    of Nancry                                                 \,                     GROT]P
     4th U.S.ArmoredDhrlslon,
          September,1944
                      by Mqrk Decoteau
                                                                             K                 NEW!
                                                                                                              TheKeep
                                                                                                  l€ Marchart Baracks,Lordon Road,
                                                                                                     Devizeq \Yiltshne SNlO 2ER
                                                                                                      Tel& Fax(or38o) 724558
                                                                                   D.B.R.ARMYLISTSBOOK 3                       M.9'
                         BACKGROUND
                                                                                                      Armies ofthe
Thebreakoutfromthe Normandyb€aches           at St. lr, andsubsequent
                                                                                             Eastward Colonial Expansion
Iace aqossBdttany and CentralFrancerate as one of the most                             Amies of the Europ€anEr ightenment
outstadhg elanples of arnored-mechanized           warfarein modem
history.Alwaj5 at the forefiont of the U.S. Third Amy's onslaught                                ALSOAUAILABLE
duringthistimewastheU.S.4thArmoredDivision(4thAD). Oneof                            D.B.RWargam€s        Rul€. .. . .-.--.............
                                                                                                                                   54.9r
tbeprenierunilsto fightin wodd war II, historians       have€xtetrsiv€ly            D.B.RAnnyLisas       BookI ............... l 4.95
$dtten about ihe 4th AD's exploitsduring th€ post'Normandy                          D.B.RArmy ListsBook2 . . .. .................  t4.95
breakout.Thisarticlefocuses    not otrthence acrossFIance,buton the                                      I\)STAGE
I-onaineCampai$which{o[owed.TheLorraineCampaign                  wasthe                UnitedKingdom-Add 10%minimum'Op;
mostcostlyandleastproductiveofth€ U.S.ThirdArmy'scanpaigns.                                          Mllnnm t3.O0
Ther€was,however,oneoutstanding         divisionleveloperationduring                   AirmailEurope- Add2t$ Moimum5l.0
the campaign,  the encirclement   of the city of Nancyon the Moselle                 Restofworld -Add 2t% Surface;         5O%Airmail
RiYer.                                                                                                Midimum.Cr.00
  On13S€ptenber1944,ConbatCommand              A (CCA)of theU.S.4rh
ArrdoredDivision,comnandedby colonelBruceClarke,crossed              the        VISA&AccEss (Mast€rcar4 Eurocard)ACCEPTED
Mos€lleRiv€r at the to*n of Dieulouardthrougha bridgehead Io. atull listing ofal ourproduclr pleas€s€nd ar s-{.E.
establishedbytheU.S.80thDivision.CCAdidnotcrosstheMoselleto                                 or 2 IRc's to the aboveadd.e$.
assistmth Divisionin thedefenceof thebridgehead,        eventhoughthe
80thwasunderviciousmunteFattacks        bytheGerman3rdPanze4ena-
dier Division.CCA\ mirsionwasto strikedeepinto the rearof the infantry-heaif(hree infantry conpaniesand on€ tank conpany)
Germanunitsd€fendirgth€areaaroundthecityofNancyanda5sist             lhe battaliontask force. A third task forc€ nade up of €ngin€ers,a
restofU.S.  XII Corps  in crossing theriver.Thedeepauackconducted         "bonowed"motorized      infantrybattaliotr,andsuppontroopswithtuel,
byCCA,andthesubsequent        link-upwithCombatComrnand         B (CCB) foodandammunitionenoughfor a seven-day              operationfollowedthe
at Arracourt,aremodelexamples      of howto conductmobileoperatioos
in the en€my\ rear to efr€ctlhe     "tuming"   ol a d€fensivepositiotr. After fightingthroughtheGemaff containing              themrth faceof the
Additionay, theyprovidethe WorldWarII wargamer             with vinua y bridgehead,the leading elenents tumed east atrd headedfor
unendingpo6sibilities   for s{enarios.Thesepossibilitiesrarge from Chateau-Salins         about20mil€saway.Col.Clarkecoordinat€d         hisuDitk
20mnskirnishganesto full scale1/300th     cnmpaign    refights.Belowisa movenentsftom a liaisoDaircraltflyhg abr€astof the leadta*s. As
slaopsisof the campaignand ideasfor recreatingthe actionon a Col.Clarkeb€liev€d                sp€€dwatvital,th€penetration       wascrDduct€d on
wusameslable.                                                             a ftontageequallo th€widlhof the highwaytheywereddvingdorin.
                                                                          Ercmyroadblocks,tankdetachments,         andanti-airdaftpositions *ere
                                                                          easilyknock€dout by the leadtanksandanillery.By 1700bous Oe
                 ANIIISTORICALOYER\IEW                                    cohnand hadformeda 36°ree          defensive   perim€te.oo th€ high
CCAbegmtheirmoveme throughthebridgehead                at 08mhoun, 13 groundwesiof Chateau-Salns.            CCA had penetrated20 milesin a
S€pt€mber   1944(SeeMap). Lt. Col. CreightonAbrams'37thTank singleday,capturing                354prisooers  anddestroying    l2 ta$ksand85other
Battalionled the vay acrossthe Moselle.CCA'Sfirst objectivewas v€hicles.            Th€command\lolsesanountedto 12deadatrd16c/outrd€d.
Chat€au'Salins  approxirnately   20 mileseastof the bridgehead.    They      Affer refuelingandre-arningonthe momingof 14S€ptenber,th€
*ould advance   on the townafterfightingthroughthe Germanforces conmanders              of 4th AD andCCA badto decidetheir nextcourseof
who wer€ attackingthe nonhem portion of the 80th Division's actioD.Chealeau-Salins                 ilself appeaiedto be heavilydefended.    Maj.
bridgehead defemivepositioDs.    CCAwas"taskorganized"        nuchlike a Gen.Wood,comnanderof 4thAD, recogdsed               thatCCAhadbrokotr
modern'daybrigade.The Commandwas madeup of one armor cleanlythroughth€Gernanpositiotrs.                           H€orderedCol.Cla*e to tum
battalioDandonearmoredinfantrybattalioo(in M3 haf-tracks)and southandconducta Ink'up with CCBin the vicinityof the townof
supporting troopssuchasengineers      andsellpropelledartillery.They Arracolrl. This novement\{ould in effectcut the Germatrlin$ of
rarelyfoughtas completebattalions,bowever.Instead,companiescommunications                  to thecityof Nancy.
wouldbe "traded" to fom a "lask forc€". This task-organizing           is    September  14provedto be a repeatof the previousdayfor CCA.
comoon practiceh many modem-dayarmies,aDdthe Germans The' crmpleredrbe anackro Arncoun by ls00 hours,oDceagaitr
r€gularlydid it in theformationof their Kampfguppe.However,for pulitrgintoa defensive             perimeterfor thenight.Acrionsduringtheday
theAlies in WWII, task-organizing    dol}nto thecompany     levelwasnot accountedfor a tunher 400 pnsonen,atrd cost th€ G€rmaff 26
ascommoD   asonemightexpect.Thisfleibility wasatradenark of the amoredv€hicles,136othervehiclesandten 84mn guff destroyei.
4rh AD, andwasoneof th€ prine reasomthe GermanscotrsideredCCAsutrer€doDly33casualties                       aodtvo tanksdestfoyed.
tbemanCliteformation.                                                       For the next four days CCA conducledraids on the nearly
  A tank-hearfbattaliontast forc€(threeta* companies,           andone undefended      rear areaof the G€rmansin andaroundNancy.During
infantrycompatry)   wasthefirstunitintothebridgehead,     follow€dbyan thes€operations      a battaliotrtaskforc€assist€d   CCBin movingacross
theRhin-Mainandth€4thArmored'scombatelemetrts       wererouoited.
At tides CCAutritsw€recapturingwholeuniisretreatingtom Nanry        The Black Country Role Playing Society
who thoughtthe Americins$/€restil boitledup h the Dieulouard                       Pmudlv Presehts
bridgeh€ad.Theresultsof thefourdaysw€reaturther1,m0prisorcrs,
andthedestnctionor captureof 8 tanks,16artillerypieces,a0d232
othervehicles.Dudngtheseop€rationslossesto CCA wereonly 3
kiled, 15wounded   and4tanksdestroyed. Themostirdporlantresultof
                                                                              DuALea9iuq'0n;LL1997
CCA\ movement     wastherctreatof the553rdVolkssenadierDivision
from Nancy.Th€ 553rd'sretreatallowedthe 35th(US) Diyisionto                   On Saturday26thApril 1997
occupythecityon 15September   againstminimaloppositiotr.                      from 10.00am to 11.00Dmat
  X\41 Corp6failed to exploitlhe success  of 4th Arnored in lat€    Dudl€yCollcgeofTechnolog/,WestMidlands
September, duein partto supplylimitationsandto LieutenantGeneral
Eddy's(xII CorpsConmander)desireto consolidate      the rcwly won
area.As a result,theGermans  v/ereableto stengthenthei defensive Eventsto includeTournamenls in mostRPG'S,Collectable
positionsnonhatrd€astof Nancy.Therewasextensiv€    frdting around   CardGamesandthe WestMidlandsAD&D Open.
Chateau-SalinsinvolvingCCBandotherelements      fron 4thAmo.ed
Division.Fhaly, on 26September,    Third Amy order€dXVII Corp6           Includingourfirst DBA Tournament
             gainsad themobileAnacourtbattleseffe.livelycame
!o consolidate
 shFtus ddin rL. us^ pr4.dd      35.mrc dippeE ed b'ndli4 fd ft hd ll50. oE 'l50
                                                                                                    P.O. Eq3ltl.      Fobatlcllrn     od.
 Iitfu]ioojshj,'h!,0'.o.ndiodeo.i[fu!i6,smomi6gfl&Fddd,biplHt                                                 ca, 94&t u-s.a.
 i,!. 30q,orEid ena b Aedi, ad /\dr.
 htudmlcnd6crdrdetn|[email protected]*rErctr.n
                                                                                           T() OR.DER CALI:           T./Fa    # (51O) 2351955
                                                                        b.ri.c
 dd*6.r.*'d!d..t]dft
                                                                                        rledtu     , N'rr.,   sd.r, co.tfu    DBrn,    r;:or2rD2ast
                                                                                                              BIBUOGRAXEY
                                                                                   The4ti tunond DivitionitrdEE$ir&ttut 4 N@q, G&1, 19E6.
                                                                                   nebmin C@tpaign:     An Ovavicfl,@t-kt. 1914,Gta}fj,l9fl.
                                                                                                                G.J.M.FIGURINES
                                                                                                 WaQarnesFigur€spainiedlo coll€clorsstandard.
                                                                                                 smmb 3Om. 5mh samde lrs€ wnhSAEor 5 lBCs.
                                                                                                 For ssmDlsl Srnmffoureandlisls s€nd!1.95 or E2.95
                                                                                                 lor 25mmsamolofiq-urc.Davableb Gerardcloain.
                                                                                                 74 CroltonRoad.Oipingion'.K€nt886 8HY.
                                                                                                 tl€u tol€pfion€ numb€r:016€98,18474  (,. ft'3)
A GemtanqusdrupleW gunvairsne acinglyiaafaaory'a ,ha
pne stoged br DaveAadrcws,
                         Alt Monimn& Iriendaot thenoul
dcfuiwtCo tonle-Wilotes                                                              UScrl3to|r|€|! dd!€ !€nd $5 blll tor 15mm.ample lnd llst.
                      shotr.
 l8
                 r!.rqi'tr.r,{i.i.hBNNAE.br.aritB.M.MoDE5,cIAvEsTn67/694331ANTUSSTNGENNEDERI.AND
                                                   TtrL Orr&4rr€9 F )G 0113_411439
                           osoao   tus0(Mdosr0p)s                           o.K dy) EUiorE ^lRzo$ REro
                                                     otFsrrlslvE
                                                     ?rJit A?Rt!.1997
                                                                      97
       Traders                                                                                           Attending
                                                                                                    OIti Ctory
    B&BMn
    Bicome                                                                                          P.odnk    r
                                                                                                    P.O.P
    Booktop
    Briannia                                                                                             & A Sccrica
    CheliferBook
    Cooquest
    Curteys
    Faust
    Hallrnak
    Iregt{ar
    Last Vallry
    Long Shot
                                                    the North East Wargamer                         lvort(A Boo}g
                            SIOCKIONS?ORTS
                                         CANTRE,
                                              OTF NORION
                                      slocKfoN-oNt-tEES
                     ADMIS$IONt
                             ADU!.TS
                                   S1.50CilltDRlN/O.A.P.
                                                      60?
For ftrtt.r   dct ik rcnd rn S.A.E"to D.vid .t 3 fl.oel Oor., Thor!|by, Stochotr-otr-T.c.,Cl6d|r4        lSlZ 9Ap
22
                                                                                   WoodenShips& hon MentuomAvaiorHill whichusesa tum based
                War$amer's                                                         system and,in myopinion,suffenin comparison.  Theenphasi!in AoS
                                                                                   is to makeyourdeosionswhilethebattleis underway,    preferablywith
                                                                                                     XUJO
                             WARFAYRE97                                                               oeo,gor)s
                              SATURDAY5thAPRIL
                                     Comb.wHall,Halesoven                                             prrooc]ctior)s
                                  otrJuncrion3,M510m- 4pn
                         r
                         *
                                    Padcpalioncames
                                    Fetcshnonis
                                                                                   Mcronn's         Henors
                                                                                      by thelateBobDelaney
                         *          a'ing and euy
                                                                           coIdnd4gr.iouF|1.'or.ftd4.h.''@||4oi'...'
                        ADM|SS|ON11.50p,
                                    UNDEF12,sFFEE                         .etEld.n'.of           ordLlrarud|[email protected].
                                                                                        .aatdonb.up.Eirlr                 Tt itm4
            Fortu sdBl€ileoniact     (6in1 (0r33,r)25ztg                   rh4tt.gdPd.h.d.ll!..4ao                     r'tn..r.oa.rrDiq.6tE
                             or      Ashrey(01334)56133e                                                             oeoa||t@eoFr3!ot
                                                                                                    .b.l.4v|corl.r4
                                                                         0ATPAX&Sdlkil blryMarhiig
                                                                                   p,i|m $rr rdnlls om.lnpRl helmd,
                                                                                11846                            phn Kl odd0)
                                                                         BATPd\21 BndlhInfabl FintrgLitu
andgeneral   magazines -one exatuplebeingEl Dorado,uDtnoBnto me                    03%pallmlnllj ddll[ilom, [trPkallP]ner,prajnner dd2ii)
                                                                         BAIl{[n   Br,r,sh
                                                                                         lildEl alieRod!
until nentionedbyBryanAnsell,whichI havebeedavidlydownload-                        08%piitsnkhakidrillunil0fl!hfkal idmL quilledKk dtain)
ing a[d readitrg.IJ youhaveanyinterestin lhe hobbypress,andthe           BATPAxAHiShhidR€8inor,QleFonrCmem&S,lmlhs               r0tiguE
tidesare glowitrgal the time, you'd be b€stadvisedto drop by at                    0896piikmhalidnllunilom,rDpielhelmel,r/,{Lrh  r/,{ithellwlh)
Magweb- wsry.magw€b.com        - ad se€v,/hattheyhavegotooofier.         BATPrL\21 [mlirn ReSuldlnhiqrMt             !01i8u6
                                                                                   (Cinpiig d6, rdt@h er..3r tuubarbliotrfomar)
   BookoftheMonthisareprint.Frcn flinnmk ro Rife,1740-1866,by
SteveD  Ross.Publish€d   by a company lorrl to mo,C{5s,it is a higlly                       ALLBATPtX.d ft,50 ld Pd G10% p& pl
specifictitle but nakesa fascinatingadditionto theHorso& Musket              at tnstItilfu.nf{ft WsNW}I.ntiltfr/.DL td,,i4dl{.t s,oh4,0.
libraryand an ercellentadjunctto the moregeneralworks.Fu[ of              lornorcd€r.ik$nd,norreupdir€datil08ue0rly4,00ind.!(p6r.Beo     !.r
interestingspp€ts,it concootrates  otrthetraositionof infatrtrytactics
ftom lin€arto opetrordeaandofrerssorneunusualconclusions.
analysis             theprosesBlehigblyreadableandtheshiftsfiom
        is excelletrt,
                                                                 The     TWODRAGONS
bactgroundto detailar€wellhandl€d.Remmmended.                            PRODUCTIONS
Above:Setuadelor s/frings,n:[$ed archensbke theit chin to a sna stip ol Cod'sA$e. Wotgon$ Foundry8nm Medievabpainud by
 DanizlNorcr, ol D.O.G.S. (seetheit adr in prcviouswts). Tenainbt Mick Sewe, Rob Baket et al. Backnlopbt Al& perr].
Belovr:KingandCadinalesco edthtought|oodlanh. EsserMinitlurca.Umn MediewlspainAdby the'Schoolof caned in Exilz',o group
of Ri Brcweri6pbed brulngn brcughtinb rte publi. ett bt Exile:hotgho Peb O'Toole.Phil Robil{'ond tE .a inol and hit
ctoss-beam. Trceslron Mick Sewekwal|in rcti'tfron Wdtugon Sadio;ba**op by BnlnoAlbnson.(If wewm norc teclnxaly minded
wecodd EAfou dtathesephot6 wercatkenrLring    such-and-su.1a b$, atf-stopur1ptee\,wingsuth-and-such
                                                                                                 a fLlt a| t' speed.etposed
                                                                                                                          for
'J' second.t.
           I do rcnenbet that dE werctalan at abour2an in tha fioming!)
                         r47l                                            Sutrday,therewasa thick fog cov€ringlhe battl€field.Unableto see
                                                                         th€iretremy,botharniesdeployedwith theirrightllanksoverlapping
                                                                         theenemy's  left. Attackedin thereaibyOxford'sdivision,theYorkist
                   By GrahamHarrison                                     left flankcollapsed andlled, whileontheright,Glouc€ster pushedthe
                                                                         enemyback,swinglngboth armiesaroundto a right aDgleof then
when Ed{ard IV landedb Yorkshireon 14March14?1,f€wpeople                 originalposition.It \r,asnowthatOxfordretumedandcrarhedtutohis
beli€vedthat he couldregainhisthrorc. Edwardhadlessthan2,000             o*n centredivision.In thefog Oxford'sbadgeof a starwasmistaken
menandrangedagainsthimwasaseeninglyawesome                               for Edward's'sun
                                                            alliance.Under                   in spledou/, ad he wasattack€d   by Montagu's
the guidanceof the Frenchking, Louis XI, Edward'sone'time                m€n.Believingthathehadb€enbetrayedOford left the6eldwith his
stauochest  aly, Richa Nevile, Earlof Warwickhadjoin€dwith the           men,leavingMortagu'sconfused     troopsto becutlo piec€sbyEdward.
lnDcastnans,  at hadEdward'sownbrother,GeorgeDukeof Clarerce.            WarwickandMontagubothdiedh lhe routthatfolowedandEdward
As theMilaoeseambassador        \+Tote"it is a difficultmatterto goout byhuniedbackto London.
the doorandthentry to comein by the windo{s" (1). The previous
SeptemberEdward and his youngestbrother fuchard, Duke of
Gloucester,had fled th€ countryalter beingcaughtbetweentwo
Nevillearmi€s,oneled by wa$/ick andthe otherby hisbrotherthe
Marquisof Montagu.Henry\al hadbeenrel€ased               fromtheToperof
London,soonceagaina Lancastrian         woretle cro*ll ofEngland,
   After spending  thewinterin Burgundy,Edwardknewh€hadto act
quicklyif he wasto haveanyhopeoI victory.Thel-ancasteiNeville
aliafte wasfragil€anddfe with distrust.H€nry'squ€€n,Margaretof
Anjou,andhisheirEdward,Princeof Wales,w€restillin Francewitha
forceof lancastrianexiles.In Englandtherewasno lovelostbetween
Warwickand the Lancastrians         who ruled with .him. the Dute of
Som€rset   andtheEark of OxfordandExeter.With hisov,mhopesof
lhethronegone,Clarenc€       alsos€emed    to behavingsecond     lhoughts.
   Acxompanied    by Glouc€ster    andIrrd Hastings,Edwaidmarched
iowardsYork, alayingthe fean of localLancastrian            sympathisers by
statfugthat he had not retumedto claimthe rhrone,but simplyto
regainhisIather'stitle, Dute of York. WhileMontaguhesitated,th€                                        BARNET
smallYorkistforce reachedYork otr 18 March.The city aldermen
allowedEdwardenty on th€ conditiontht he left by noon of the                  During th€ eveningof ihe battle, QueenMargaretand Prince
fo[owing day- The reasonfor Montagu\ inactionis not knovn; Edvardlandedat Weynouth,whercSomenetvaswaitingfor them.
possiblyhewarstill tom b€tweenhisloyaltyto Edwardandhisfamily Onaeceiving                 newsof Bametth€lancastrians    narchedto Er€terwhere
tieswith Warwick,or elsehesimplyfelt thal hecouldnot relyon his theyverejoinedbysupporters                 ftomtheWestCountry.Fromherethey
folowen to fight againstEdward.Whatev€rthe reason.Ed*ard hada choice.ro strik€easllo London.or nove nonh andjoin upwith
marched   southunmolested,     bul notonemanhadcomeforwardrc join Jasper           Tudorandhisainy of welshmen.Margaretdecidedto gonorth
hisarmy.On25Marchhereachedl,eicesterwherehereceived                 his6rst al|dat thesametimeEdwardleft l-ondonwith hisarmyandadvanc€d
rehforcemenK    ol L000menledb' lrrd Haslings           retainers.          uptheThan€sVa[ey, By I May,lhe l-ancastrians       wereatBristoland
   ln the meantimeWarwickwas unhurri€dlyraisingsupport.H€ th€YorkistsatMalm€sbury.                      MargaretandSom€neteludedEdwardby
stationedhinself at Covetrtry,gatheringtroopsftom th€ Midlands, appearinS              to advanc€ towardshim,thenquicklymovingDorthto tlf to
whileOfford andExeterwereraisingmenin EastAnglia,Jasper              Tudor crossthe RiverSev€mandjoin with JasperTudor.Edwardrac€din
in Walesad ClarenceiDtheCotswolds.           On29MarchEdwardwasat punuit, s€ndingor ordersthat the city of Gloucester               shouldrefuse
th€gatesof Coventry,but Warr/ickretusedhischaleng€to a pitched entry to the Lancastrians.                Luckily for Ed$,ardthe Gov€morof
battle,knowingrcinforcernents      ftom Montagu,the Lancastrian       eads Gloucester   remain€d  loyalandth€Lancastrians   wer€forc€dto marcrh
andClarenceweredueat anytine. Edwardmovedsouthandon 3 northto theford atT€vkesbury.By aforcedmarchEdwardcaughlup
April Warwid was joined by all his a i€s €xc€ptClarence.As withth€montheeveningof3 Mayandbothsidesdeployed                            in thenight,
Warwick'sretuIorcements       e eredCoventry,th€ York brolhershad ktrowitrgthat th€ decisivebattle would be fought without Jasper
met otr the road from Banburyto Warwickwh€re"false,fleeting, Tudor'swelshforces.Edwardhad5,000menagrr0stlhe Lancastnans
p€rjuredClarenc€"(2) chatrged       sid€syet again,tfing with him the 6,000.
4,tJ00metrhehadrais€dto fight for Lancaster.                                  Th€LaDcnstrians   deployed in astrongpositionooaddgeto thesouth
   Ed$,ardnownarchedsouthtowardsLondon.andWarwicks€iofi in of the tovn with thei frotrt protectedby woodsandroughground,
pursuit,confidentof catchingtheYorkistsbetweenhisownarmyand "foul lanesanddeepdykes,andmanyhedges                        withhillsandvale)6" (3).
theLam.astrian   forc€sitr lrndon. It wasnowthattheweaknesof the TheYorkistsadvanced                slo*ly, andse€inga largewoodlo th€westof
Nevile/Lancaster    allianceshowed.Londonwasheldby the Dukeof th€ l,ancastrianpositiom, Edwarddetacheda force of moutrted
Son€rcet,but on receivingwod thatQueenMargarethadembarked men'at-arnswilhorderstoscoutlhewoodfor anambush.                           th€ntoactat
fiom Fiance,he left the City andKing Henry,andhurriedsouthto th€ir owndiscretion.Al ftst both sid€sengaged                    in aDarcheryduel,
neet her.Wlhout Somenettherewaslitde resistance             to Edwardwho thenSomerset,       commanding   the lancastrianrightwitrg,launchedan
enteredthe City on 11April. Hemywasietumedto the Tow€rand attackon Edward\cenFedivision.Possibly                        hethoughtthatth€rough
Edward'sarmyreinforcedwith moretroopsandsomemuch,n€ededgroundwouldpr€ventGloucester,                            leadingtheYorkistl€ft s/ing,fron
camon. Now numberfug10,m0 men the Yorkist anny moyed attackinghim,or €heit maybethatdueto lhe natureof thetenainhe
mrthwardsto meet Wamick. On the eveningof 13 April the two did not se€Gloucester's                    division.wbateverthe plan, it caughtthe
advance  guardsclashed   in Bametandthemainbodiesdeployed            in the Yorkistsby surprise.At filst Ed*ard's troopdwere tkox,n into
darkness,readyto fight the folowing day. War' ick had the larger confusioD,             but for someunknownreasoothe restof th€ l,ancastriatr
force, perhaps15,0m men, and more canlon, which he uled to armyfailedto advance.Gloucester's                       divisionjoined the meleeatrd
bombardthe Yorkist posilionsthroughthe night. Howeverin the Somerset                   v,/as
                                                                                           forcedback.Al thismoinentthenou edmen-al-arms
darkness,the two armieshad deployedcloserthan expectedand charged                    intotheLancastrianJ   realandtheirlineclumbled.Som€rseth
Warwick'sgunsov€nhottheirtarg€ts.Thefollowingmoming,Easter menranad werecutdot|nby Gloucester's                         punuiDgtroops.Thefield
*here lheydiedisstill calledBloodyMeadowto lhisday.TheYorkists
nowattackedthemamLancastrian        forcewhoweredemoralised    bytho        1
destruction of Somersefs  divisioD.After a bri€fmeleein whichPrifte         1
Edwarddied. th€ YorkistssweDtthe Lancasaiarsftom the field.
l,egendsq,sthatSome$etbladedlrd Wenlock,v,/hoaccompanied
thePrinceof Walesin thecentredivision,for notsupponhghisattack,
andin his fury kiled Wenlock\t/itba singleblowfrom a battle-are.                                 ))
Howev€r,th€cotrtenporary     accountof thecampaign    containedin the
'Historieof the Arrival of EdwardIV' nakesno m€ntionof suchan
                                                                      l:"'4               "*-\I
ev€nt.As the'Arrivall's,astheofEcialYorkistaccount,*ritten by atr
unnanedparticipa , it wouldalmostcertainlyhavenentionedany
suchdi$ord withintheeD€my     ranks.
                                                                      'P"-+                I .\\
   Somenetwaswoundedin the battle andtook shelterv,/ithother
survivonin Tewkesbury    Abbey.Twodayslatertheyver€dragged
by Yo*ist soldiers.After a trial presidedover by the Dukesof
Gloucest€r  andNorfolk,Som€$etandihe otherl,ancastriaD
                                                                  out
                                                              leaden
                                                                                                 \l
werebeheaded     in the ma*et placefor trearon.Tbercn dayQueen                           TEWKESBURY
l,targarets,asfouDdsheltering  in a nearbyreligoushoose.
   Th€ victoriousYorkistsretumedto Londonafterpulting dovrDa 4.E rl of warrvick'sDiYisioD
final uprisingin K€trt,led by ThonasFauconberg,     oneof warwick's 10metr-at-arms,   polearms,full-platearmour(Veteran)
cousins.On 25MayHenry\4 diedin th€Towerof l-otrdon,'of pur€ 20bilmen, polearms,           haf-platearnour (Average)
displeasure andnelancholy"(4).conveniendy       renovingthelastlhreat m bo*men,longbow,paddedarmour(Avera8€)
to Edu/ard'scrown. OueenMargaretr€maiD€da prisoneruntil
ransomed   by lruis XI in 1475.Clar€nce  fitraly pushedhisbrcthertoo YORXJSTS
far in 1478,and wasexecutedin the Tower otr Edward'sorders. l. Ihke of Glouc.ster's         DivisioD
Englandremainedat p€aceintemaly for lhe r€nainderoI Edward's l0 men-at-arms,          polearms,full-plat€armour(Veteran)
reign.In rhespringof 1483EdwardIV, und€feated       otrthe battlefield, 20bilnen, polearms,
                                                                                          hat-platearmour(AveraSe)
wenton aisbingldp, caugb!a coldanddied.                                 30bowrnen, longbow,paddedarmour(Average)
                                                                  2. f,dvud IY's Diviliod
             WARGAMINGTIIE BATTLES                                10men-at-arms,  polearms,  full-plateannour(Vet€tan)
                                                                  10billmen,polearms,   balf-platearmour(Veteran)
Themapsarefor 6' x 4' tablesusingl5mm figures.If you a]€ usirg 15billmen,polearms,      paddedatmour(Average)
Amm frgurestheyshouldbeIncrea*dapproprialely.                     25bo*men,longbow,paddedarmour(Average)
 For norale pu4osesI haveusedthe followingtends,*hich can 2lightcannonandcaew
easilyb€convertedlo what€verpaniculars€tof rulesyoupreferto u!€:
                                                                  3.lard HrstitrC'BDivision
Yeterrn:experienc€d andwelltrainedtroop6.                         10men-at-arns,  pol€arms,  full-platearmour(Veteran)
Avenge:trainedtroopsbut with linle battle exp€rience,or good 10bilmen, poleams,haf-platearnour (Average)
qualitymercenaries- experienc€d butlesspilling to risktheirlives. l0 bilmen, poleams,padd€darnoul (Poor)
                                                                  20bowmen,longbow,padd€darmour(Poor)
Poor;rawrecruits,or low-qualitynercenanes.
                                                                  4. R€serveDivisiotr
  Within€achdivision,the troopsshouldbe split into threeor four 10men'at-arms,    polearms,  full'plat€a.mour(V€leran)
units,sometimesmixingweapontyp€s,vdthbowmenin thefiont rank l0 bilnen, pol€arms,        haff'platearmour(V€teran)
andbillnen behind.                                                10bilmen,polearms,    paddedarmour(Average)
             BARNET,FIGURESCALE50:I
                                                                            TEWKESBT'RYFIGURESCALE25:I
LANCASTI]ANS
1.E d ofOtrordt Diviliotr                                          LANCASTRIANS
10men-at-arms. polearms. fu[-platearmour(veleran)                  L Dokeofsoners€l'sDiYiiioD
10bilmeo,polearms,  hafi'platearmour(Averag€)                      10men-at-arms, poleams,full-plateafinour(Veteran)
20bilneo, pol€arms, paddedarmour(Average)                          l0 billmen,poleaims,half-platearmour(Average)
40bowmetr,  longbow,paddedarmour(Average)                          20billmen,polearms,padd€daimour(Average)
10cavalry,lance,half-platearnour (Average)                         40bo$,men,  longbov,paddedarnour (Averag€)
2.MarquisotMontrgu'sDivirion                                       2.EdFrId, Princeof Weles'DiYlrion
10meFafarms,poleanns,fuI-platearmour(Vet€ran)                      10men-at-arms, polearms,firll-plateainour (Veleratr)
10bilmen,polearns,haf-phte amour (Vet€mn)                          20billmen,polearns,balf-plateainour (Average)
20billmen,polearns,paddedaimour(Average)                           l0 billmen,polea.rms,
                                                                                      padd€darmour(Poor)
20bovmen,longbo{,,paddedamour (Average)                            20boemen,longbov,/, padd€darmour(Averag€)
20box,men, longbow,paddedarDour(Poo4                               20bou/men,  longbow,padd€darmour(Poor)
3 lightcannonandclew                                               I lightcrnnonandcrew
3. Eadof f,letert DiYision                                         3. Eadof DevoD'sDiYi'iotr
l0 men-at-arms, pol€arms, full-platearmour(Veteran)                10men-alarns,polearns,fiill-plateannour(Veteran)
10bilmen,polearms,   half-platearmour(Veteran)                     10biln€tr, pol€arms,
                                                                                      haff-platearnour (Average)
20bi neo, polearms,  paddedarmour(Poor)                            20billmen,polearms,paddedarmour(Poor)
20bosden, longbow,paddedarmour(Av€rage)                            m bown€n,longbow,paddedarmour(Av€rage)
20bo$nen,longbow,paddedarmour(Poor)                                20Fr€nchmerc€nan€s,  cmssbow,  paddedarmour(Poor)
                                                                                                                                                    27
YORXISTS
l Dukeof Glouctster's
                    Division
l0men.al.arms.polearm!.fulfplalearmour(Veleran)                                 Wherecan I find 2000 MilitaryBooks?
10billmen,polearms,halJ-plalearmour(Veteran)                                                              ln the
10billmen,polearms,halJ'platearmour(Average)
30bo\r,nen,longbow,paddedannour(Average)                                            KENTROTMANCatalogue
2. Fiward M DivisioD                                                                                    of course!
10men-at-arms,polearms, full-platearmour(Veteran)
10bi men,polearms, half-platearmour(Vet€ran)
20billmen,polearms,paddedarmour(Average)
20bo\rmen,longbow,paddedarmour(Average)
2 lightcannonandcr€w
3. I-ordlia51itrC's
                 Division
l0 men-ar.arms. polearms,        armour(VeLeran)
                          tuU-plate
10bilm€n,polearms,   haf-platearmour(Av€rage)
15billmen,polearns,paddedarmour(Average)
25bovmen,longbow,paddedaflnour(Average)
4. D€trchedClvalryWing
10cavalry,fullrlate, lanc€(Vet€ran)
                                  NOTTS
(1) Calendar of statepap€rs,Milan.
(2) Richardke Thitd,W i,amShakespear€.
(3) Hiiotiz oftheA ivdl of EdN/otd N.
\4) Hbtotiz ofthe Ativall of Edwa  N.
                                      LANCASHIRE GAMES
                                      20 PLATTING ROAD- L.lDGAl€.         OLDHANT Oln 4DL- ENGLAND. TEL: 01457372?l? d 0402 139{90
                                                                                                                         NEW                            NEW
         !E{8E9!!E!                                     E4E!A!jI!4ES4I]SL                                                 AVAII-AtsLE!'ROMMARCI{OURNEW
                                                                                                                      MNGE OF I 5mm20lm & 25on EUII-DINCS
                                                                                                                      SENDFOROURLISI'TODAY I
                                                                                                                            TIIJI'SEINCI,UDE:
                                                                                                                        15m AIlAll, IiORSE& MUSKET.
         ElllsEL4!g!!B4E{!4                                                                                             20m WORLDWAR IWO
                                                                                                                       25m I{OINE & MUSrcT
                                                        !4!!44!
                                                                                                                       COMINGSOONMORL l5m AXAB AND
         u4au{a@A!                                                                                                    20@ WORLDWARONE/TWOEASTERN
                                                        !4G!!!g.q!SU44A1                                              ITRONI'
                                                                        lstEll_IE48t !48
                                                                                                                         OPEN FROMlst MARcn oURNEw
                                                                                                                      PRFMISESPHONEIOR OPEN]NGTIMESOR
                                                                                                                      SFND!] FOROI'R FI'U, LIST(S)AND
                                                                                                                      SAMPLECAS]ING
                                           DESIGNERARMIES IN I5mM
                                      ou' D*kn' amis h.ve! proled b be very pop.lar sine rhsy $fise i'tod.d a ad )dF ago sd h.pc $a )e sill s du
                      Fi6     giv. wu rhe ld t.lue aood rirfi rhe nrrirb     .dd of [esbilny. T]'e ami6 6 lE nad. !p ft@ *6l   dflsol Fio* rd
                      ldjq     usi,c oe d dlG 6gcE tlEufadrs'.        ad if)ou amy *eds lne loopc or 20opcu4 e*a fisu6 o ened by lro - rtu
                             TEIRION BASED                            TJIIDASID                  I4as..i!'t9-c!49!3!s9!4
                                                              usr-srj44Nr4eraE!!*
                               ( lsaliRGft.         l\lllen   Vintrlld.In.g!l&   Vinirub.   T,brqopG:mN vini'u c FiesiD. . Dmingm           l
a{AsN@s s4qEI!!!!!ArU@r
                  @f         noa@sMlMvnMs
                  AMERICAN
!E!!@
                                                                                                @M    NCIMEAUDMM
                                                                                                mWdD^MsNF!{llrffi
                  GEBU!
                                                                                       2lhh WORLD WAR ONE
                                                                                       9E!!4A!
                             c6eER(Mtujw
                  SAUIAICT-!84!
                                                                                       ,@d      Nrrmr@M|{Nc$A)
                                                         2ltM \1I)RLp wAtt TWO         ,@B      MrmYMN6GEID
                                       sElErJE4A!.tlAa                                 4UE8!E4I.q4E.SIINDETEdDEdID
    BATTLE
    PACKS
    1 PACKf 10.50,
  2-3PACKSf10 each
    or 4 OR MORE
    PACKSONLY
       f9.50each                                                                       ,{tbn woRLD WAR Trvooo Em    )
    (EACH PACK
      CONTAINS                                                                         zMe      san@Bmctld        raofMM
      100FooT oR                                                                       2EE-!@8!S]4AB-O!EcIn(iA)
                                       sBPlr   r^@3ftsvdrY(frMcl'
    40MOUNTED
   oR AS STATED)
PA}A \I'LLIES \v.{RG]!]INC             NORTS BAY CA.VES &                    LIERERJA ATLANTICA           BATTLE CROIJP GAMES
sE$84L                                 uo!tIEs                               PZA STA I\'1a.SOLEDAD        P.O.BOX r82, AEDFORDVIE!!"
8014I\ORYFOREST,  SAN                  490\({N STREET
                                                    EAST,                    TORRESACOSTA2, MADRID        JOqANASBERG&S.A, SOLN{
.{\TONIq TELAS.782r9-:r505,            NiORTHBAY, ONTARIO                    28004, S?At\-.
Ijsd   lEL: (210)6546601               CINADA PlB IBJ
                                         TEL:105 4762004
l4
 'ITSTHEMPESIW                                                               Beingclosefirendsof thewhites,theParlD€€mightbeexpe.{€dto
                                                                          havenore thar theirfair shareof fteaflns. Becaus€ of theircontacts
                                                                          *ith thesouth-€ast€m  woodlandtrib€stheyalxomadeu3eof sstem
                                                                          vr€apofflike the "ball" and"gustock" club6,in Prelerenctto the
   IMUNSAGATN!"                                                           stone-headedPlainstne. Theyhadwarriorsocieties  lile manyof theii
                                                                          rcighbouB,oneof {hich employ€dan interestingvariatiotrod the
                                                                          usualsashu!€d to pin a vanior to the gound. Inst€ad,their Crazy
  MoredNoteson Customlshg                                                 DogsSocietyusedaropeanached    atorc endto aslateandat th€other
                                                                          to th€s/anior'spenis.(I defyanymanulacturer to Foducoa figure!)
     PIafm&ldtanArmles
          ParlTwo                                                                                    THE,KIOWA
                         by ChrisPeers                                     TheKiowaspokea latrguage        relatedto ihat of the Pueblopeoplesof
                                                                           NewMexico,andsoare       generally assumed  to haveoriginated  fromthat
To cotrdudemy noteson producingPlainsIndianforcesbasedon area.Hovr€ver,in the eady18lbcenturytheywereliviogfar lo the
sp€cificp€oples,I will tale a look at sordeof theleadingtrib€son the north,in vhatis DowModana,asalliesof theCro*6.PerbaFbecause
SouthemPlaiDs.It mightbe worthnedtiodingthat sone authoriti€s they had originaly beena setded,agdculturalpeople,they were
regardSouth€mPlainswarfareasslighdydiffer€trtin ib enphasishom exceptionally              richin art, orltoreandritual: it hasbeensuggested     that
thatof the mor€nonhemp€oples.For onethitrgthe warnerclinate theKiovahventedth€SunDanceandinEoduc€d                             it totheothertrib€s.
meatrtthat tfiere s,ass€ldoma long qdnterbneakftom inler-t ibal              Theyhadsacr€dstoft idolswhichworesometinestalen otr var
sarfare,*hen theweather€nJorc€d          a nore or lessinvolu ary truce, erp€ditiotrs.  Theyalsohadamilitrry hierarchyanounthgalnostto atr
Materiallythesouthemtrib€slivedsimplerlives,andhadlessaccess           to her€ditary  adstocracy,  headed   by asociety-lhePrircipalDogs-which
thefuls andporcupinequilb with whichoorthemoNlik€dto decorate comprfu€d               thetenleadbgwardonof thetribe.TbeKiowaweresaidto
themrelv€s;    south€mwarfarewasthuslesscomEm€dwith showand hayeb€enfearedby vhilestmyellingtheSantaFeTrailmorelhanany
dtual. Perhaps     the abovehctors help€dto nake it nore inplacable othertribe in proportioolo th€ir nunbers,possiblyb€eus€of their
anddeadly.C€rtafulythe erhitesregardedsomeof thesoutbemhorse reDutation               asthemoststillul tortureBin tbew€st.
Indiaff asthemostterrifyingfoesof all.                                       Theyhadspentmucbof th€ 18thc€nturybeiq victinis€dby the
                                                                           Siou, whos€remorenumerous           andbetter€qulpp€dwithhors€6and
                              THEPAWNEE                                    gum.  So when   lheyhad  acquired  enough  horesthem$lvostheKiowas
                                                                           rodesouth,relyingonmobilityto ayoidtheirenemies,         andsoonSained
Althoughtheyplayeda sigtrGcant          role in the warsof the Plains,the a repulationasthe mostenterprisitrg       long{istaN€ raidersof all lhe
Paw[e€s    werenotthemselves     atruePlainsp€ople.Origioallytheyser€ hors€trib€s.Id the1780s        theyc,erebackontbenorthemboder ofNew
anoffshoot    of the  Caddoan  Federation   of thefukatsasrcgiotr,related Moico, wherelhey madeftiendscdththe Comanc$es.                [o the 19th
to the aftient temDle-mound       civilisatiotrsof the south{ast.At som€ century,KiowasaDdConanches           usuallyfoughttogether.
stagetheymovednorthup the MissoudRiyerandb€&meoneof a                         (AmoDgthe Kiowa aas a small clatr which spole a differetrt
numberof semi-nomadic        peopleslivingontheedgeof thePlairls,who language,       relatedto thatoftheApaches.      Th$e weresometim€s     l(nof,T
divid€dtheir time betweenbufralGhuntingandfarming.Ooeof the as Kiowa-Apaches                     o. PlaiN Apaches.This is colli|smg, howeyer,
largertribesoftheregiotr,theytrurnbered        about10,0min theearly19th b€cauethelatterte.mproperlyappliestotheApachetribeswhichhad
cetrtury.                                                                  dominated   lheSouthemPlamsb€foretheCrmanches            &ovethemwest
    For mostof the y€3rthe Pac/D€e        werebas€din vilagesalongthe h th€ early18thclntury. Ther€wereno realApach€son the Plaits
Missouri and its tributades.Thes€ wete protectedby woodetr afterthat,apartftomafewLipaNwhohlng ononthenestomfting$,
stockades,   andconsisted    of eanhlodgeswhichcouldnotbebumedby aDdif therehadb€en,th€KiowaandConanchewouldno doubthave
anenomy,andwercarangld soasto providecoverandgoodfieldsof ts€atedthen asenemies,)
6rc for thedefenders.     Suchlacticswercevennore effectivewhenthe            Kiowaleggings   oftenhadredllaF anacheiatthetop6like lhos. of
Pawneeacquiredgunsfrom the French,€3rly in th€ lSth cedtury. theCheyenne.                   Thepracticeof paintingtheMy, shieldandhors€with
Thesedefensiveadvanlages         larg€lyoffsetth€ obviousdisadvantagethera$e colourm designis saidto havebeenpopularamongthern.In
thattheirmoremobileeneniesknec/wh€reto findthem,andeoabled Dlostotherresp€cts                    theydressedlike lhe Comanche.        Tbeywerethe
 the Pawneeto slrvive d€spitethe inplacablehostilityof powerful ackooc€dged€rpensamongthe Plainspeoplestu signlaogoage                             -
 eoemi€sliko the Sioux.Otr the other hand,whenPaen€ehrnters perhapGbecausetheir otrn languagex/as almost inporsible for
 venturedonto ihe open Plainsh soarchof buffalo, lhey b€aamo oubidersto l€am.TheKiowawereesp€cially                        alraidof owk, andif one
 wt&rable. For exasple,in 1873the Siourcaughta huntiq partyat washeardhootingavrarparq wouldoftentum backonthespot.They
 MssacreCanyonin Nebraska,andkilled 150of lhemithechast€ned g!€atlyvenerated                  beirs- whichwaskmwn to caus€ftictionwith their
 survivorsbadto berescued       by theUSArmy.                              Comanche    allies,whowouldp€rsisth eatingthen.
    LiketheCrou/,thePaq,nee      tbrewin theirlot cdththewhit$ ard s€nt
 contiqe s to Eghtwilh then againstthe Plainstribes.Alro like ihe
 Crcc,,th€ydidnotproft ftomthispolicl in tbeend.In 18?6,3ssootras                                   TIIf, COMANCIIE
 theSioux   theat   seemed  to have  been  eliminated, theyw€rekick€d out   Lile the earliest Plains  horsemetr  - th€ ApacheandShoshone         who
 of theirhom€sio Nebraska       ands€ntto theIndianTetritory.               dominatedthe regionin the l?th and early 18th centuries- the
    Alhoughrct €sp€cialyrichin hors€s,theyoftenfoughtnountedon Comarcheaniv€dhom tho sest. Theywerein factcloselyrelalodto
  thenains,usitrgihousualtactics.However,theylookedverydifferent the Shoshone,               amotrgwhomthey had oncelivod in what is trow
  ftom the  rrue Plaiff trib€s. They  did trothave  the o$tonary lo4 hair,  wyoming.   Tbey  splitavrayftomthen around17m,s/h€trth€yacquir€d
  but oftfl shav€nth€irheadserceptfor a snall tuft on thecrom, and hors$ andb€gaoto ddft southalongtheeastemfrinS€of the Rocky
  paintedth€headandupp€rpan of the facered. Scoubpaidedtheir Mouotains.The Conadcbehad originally been very poor and
  faceswhitein orderto inyoketheporverof thewolf. Alotrgwith other back*ardcompa&dto rdanyothertribes:theyhadno knowledge                         of
  south-€ast€m    tribesthePaxmoo    sometines*ore a stntrgeloohngfirr      agdo  t|rc,  for example,   and  possess€d lide  in  the way of political
  c{p, s/ithapaint€dhid€trisngleup to afoot lodgstickingoutto either organbation          beyoodthofamilyor informalhuntinggloup.
  theleft or rightside- althouSh    thiswouldnot seento havebe€nvery           Perhap6 b€cause  theyhadsolittle to lose,theyadoptedthehorseand
                                                                            the aslociateibuffalo-hunting    culturewith unreslrained   enthusirsm,
                                                                                                                                                                                                l5
                                                           IRREGULARMINIATURES                                                                                          *_.mX;*__
                                               69aACOMBROAD.HOLGAIE. YORKYO24EP TEL:(01904)790597                                                                        i.d..-'"d*.
                                                   SORRY,NOCAIIERS, DUETO COUNCILRESTru.CNO1{S                                                                           ffiffi
                                                                                                                                                                           d@rEr6d
   "Jn*rnrsulJ@
   ;;;;;.:;-";:;                                                  Post^Ee
                                                                  Posr^aeiate 12ky,
                                                                              12thyo 50p on orders lessthan 12                                                               ttr0i!d!6t-rd-
            nLd,*                                          winnerof the
                                                                    iheFIASCO
                                                                       FIAsco mail;(ter
                                                                                  ;(lel conpedrion
                                                                                        conpetitionfor 4years
                                                                                                        y€ars                                                           tr#ffiffi
                                                                                                                                                                        ffiffi?
   i;;;;1,i4
   hr.;6-jE*-*!h..                       d@**.
   qN;--;tudl.4                          brd;u                                                                                              &;.       .......    ....
   "y:4=,.{y"1c::::9- 'I:,y*:".'":::.tr:,..                        r4irbrtu     rtud                                           60      tu   ^;-6q;&*Fd-k4^lDb1F!@
                                                                   fuh{!\@R,.bfuN4fu
   ffir:ffi:";,5,T:t"J';i".:i1,fifr1,Y,fi:1"*".r""+'*                                                                                       ;';.d;;bd;r.tut"b                        iG-nffi
   @.'*;ryi*dnrFsJ*'lhid;ddtu'@                                    lLIntertr,,@
   dq*drc6!:&D';d'@t<:@                           deo4ie           ftrtrsebM                                                                ofubRMM        B'q;dqi:i&drd
                                                                   pddiebEftrsb            b4*eF4                       ..     trd
   f:!F!-*Jt1E3q9d-a.I-+-rldvd                                                                                                                                .,..... ....... ...!'+alrr
                                                                                                                                                                       . .. ..as!!*t
                                                                   rtu;-tu-ard^q''....            ........... .                uo      @ft;t;;&tuevnhi4d_ui!&,EFb
                                                                   rd b'dh;.-!fu!-d4                                                       ;;;;;l;Mb*{rue'               .... ",*!r,r.,
   ry4
   9d      9d!,                                            f 15    Mbu.h      !i.B   xho4i!!bE,                                !!      tu   wdlie&d4r_ldsrcldwdr
lsbrdlq''''''.''''..e!
                     By TimWalker                                                                            t               l
At our Club AGM we usuallyplay wargamesof a more
light-hea(edvariety than usual.The follo*ing offeringwas
                              requidngno prior knowledge                                                     MJ
                                                                                                             [lt-]
devisedasa multi-playergame                               on
the part of the participantsand enablingthe oryaniserto use
alreadyavailablefi gures.
   Eachplayerwasgivenan 'Introduction',a'playsheef,which
were the samefor everyone,and a 'charactercard' which
                                                                                                             E
outlinedan objective,movement,combat,escapeand money
valuesand any specialabilitiesor possessions for that player.
Players'charactercardswerenot revealedto eachother.
   In addition,as umpireI had a deck of cards,eachwith a
player-charactert  nameon it, to determinemove sequence,                            PIGSWILL
anda  lht ofrandom  eventswith whichto besetthe  Dlayers.     onlyif targetin cover).A scoreof 1will hit thefint objectwithin
                                                              I inchofthe intendedflightpathofthe missile.
                                                                 Onewoundis inflictedfor eachhit.
             PLAYERS'INTRODUCTION
                                                                  Blocking
welcometo thequaintmedievalvillageof Pigswill.                    You canattemptto blockthepathofanyonewhopasses        within
  The villag€ hasfive streetsanda marketsquare.The principal      an inchof your character. To do thisbothplayersroll a d6, the
buildingsarethe tavern, 'Ii e Pig and Trumpet', the Chulch, rhe   block succeeding if the blockingplayerwins. Combatalw.ys
BishoD's Residence  andtheWatchtower(whichalsodoublesas           occursin this situation,regardless  of whethereither player
aJail).Thereis alsoa substaniialhouse  belongingtoa m€rchant      wishesit.
andseveralpeasanthovels.
  The big rumour aroundthe villagetoday is that a'Great
Treasure'istoarrive.But who istobrins it?                                             TTIECHARACTERS
                                                         I feelthesearethe mostimportantcomponents     ofthe game,as
                      GAME RIJLES                        theywill governtheowningplayers'actions.Theumpireshould
                                                         encourage roleplayingbytheplayers.Thisshouldhelpensurea
Thesearedeliberatelypitchedat a very simplelevel.Theycan
                                                         suitablelevelof confusion,asno-oneshouldbe awareofwhat
be DickeduDin aboutthrceminutes.                         the othersare tryins to achieve.Belowis the list of characters
cameTurns                                                usedin our game.You may have to changethingsaround,
Turnsaretakenin sequence,deteminedby drawingcardsfrom introducenew characters      etc., if your playershave readthis
a deck.                                                  article.
Mov€ment
                                                                l. SisterBrunhilda:an old andflabbyGcrnan trun.
This is normally8 inches,unlessyour chara€tercard states
otherwise.Movementoverobstacles  or throughbadterrainetc. Object: To visit the churchfor prayerand contemplation,
is reducedbyd6inches.                                                      andwoebetideanyonewho t estopreventyou!
                                                                Move:      6inches.
Combat                                                                      -1. (On accountof yourageandbulk.)
                                                                Combat:
Occurswhen one or more charactersare within one inch of one
                                                                Escape: 6. (Alsoon accountof your ageandbulk.)
anotherandanyoneofthemwishestofighton theirownphase.
                                                                Speclal: Your pet'Fido', a ferocious'dog' (in fact a wolq.
Theremay be severalroundsof combatfor eachchara€terin
                                                                           He will obey all your commands,movingon your
eachturn. All combattantsin a meleewill fight, no matter
                                                                           tum.  He canmove 12inches,escapes   on 4, 5 or 6
whosetumitoccurcon.Combatcontinues     untilsur
                                                                           andfightsat +0.
longerwithinaninchof oneanother.
                                                                Money: 3 shillings.
CombaaProcedure
The player/non-playercharacterwhoseturn it is rolls againstall 2, Chartes:Atr unemploy€dBurgundianmercenarJsoldier.
lhosefighringhim or herseparately.
                                 eachaddins  " or su- brraclrng
                                                         -- ' ^,           -Food.
                                                                                , moneyandemployment.
                                    ,                           OUl..l.                                in Lhatorder.
Inecomoalvarueon rnerr
               poin!foreacb
  lnflictonewound         poinr)ouwinby.s"tt* *.
woundpointforeachpointyouloseby.
                                                                  iffi,,     I'i'""
                                                         Escap€: 5or 6
 Deathoccurson reachingfoul woundpoints.
                                                         Special: You haveone of thosenew-fangled      Handguns.It
E$ap€                                                             hasa rangeof 12inches,will causeall animalswithin
You can attemptto escapecombator any other unpleasant             6 inchesto bolt whenit is fired,butwill not work if
situationon yourowntum bcfor€youmove.lf youfail,youstay           wet.
put; if you succeed,do a normalmove, but not into combat Money: None.
unlessthisisunavoidable.
  To'escape',roll the numbershownon yourcharacter  card. 3. BentDick:Thevi agewatchman..
MisrileFir€                                               Object:            Maintainorderand,ifyou can,makesomemoney
Rangeis 16inches,              To s€orea hit roll5 or6 (6
                unlessobstructed.                                            on the side.
38
Mov€:      8 inches.                                           9. Igor the Idiot The villageidiot.
Combat:    + 1 (You havea verylargeexecutioner's
                                              axe).
Escape:    5 or 6.                                             Object:  You havehad your silverring stolenby a person
Special:   You have the keysto the jaiywatchtower.ln the                with a funny accent.Try and get it back and punish
           tockupis'RancidRanuF. You can'tremember  why                 the personrcsponsible.
           he is in there.                                     Move:    8 inches.
Money:     6pence.                                             Combat: + I (You maybe thick,but you arealsoverybig.)
                                                               Es€ape: 6. (You aretoo dim to knowwhento quit.)
4. Sir Ednund: The lo.rl tax gatherer.                         Special: Nil.
                                                               Money: 2 pence.
Object:   Extract 3 pencetax from everyone,particularly if
          this will causeexcessive hardship.(You are not a 10. Jumpled€:A cudousp€asant,
          niceman!)
Move:     8inches.                                             Object:    Nobody seemsto like you or your invisible friend
                                                                          'Auila'. This hasupsetAtilla very much, and he
Combat: +0-
Escape: 4,5 or6 (You area veryslipperycustomer.)                          wantsyou to make them all suffer for it.
Sp€cial: You have a servant called   'Scab', to carry all that Move:      8 inches.
          heavymoney.Scabis so disgustingtha! he is not Combat: +1.
          allowedintoanybuildingat all.He will alwaystry to Escape: 6.
          escape from combat, but wil otheruise obey Special: You arebarkingmad.
          instructions.Move:8 inches:Cornbat:-2; Escape: Money: Nil. Nastystuff,tasteshorrid.
          3,4,5or6.
Money:    12shillings,carried by Scab.                         ll. Kurt: A Nnight of thc TeutonicOrdcr.
                                                               Object:    You hav€ been commandedby the Head of your
S. Sir Hugh Dickedd:A bold and chivahou! Knight.                          Orderto deliveageat treasuretothe Bishop.This
                                                                          [easure is in a smallbox canied by you at aI times.
Object:   You wish to prove yourself by doing chivalrousand Move:         6 inches on foot (heavy armour); 12 inches on
           Knightly deeds-You are alsoan'upper classtwit'.                horseback.
Move:      6 incheson foot (heaiy armour), 12 incheson Conbat: +2 when charginginto combat on honeback
           hoNeback.                                                      (lance);+ 1 at all othertimes.
Comba.: +2 charginginto meleeon horseback       (lance),+ 1 at Escape: 6onfoot;4,5or6onhorseback.
          all othertimes.                                      Special: You hav€ahorse,called'Towser'.
Escape: 6onfoot,4,5or6onhorseback-                             Money: 6 pence.
Special: You haveahorse,called'Rovei.
Money: 10shilings.                                             12. Llerelyn: A wclshman.
6. Haystlck Hsrry: A pcasent,vho smellsof sooa.                Objectr To removean animal, preferably a sheep,from the
                                                                       village,andmakeyourescape.
Object:   You are the village arsonist; you find fires very Move:      8 inches, reduced to 6 inches iJ driving/carrying
          exciting,go andstartsome!                                    animal.
Move:     Sinches.                                          Combat: +0.
Combat: +0.                                                 Special: Sling,range12inches.
Escape: 5 or6.                                              Money: None.
Special: To start a fue roll4, 5 or 6 when next 1osomething
          flammable.Subtract2 if target is moving/alive.    13. Slipp€ryMcDufi: A Scottishhouscbreaker.
Money: Abent penny.
                                                            Object: Burglary.
7. Hcrcule:A Belgianmercenarysoldier.                       Move:      8 inches.
                                                            Combat: -1.
Object:   You are poor and hungty. Get somerations, evenit Escape: 3,4,5 or6.
          it meansworking for them.                         Special: You quietly pick a door lock or window on a roll of
Move:     8 incheson foot; 12incheson holseback,                       3,4,5 or 6. lf you rol I, you havepickedthe lock,
Combat: + 1 on horseback;    +0 on foot.                               but made enough noise to be heard by anyone
Escape: 5or6on footi3,4,5or6on horseback.                              within4 inches.
Special: Youhaveaho$e,caled'Spot'.                          Money: None.(Pickings       havebeenveryleanof late.)
Money: None.
                                                               14. Nipper O'Toolc: An kish pickpocker.
8. Brother lgnatiors: A devoutmonk,
                                                               Object:  You are travelling under the pretence of religious
object:  This vilage is a moral sewer; go forth and chastise            pilgrimage,andreckonyoursef the finestpickpock-
         the ungodly. Your order sanctions the use of                   et in the land.Go to work.
         violenceif it is required. Cleanup the villageI       Move:    8 inches.
Move:    8 inches.                                             Combat: -1.
Combat: +1 due to your faith, until someoneactually huns       Escape: 3,4,5or6.
         you, when you realise it won't stop you getting
                                                               Special: ff within 2 inches of a victim you may pick their
         kill€d.                                                        pocket,saddle-bag    etc.on a roll of4,5 or6. Ifyou
Escape:                                                                 ro 1 however you are discovered.Last night you
Special: Moral superiority.                                             'found' a silver ring with a letter 'l' on it during a
Money: Who needsmoney?
                                                               Money:      None.
                                                                                                                                             39
        .tfte lBunkern"Y"Rffi
  ff================
             PUTSII{E GAME BACK INTO WARGAMING
                                                                                              \J
   THE ALTERNATWEWARGAMESHOLIDAYVENUE!!
  NOW - EVERY         WEDKDND!!!       AT yOUR SERVICE!!! - By popular demand             and due to last years
                                                                                      '97 (Book well in advance
  response we have arranged to be available for ANY WEEKEND you may requlre in
  to ensure you get the weekend you request).
                       '97 Keepingwith the policy of customer satisfaction you can choosealmost any combination
  NEW GAMES FOR
  of gamesfor your weekend.
    "TREEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEAS['RE
                  Ist lfND- sall unih be  Hispmiola   towdds         PLB   oliL                    - "cRoss   oF   tRoNl'rHE   e4cLE   His
                                                                                  Jaoo!.ir8
       treasure dd rrches. folfNthe Dap to]@d pieces of ei$It        IANDED^:1977^ s.uonbe Bds wiM           o.[ B6t Deturetratttn
       laDd who de tne 15 dead men...)                               cffi sh..ni2Llrfqpl6 )995 . 'FAID AT ENTEBBE".Wi^nq Best
    "GrrNs oF NAVARoNE- lust a sma.ll task. go in. desboy                           s'e!441!!pte:  1ss6  'coNOLEsr    oF AMFIItCA
                                                                     tPYlst\lg -tttaGNtncENIT'_633SOU,DRON"--SIFIwEEKEND"
       the Guns. dd back for brear.fast._" e.reatiy ","u o,-;.       953AD-
                                                                                     WEEKEND-     'FANr'4sv WEEKE
       no hold uPs no Prcblems jt"t. -"alt"--i"-i"i[i"               ..'MEDIEUAL
    "Tm    BoRGGAME-{cubi"t w*g*hel          *"" th" r   ";i,       l"PrtfJH""          or- r"norJRrr€s. AxD nDw EvENri - FrrLL
        deshoy Borgs,                                               DErrtrs oll DATES. cr.MEs aND Eow To rRRAxcD yorJR
    "ttID SWEENTY GAMD" Fast cG,        Fldes @d Attiiude.          WEEEENDsEI{r on REguEst
                                                     Tlmctrblc of EYcrtB
             trdday                                  Satunhy                                                Sutrday
    7.3oDmDillller followed bv
                             '            9.30am Batde Conmences                                    9.30am Batile Commenc€s
    introductorybrieffngs                 12.00' l.00pm Lunch                                       12.00- l.oopm Lunci
                                          6.00pm,Dinirer.fouowedby last moles                       4.00pmCam€Completion
    ONLY €8O.OO per Perso! - FuIl Bosrd                      GRot P DIscoIrNTslt               2 players,orly 375 crch
                                                                                               3 players, ody €?O clch
      hrshqDanty.
               hdrtonal/v.eebdan.Enc'bhBed& Be,lfast                                           4 players. or y a6o clch
  For ftrdhd detalb of cscL .v€!t od a coEplctc tlmct.bl.             Models dftd Jigures Jrom the superb ranses oI
         plcsc scnd a !,r.c. to Shoun Mclsughlln,                     RAVDNTHORPEa^d VILLAGE GREEN are no'./,
    7 Bte.mblc Dcn., woodthorpc, YorL YO2 2RL                         auailahle bg rcqrpst at the cente - Checkfor details!
               Tclephone (Ol9O4) 705399
                                        ADVEI{TURESE\'ER TOLD!!
                    IN SOMEOFTHE GREATEST
          PARTICIPATE
Object:    You are a bogus magician, fortune teller, water         He startsthe gamein the Bishop'shouse.
           diviner etc. who hasrecentlybeen 'closeddown' by        Monk
           the church authorities. Retaliation is definitely in    Incorruptible guardianof the churchand its valuables-
           order!
Move:
                                                                   Move: 8 inches                    Combat:
                                                                                                          +1                     Escape:5016
           8inches.
C-ombat: +0.                                                       He startsthe gameat the church.
Escape: 4,5or6.                                                    The lDnk€€p€r
Speciall You may 'curse' anyone reithin 8 inches. (Both            A muchscarredand batteredlooking man, very large.
         playen rol a d6 to seewh€thersuperstitionor sense
         winsout.) Thosewho believethemselvescursedwill            Move:Sinches                      Combat:+ I                  Escape:5or6
         - I to aI later die rols.
                                                                   He startsthe samein the bar at thetavem.
Money: 6pence.
40
Inn StaIT                                                   6. Drunk
As peasants,
           but witl alwaystry to avoidcombat.StartinYard. Lurchesinto town alongTowerStreet.will walk d6 inchesper
                                                            tum southuntil he leavestown, mutteringand rantingabout
                                                            'sodngthemout' and'I'll showthem'.On ad6 roll of5 or6he
Eachpeasantdwellingandthe merchant\housewill have1to 3
peopleinside.Theywill fightto defendtheirown.               will shoothiscrossbow at the nearestperson.
Move:8inches            Combat: I            Escape: 5 or 6 Move:d6 inches.Combat: 1. Es€ape:Never.wound points:
                                                            4. Money:2 shillings.Shoot: 1.
                                                              7. Beggar
                 KTJRT'STRXASURX                              Will hobbleinto town alongChurchStreet.He is exlremely
As there is a distinct possibilityof someoneattemptingto      scabbyand smely. He will try to persistently
                                                                                                         beg,whineand
relieveKurt of his responsibilityfor the 'Great Treasure'we   wheedlefor alns from the first personhe sees.He tendsto
needtoknowwhatit is. Roll ad6 whenthebox isopened,and         throw daggeninaothe backsof thosewho cannotrcsistthe
tell onlythosepresentwhatthe boxcontains.                     temptationto kick him.
L GOLD: worth!100.                                            Move: 6 inches.Combat:-1. Escape:6. Wound points:2.
2. Fragmentof the 'True Cross',as certifiedby His Holiness    Money:Nil. Shoot:4inches-
   ThePope.                                                   E. M€rchatrtand Bodyguard
3. ToothofJohnTheBaptist,ascertifiedetc.                      Entertownwith theirwagonalongEastStreet.Theyonly wish
4. Ashesof SaintLotharThe Enigma,ascertified. . .             to reachtheMerchant'sHouseinpeace.
                                                                                              Wagoncontainsfl0.00
5. Incredibtyancientandundecipherable scrollof parchrnent.    in assortedgoods.Merchanthimselfhas 20 shillingsin his
6. SILVER: worthI30.
                                                              Merchant
                  RAI\'DOMEI'ENTS                             Move: 8 inches.Money:20 shillings.Escape:5 or 6. Wound
                                                              points:4.Combat:-1. Shoot:No.
Each gameturn roll a d20, carry out the eventsbelow before
playersstan their tum. Roll of 9-20meansno nndom events Bodtguard
thlstum,                                                       Move:8 inches.Money:Nil. Escape:5 or 6. Woundpoints:5.
                                                               Combat:+1. Shoot:No.
l. Rabid Dog                                                   Wagonmoves6 inchesperturn.
Starts(1,2or3) EastStor (4,5 or 6) WestSl.Will trot towards
the market squareif not attacking. Ro 4, 5 or 6 on a d6 and he
wil 'go for' the nearestcreaturewithin 12inches.                             PLAYING THE GAME
Move:12inches.Combat:+1. Escape:Never.Woundpoints: Ensureall playeNhavea set of playingrules,a d6 and their
4.                                                            charactercard. Don't forget to take out the cardsof those
2. DancingB€ar                                                characterswho have been killed or who have successfully
                                                                                                         'dead'playersto
Startsin tavemyad. Will standnenacinglyin the yard.Roll I completedtheir mission.(You can allow
or2, he will attackthe nearestperson,roll5 or6, hewill lumber re'enterthe gamewith unusedcharacters    if you wish.)It is a
towards the market place, After combat he must roll wound goodideato havea time linit (perhapsonehour) or limit the
pointsrcmainingor moreona d6 to continue.                     numberof gameturnsto 12or 15.Thisstopsgamesdraggingon
                                                              too long and encourages  playersto get stuckin; ratherthan
Move:6inches.    Combat:+2. Escape:5or6.    Woundpoints:6.hoveringon theperipheryof thegame.
3. Vigilantes                                                   If you needto decidea winnerthenit shouldbe the player
Startin thealleybehindthewatchtower(3 men).Will approach who achieves      hisobjecriveswhilstrernaining'incharacter'.
the nearestpersonthey see, and will accusethem of acting The umpire'sjob will be to keepthe gamerun ng quickly
                                                                                'off the cuff to playe$' questionsand
suspiciouslyor being criminals. They may attempt to searchor and responding
arest suspects. Theywill try to escapeif anyof themarehun. suggestions.
                                                                I imaginethat the gamewould be suitablefor playingin
Move:8 inches.Combat:+2. Escape:5 or 6. Woundpoints:4 almostanyhistoricalperiod,AncientEgypt,Dark
                                                                                                              Age Britain,
each.Money:d6penceeach.                                       the EnglishCivil War, theWild Westto namebut four.
4. Church Collectors
Startin Churchyard.Two severelookingmen.Will approach
nearest person within 6 inches of th€ churchyard gate for Allthe hovelsareorestoreyhigh,otherstwo storeys.
contribution to the church roof restontion fund. They do not The churchand tavem are constructedof stone, othersoI
take kindly to refusal and will always attack if insulted or timberandplaster.
                                                              All buildingsexceptthe churchhavestrawroofs
                                                              The  Mer€hant'sHousehasf20 in moneyandIr0 in goods.
Move:8inches.Combat:+0. Escape:Never.Woundpoints:4
                                                              The  Bishop\ HousehasIr0 in plateandf5 in rnoney.
each.Money:4d6Penniesin collectionbox.
                                                              Thereis plateto thevalueofls on the churchaltar.
     The GreatAdvanre                                                                                                  T h e s ci . h i c l . \ r r . r l l F u n e d L h l L ,\ L l hb i a c lr v r e sa d r r . . . . .
                                                                                                                   i i i : r i . n d r a lc r n L . er . : f l r : r l r L \ .d . r l i h r n ! r h . n rr nr h e\ 1 . .
                                                                                                                     r \ n e n i i r eS S 2 0u n l r1 sp . r r . e Ji L r \ m p ( , ! r r! P e r s h r rl g         . fn .
   Avrsrr ro rhe CeniraiMuseum                                                                                  pa of an.\.hangepackage                           sitlr the L S ro'drnment
       of the.E;trsd Forces                                                                                          S.ll-propclledarriller\ot morr recenrlme\ rsslnrivnin rh. :
                                                                                                                 lllmm and lilmn houlzer\ rnd a rn,rsslle                                     l]umm mortar.Itrr.
                                            ' r'.\,ri Cr-;';rrisl                                               rll     painted      in  a  shade          ol   medium          green       and     glo ln rhe Jrrf .
                                                                                                                - H y a c i n i h. - A c a c i aa n d - I u l i p r e s p e c r N . h
                                                                                                                     A n r i r p o r i a h l €h o \ i r z e ra n d d o u b l eb i f r e i e da n r l ' a i r . r i . : '
                                          BACKCROI'\,;                                                          n o u n t e d r n n n dg r e rp a l i e t s . ! . r . c a n r ) u f l r g r d i n mgirLcti : r '
                                                                                                                black,buI luftherd€!ri1!*c.c un.iaihhlc.
 h o \ i r r . l r o I \ L : j t € tLhl et s u k ,e \ t \ t r l i r a j . ! s ; u n r i d e n j o y e a     d
                                                                                                                     f u l l v - r.fL c k er ,nl r l r , i r c r aaf tn i L l . . \ n r h . \ h r f . o l a q u a d r r t .
lervpleasaa             nn  r d p r ol u c t i \ et e nd a v s o r s r h e r i B u r . i r \ L h . s e o i v o u
                                                                                                                 Z S L : r nr. d s i i . r l Z S LK l l l B . r ' ) . l 1 9 6 l . a . m e ( l n '
sho ha\e ferd mv occ.,nonal                        articlesfor tha mire^zin.ir thL px\i rilj
                                                                                                                 : f r . ! 1 . ! f l i . : , r r . . . a r ! : , , L n r e J! h l ! r . r r . r r r h \ r r ,
k l t i \ n \ ! r : r t r i r r r . L rr. gn a s s i ornsf o rr h eR u \ \ r i rA  . m \ o l t h €C : e a t
                                                                                                                .  trrni :r. . .:r.. . rr c\l r \eLL,i\
\ \ r i r i r e . e l - e i r $ . , i r n e \ r t r b hl h a t I s h o u l dn a k . * h ! r . t l r l n r e .
                                                                            '                                        Aniilt_,L. r| \hr:.. .,rd f.,i. ailu,l.. r. \l l,rl l-
rnfunrcdr..,:. !. rJje rf,l.r r li .. ,                                         r.\.rr.h rh.\ublec'                                                                                          . L i F L r c kI \ r . \ r n L r'
                                                                                                                 ! ' o w n z c r br .o u r r J , r ' . r . J
                                                                                                                  . , c k l h e s e . o r , 1l r               -'
                                                                                                                     r i h n \ f T h , ,r \ ' i .                                        . r f, i i e l r l v
                                     ,-,fi,:r'.                                                                                                                    ' : . . r , r , i i , Ll u n s .m c l u d r nts, - '
                                                                                                                 \l r.tLi : lLi                                              , . L r r p € l aA     l r s € n a lT. u l a .i n
                     . i i r . .! ( n : ; : . : .          ni          lrm(.Ffr.es.\lo\co$.ln                   Nhich        i5 almosM           r\Ji        .fin     , , rhe     irnroLrs      French        75 ol rhe ..,
r l i : i r . . \ i u . ( ! n . D r e ; l n r L ! L ! , n e\l l L r n o \ .t r a sk i n de n o u g h l o Deriod.Anotherfanililr nL.ii '1h! !.rtl llanm anti-aircrafi                                                      sui
                                                                              i r h o u tv h i c ha v i s ai s r q n o r r h eG e r I n d b
                                                           l Irn i i t a t n rw
f r , \ r d . n r . I r r h r h ee s s e n r i a l l e tot e
                                                                                    .::,rtjrsti cdi                  F i n i r l l \ . e n a i r . l r . , , . . '- i . l r . l : r t - . , r . i i \ 1 1 i ) l ll l
$e lorD ard paidn) t1DDa!,afteratDrtright,g;ver)r tra. A Dordot hoyil?rr, lhe oihir ' 151mr$         !Dr,, botbrrilh theirlinbers blt jrc\or!
advicefor {ould-betravellers:youshouldstartthisprocess      at leastt\ro tractorunits.
monthsbeforeyouintendto goasihe v,/heels      grindexceeding   slowl       TheNaryandtheAirforcearecompantivelymodestlyrepresented.
   lmmigration andCustoms     are'steadily' efficientandnowhere     near Singleguntunetswithweapons      of variouscalibres,in battleshipgrey,
asintinidadngasI'd beenl€dto believe notanAK47in sight.As my havebeendismounted                 and placedon concretesupports,as havea
Russianis weat I wasluckyto havefriend5meetne at the airpon- selection             of torpedotubesandminelatinchen.the majoritemin this
avoidthetaxi-hustlers.                                                   section isariverparol boat.Vessels  suchasthisw€reusedontheivers
   At the time of fiiting I wouldsuggest   that the visirorrakeseither of RussiaandCentralEuropeto covercrossings        andbreakup enemy
U.S.dollarsor Germanmarks(newnolet andonlychanges                  them advances-   Thispanicularvessel hasa tanklurrel atbowandstem,and
offrcially.There\ a vastanayof exchanges     andbanks$,hicharefin€, anarmour-plated        d€ckandwheelhouse.    Thelatterisloppedbyanother
but avoidth€   "mafiosi"   on the streelsand   in  the  ban. Travellers  tunet  mounting  lwin heavy machine    guns.Seemingly   this craft vas
cheques.   AMEX and vlSA cdnaho be changed             in an IncreasingusedduringthebattleforBerlin.
numberof placesbut it takestime- Major oedit cardsare alwal's Aircraft              sho\rnincludetheMiG-17.21and23.Thefinishiseitherall
well-received,ho$,ever   smallthe transaction.                           over'silver'or camouflagewith blueundersides.
   Travelingaroundis best,andmostinterestinglydoneby Metro,                There   are tbreehelicopters includingan Mi-244 in Afghanlvar
whichis assplendidasthe guidebook say-Thebuses,trolleysand coloursandanMi/4Acarryingalelectionof ATG weapons.
tramslookirterestingbutgethot,crowdedanduncomJortable;           they're Nearby,but lackingits trucks,h an armouredlocomotiv€andih
alsomoreexpensile     asrbedn!els perl.isrogi\enochange.                 tender.{Thetrucksareelsewhere    for renovation).Thelocowasbuilt itr
                                                                         1896andservedduringbothth€CivilWaratrdtheG.P.W.whenit toot
                                                                         part in the actionduringtbe summerof 1943.The 6nishis Russiatr
                           THEMUSE{IM                                    Khakiwithblackwheels.
 Armed with a nap and my letter of introducrionI arived at the             Finally,thereis avariet of fu[y'trackedpontoonvehicl€s,wheeled
 Museumwhichis locat€don the SovietArmy Streel,by the Soviet A?Csandabridgetayingtank.
 ArmedForcestheatre,oppositethestatueof Suvoro,.                           S€veralpiec€sof contemporary     self-propelledartill€ryandmissile
   Th€buildingis easilydistinguishable  ftomits neighbours,   whichare launchenwereparkedouhide,but inspectionandphotography              were
 similarmonolithicpiecesol Sovietarchitecture,    by theT34l85andthe
 152mm    howiEbrparkedD€artheentranc€.
   The exhibitiotrhals andthe grounda.reopenfrom Wednedayto
Sunday    10.00-17.00, butthelibraryisonlyopenonWednesdays.         The                               INSIDE
pric€of adrnission  is roughly12.00atrdphotography      is permified,by It is insidethatthemaintrealuresli€. Theorigi$ of theMus€unare
prior arangenent,both insideandout. Takefood asthereis noDe
                                                                         tracedbackto a displayof WhiteArmy trophiesplacedin RedSquare
ayailableat theMuseumor vithin comlortable      walkinedistance.         in 1919.Followingvariousmovesit wasfinaly loeted fu its presetrt
    I begatrout.ide
                  asthewealher.duringJuly    andAuBuit.ishumidwilh hone in 1965,{,henit re-opened         to coincid€with th€20thanniversary
a lot of lhunderstorms.  (Takeanumbrclla.)
                                                                         of theG.P.W.At thetimethe25exhibitionhallsconcemed         themselves
                                                                         mainlywilh the achievements   of theSovietArned Forcessince1939,
                                                                         with particularemphasisbeinggiven to the achiev€mes of rhe
                           TI{E GROIIMS                                  individuals€nic€madwoman,     politicianorworker.
 ln aroughlychronological   arcis afabulousmllectionof RedArmyand Sinc€the adventof geater freedom,post-1985,                therehasbeena
 Sovietequipm€nt.Thereis an exampleof almosteveryRussiaD            rank gndual expansionto encompa$a broaderhistoricalperspective
                                                                                                                                             43
embracing   thelmp€riallorc€sfromth€timeof PetertheGreatin the capturea Germanariillery positionduring the sumner of 1914.
earlyy€arsof the 18thC€nturyup to andincludingthe Civil war of Wrangelu/entonto geaterfarie astbelastseriouslead€rof theWhite
 1918'21.Matryof th€ €xhibitsdatiDgfrom before1921haveb€en forc€sin SoulhemRussia,supewising                             lhe evacuatioD  fromth€Crimea
retum€dto Rursiafiom theRodina{Moth€rland)Museumwhichwas inl92l.
established  in Ne\rJersey,U.S.A., asa repositoryfor artefactstaken Itemsrelatingto regimental                 lif€ suchasinvitations,nenusanditems
ftom Russiaby anti-Sovietedgr€s. Museumstaff arc cunently of uniformcofflud€the!€displays.
workingup the 40,000itemsdonatedby Rodina,supplenentedby                       The Cr€at War Foper is showtrin hall three. Here the eyeis
piecesftom Russians      in olher partsof lhe world, to providea less innediatelycaughtby a vastmodelof th€farnous'Ilya Mouromeb'
id€ologically  biasedcollectioD.                                            bombersuspend€d       fton thec€iling- butmoreof thatlater.
   Theentrance   hallisdominated    byalarg€bustof knin withamosaic AnotherpaintingfromAmericah givenprominence.                            Thisfeatues
backdrop,   atfirst-floorlevel,showing   theadvanc€   of servicepe$onnel, the 10thCavalryDivisionin actionagaifft ihe Austro-Hungarians               at
workersandpeasants.       This heroicstyle,tlpical of Soviet-era    ofEcial the battleof Jaroslawice     in GaliciadurfugAugust1914.Thiswasthe
an, is atasteof thingsto come.                                              lastcavalryactioflin theNapoleonic         kne€-to'treelndition.
   Thefirsrhaflcoversthedevelopm€nt         of the Russian Navyion the         Onecabinetisdevotedto Cossacks           andtheirequipment   - acomplete
 181hC€nturyto thepresentday.Displaysitrcludeprtutsof thebanles $t of weapons,swod, carbineand a bambooIndian Army lance
againstthe Swedes      andTurksandmanycurawaymodelsof sailing Guppliedto the White Arny courtesyof the British),saddleryand
vessels.  Uniformsandweaponsfrom this time canalsobe seen,but oth€rhorsefumiture,a tunicaadbaggytrousenftom theDon,anda
prideof placemustgo to a beautiful1:96modelof the to.odino, a kaft^n(Chetuatska),                     bwkt aDdhuge,shaggyblackcanel hair cloak
battleshipftom the tum of the 19thCentury.It is frnishedin fte contrastwilh anelegantfull-dr€ssGuardCossack                          busby.
Imperialcoloursof th€dayrsalmonpbt hul andblacksuper-stflcture, Thereis alargedisplayof ImperialArmybuttoDs,                            pogort(shoulder
with scrubbedwoodendecksand bridg€. A selertionof naval boards),photographs                           andmedals.
helicopters  of amorerecenteracompletes        thissection,                    Trenchwarfareis exemplifiedby iwo Russiantrenchnortanr a
   Ilall twomDtinu€s    thenavallhemeinto theprel914 erawith many 45mmM.1915(fad€dto blackmetalwith a light greybomb)anda
itemsfrom the RodiDacolection.Due lo an ideologicalban, that sinilar,butuuder,58mmmortar(agatublack).Thelatterhastwosolid
carriedseriourcoffequenc€s      for bfring€menb,onanlthing(including eheelsandis mountedon what appearto be two baulksof 6" x 6"
cigarctt€pack€ts,   for example)thatcaniedtheTsarisldouble-headedtimber.Therang€of bothwasover500m€tres.
eagle,whichrcnainedin forceutrtilth€veryrecentpast,articl€sof tbis             Nearbyis an artillery of6cels uniformwith sr,nel (great-coaO,
period are rare in Ruslia itseli - heDc€the value of th€ Rodha /ardt?&a(cap)anda s€tof *€bbingincludingholster,mapcas.,sword
                                                                            andboots.Closeby is a selectionof hand-made               plastermodehof
  Pe6onalitemsincludea damaged            piec€of arinourplatefrom the      various  reginents'   paraderft/orika     painted in thecor€ct  colous.
crr.lis€rlrarevilci whichwas     present  at the battleof the Y€llowSea        Directly  opposite   is a cabinet    featuring  the Imperial fanily. This
duringthe RussGJapanese        War 190+05.Thishasbeentumedinto a drawsattentionto the s,orkth€ydid with the wound€d.TheTsarina
photo-ftame,                                                                andherfour daughters       work€dtu theirowDmilitaryhospital,albeitiD
  Two Dermants.     a 'his andhers'.whichwerehoistedto indicatethe          token  capacities,  fiequ€ntly  visitingcarefulychosensickandinjured.
preserce   onboardof eith€rth€Tsaror Tsarina,comprised        theRussian    Amongst    the anicle!   on show  area panof socks,a egedlyknittedby
'UnionJack'wilh a blackandyellowInperial eaglesuperimposed               at theTsarinaherself.
thecentrewith eithera whiteor lighl-bluedouble-pointed         tail for the    Thel(r'ry:i?/(a longknife)o"ned by the TsarevitchAlexisis shown
Tsaror Tsarinarespeclively.                                                 alongside  a replica  of theTsar'stunic.Severalpiecesof commemora'
  Nea.byis theblackand        gold tul-dressunifom of a captainof the       tive china are  displayed  withoneof theTsarinayliberty Print'capes.
Fint-ClasswithhisSt.Georg€\daggera*ardedfor braveryin 1916.                    The F€bruary(March)Revolutionfolows hard after this. The
  Shipstoo were giv€n the St. Georg€emblemfor outstanding displayfeaturesa hugepaintingshoivingtheTsaristtroopsleavingthe
performance.    The St. George\ Cross,in the appropriateclass,was ftont. Photographs               of K€renskyandothertuembenof theProvisioDal
                                                                            Govemm€nt      (March-November        1911arenorable.
issuedto officersandmenandthe flagwassimilarlydecorat€d.               The
             of
usualcross St.     Andrew    (pal€blue  otr a white fi€ld)was enbellished      The  soldier'spapo   ira(tur hao,   fromwhichtheInperial cockad€      has
with the badgeof St. Geo4e slayingthe dragonat its centre.To the beentom andreplaced                   by a stripof redcloth,leadsthevisitorinto the
bottomof theflagwasaddedastripof redcloththatincreased           ilssiz€by CivilWarperiod.
aboutone-fifth.                                                                HaUsfour andfive dealwith the Civil War, preseoiingitemsfrom
  Tlis is followedby a displayof sealsandcommissions        fron th€18th bothsidesof thisdreadfulepisodein Russianhistory.Anefaclsfrom
C€ntury,aCuirassier\h€lmet,breastandbackplatesc.1812,ava.riety the Rodinacolleclionhavebeensupplem€trted                           with unifornsaid the
of unilormplates,a Guardsnitre helmetandasel€ction          of svordsand    like from  private  colleclions to prcvid€    a R€d-White  balance.
pistols.My apologiesto the Napoleonicinterest,but this isnl my
periodandonelanc€rlookslike anyUblanto me!
  MovinSrapidlythroughtime contemponrysketches                of Generals THECIVILWARANDTI{EALLIEDINTERVENTION
DenikinandKormilov.leadeisof the WhiteArmiesof the Southof Herehthelegendarylacrrnk                              .Thissmallcarriagedrawnbyateamof
RussiaduringtheCivilWar,contnstwilh adisplayof badges,            insignias four hones (abreast)gavehighly-mobiletue suppon to the Red
anduniformsiom alnost€verymilitaryschool,mlege andacademy cavalry.Mountinga Maxin M.1910(completewith tc/o-whe€led
in pre-Revolutionary    Russia.Thebadges      wereworDon activeseNice caniag€)on lhe rcar passenger               seat,it wasa fornidabl€,if unstable,
byofficenof a[ ranksandwerehighlyprizedby theiros,nen.                      weapoo.Theappeafince         is blackfor bothvehicleandgutr.A rcd star
  Thestandard    fieldgutrof all Russian  forc€sduringtheGrcatWarand andudt markingdecorat€th€ backboard,otherwisetherc are no
CivilWar,the72.2nmM.1902,in Russian           Khali (whichhadfadedto a markings,thoughI wouldimaginesuitablerevolutionary                   sloganswere
dullmetallicblack)is thecentralfocusof thishall.                            applied.
  But agah it is a shipmodelthat stdls the show- the legendary Equaly interestingis a modelof a Red Army armouredtsain,
cruiser,Arold, whosegunssupponedth€ Red Guardsduringthe paintedmediumgreen,cotrsistingof a loc, and t€trderwith two
October-November       Revolutiorof 1917.The finishis battl€shipgrey flat-trucks,eachwith a pair of field guDsprotectedby sad-sacks.
withawhiteplimsolllineandredhull. Thed€cksandtheinteriorof the Anotherflaltruck, full of scrapironandsl€epe$,waspush€daheadto
ship'sboalsarescrubbed      wood.                                           detonaleanybooby-traps.       A horse-wagon,     piercedfor riflesandMGs,
  A painting,compl€tedin Americain 1969,depictsCaptainBaroD isdtectlv behiodthetender.
Wrangel(ashe wasthen)leadinga charg€by the Guardscavalryto                     Anotherpotentialwargamemodel,in thefonnof whatcrn onlybe
           The Tsar'scannon insidethe Kremlin.
                 76.2mm
                      M1m2Fieldcun.                                             Presidential
                                                                                         Guarduniform,1995.
              THUNDERBOLT MOUNTAIN MINIATURES
                                                              'lriloreDMlm"
                                                     fhe .le/initiw tnhwia Colbctiot depi.ntg....
                                       rhe iott Nobb chriti@ P.iEe: AtttuPen&agu-         ish k"E ofa[ Bitak
                                  Eit PrircipL ahpa.io8bf,e      K"ishe ofrlE Rd.d Tabb' ana fh.i a4is a"A .n.ht r
                                                       ME|nledn'e4bAvBoMEnl?FeaB
            3000 Arliu Kilg of6. BnroE           301? Sir I<.n Roy.l Sa6[.1           3034 FooIaa *ilb pol@. (4 v{iru).
            3001 GhtE      .acd.ldd.             3013 SnB.\iL.    SlEgc               3035 Ar.[6 d6d nil! Ldlbow (4 Enrt            .
                                                 30l9SnG&|hBdM.'B
            3003 Mdit6 t. S.t!@                                                       tu"otnq4ba.t@D,tu
                                                                                      otuddtod           wiq(@tqd')dot
            3004 MdnEd |[. B.!r-d
            3005 Tt EDFeLroiu                    3022 Sirlrirrre   of Ly*s.
            3006 Tn Gimrr, Tdlud & Tdld                                                Mdmf      crr#:    u(doddld       reortud4
              STARFORTMODELS
            Vi[ beat thefollowinCshowsitr 197
        Triples,Salure,FIASCOI, Claymor€,Derby,
                  FIASCOlI andRemn-
                                                                                     RAPIDFIRE!
                  For anyfrEtherdetails                                                                                      MPORNE 'IES
                   Phoneollt27 n4                                                                                              HntrlWby
                                                                                                                             Golhftmtud&
betweetr1918-19t22  British, French,Americanaod Japan€s€     forces                                                           ftoh.rdil.|!h
*€re all pres€ntiD differentarea!anddifreriogstrengths.Matorial
support,largelyfrom Britishstocksh Greeceandthe Middl€Eas1,
suchastanks,airc.aft,artillery,smallalns .nd unifornshadall foutrd
                                                                                                                           nnsrgmtnon
thei way(paidfor with Tsaristgold,soanex-Whitecuard sourceitr                                                                hyCollntuntud
the U.K. tels m€) to Denikin and Wrangelin rhe Caucasus        and
SoulhemRu$ia,andYudenitchid lltvia.                                                                                         O[tl!Apr['9:t
   Thisaidis exenplifiedby an l8pdr. field gun,a lruds LMG anda
l,€e-Etrfieldrif,e.                                                                                                         SEOTD$P?tflHI
   Uniforns, mainlyfton privaiecollections,showatr ofdcerof the                                                            lnr(ncAxtsAl|ot{s
lvlarkovskyRogiment(WhiteAmy), a sailorof a RedNav0lhfatrtry                                                                   lbr
unit, ad a Whit€Army TerekCossack.      An aulhenticAustin-Putilov
amouredcarundergoing     repailsis thehighlightof thisha[.
                                                                                                                           mEEAiEn tioftt
  ThepropagadapaintingsfeaturingWhiteforces(lookingsuitably                                                                   btEd|Idllnfi
malevolent)oft€n emumberedwith loot and hostag$, or b€ing
slaught€redbyDoble(sic)sailo6,soldi€rs,peasants    andworkersofthe
RedArmy,arequit€spledid andsuitablyitrspiationall                             RapidFireru|es.......,.,.,..........
                                                                                                             f9.95+ 90pp&p
                                                                              RapidFiresupplement   ..........f8.95+ 90pp&p
                            p2ar94r
            TIIEIMFI-WARYEARS,                                                 flNATAGEM,18LOVERsTATIE,IITWANK OTTS.
                                                                                                                   GA'HZ
HaI sk wascloledforrcde.orEtion
                              andhallsseveD
                                          andeidl ll€redevot€d                    !l!lE!!448!A: Et{QUlRlEs
                                                                                                       ro Tl{EEtmcRoUP,
lo ttredevelopmeofrheSovierArm€dForces  andde 6at d|IE.sof lbe                  2615FORESTGLEII
                                                                                           TRAILR|VERWOOD'
                                                                                                        IL 5I 5.U.S.A.
CivilWartorheersloflak€ Baikat.
   AlthoughtheCivil WarofEcialyendedin 1922,s?orddic               fightitrgstil rcgimenls      arcoverhead.
wetrton h the Far Eastemareasuntil fte early193G.Thes€locilised PhotognplNre.ord much of the Caucasian                                              aclionsslDwinglhe
afhin arekno\rncolectivelyasthe 'Basmachi             Uprisitrgs' andinvohed momtainous              na$r€of theterrain!o gmd effe.l.A smalKatyusha                    unit,
disffe.tedtrib€smen     who,in manycar€s,hadfoughtagainst           Tsaristand wirhoutits translon, designed                  for u!€ in suchar€asis panicrady
Whiteauthorityandsawthe Civil War simplyasa continuation                 of the nrerEsnng.
struggle  agai$tRuasian     domination.    Varioustrophiesandphotogapl$ MuchsDace                       is devotedto the navaloDemtions            bothon latrdandsea
recordth€seevenb.It $,asduringthisperiodthatMotrgolia            carneintothe durhgthi fghtingin theGinea. As in i&5,{-55,                        sailoFillhtrtryw€rean
Sovietsphere    of hfluence.                                                      €ssential  panof drclandforces.Itemsof uniform,c,aFwiththeirdbbons,
   'Ihe
        borderandrdilwaydisageemetrts        thatl€dto theSino-Soviet   conflict andweaponry          aremuchin evidence.
of 1929provile an interestinganay of photograpl$showingregdar Alboughthefightingb Karcliaistouched                                         on,nomentionismadeofthe
Clifts€ tooF andthenfonifications.                                                Arcric convo)6;althoughdtereis r€ference€lsewhere                           to €quipment
   Japarcs€'Soviet    disputes  overManchuriapmvideamthersouceof supplied                    byBritainandlheU.S.A.throughkatrad \4adivostok.
displayin the form of Japanes€         fla8satrdweapo$tat€n duringthe                A notableexhibitis a GAZ lorry us€dto ferrysuppli€sinto and
canpaign   whichendedwiththeSovietvicloryatthebatd€if Khalkin-Gol. pedonnel(nilitaryandcivilian)out of - kningrad dudngthevinter of
   'I}Ie
        riseoffas.isnin the193&gawtheSoviets          aoexcueto intewene      itr 194142alongthe"tifeline" madthatclossed                     ttrefrozenvatersof bke
                                                                                             'Ille                                         gr€yandhasa 12.7fin.a'/A
dte SpannhCivil War, 193639,and lhe vork of Russian                    pilots  is Idoga.             r€hicleis finished     in batdeship
higblight€d   withadisplay  of modelfighte$suchastheMiG atrdtheYak. maclinegun                     tipod nountedonitscalgoarpa.
   'Ite
         FiDnish-Russian   War of 193C40is featuredoDlyinsofaras it                  Conditiomduringdle 9m day siegewere dirc for muchof the
iiflu€Dced   th€riseof theSMGastheprincipal        weapon   of theinfantry.       population.      Rationcardsanddomestic           art€facts  showhowmuchsufiering
   Politicaly,theSovietArnedForc€s         wereclos€ly  tiedto theCommunist
Partyandthe Purges       of 193638arecarefttlydescribed,        wift weighting Theieisaninter€stiqselextion                   ofrifles,SMGS,     LMGSandas€tof My
givento thedamag€      don€by Slalinto th€niddleandtopechelons           of the armourjuxtapoG€d              with a selection    of steelshieldsdesigned         to protect
militarycomnatrd     struclure  ontheeveof theS€{ond      world war.              riflem€n,snip€rs        andmachine-gunnen.
   'Ite                                                                                                                                              (nowVolgogndatrd
         expansiotr   of Germanyis neadyslmboliz€dwith a rack of                     Hal twelveisdedicated           to theBattleof Slalingrad
smal-almr,otrefromeachof the nationsovenur Therearca]soitems pre-Revolution                              Tsaritsyn)   whichla5tedfiom July1942until theGernan
rakenfromHider'sotrce,hdudinga faxcntgbbefeaturingor y ltaly, sunetrder                        in February       1943.
Spain,GemanyandJapatr          andaveryfineamb€rorjademapof theGreat A life-si"r€d                    panorana      dra$syouratlentionin thisdjrnly-lithallandputs
German    Reichincluding   Au5tia,partsof Polard,€tc.Apparedlylhereis youin thefront'line.Recendy                          compleled     by a goup of Modcow        anistsit
mor€of thesameasyetundisplayedl                                                   captures   in vividstyledlepoximityofGermanandRussrsn                       troopA atrdtlle
                                                                                  realitvof dlerubble'stsewn          bat efield.
                                                                                     It hasnosound-track           or special  effea1s- theyareunnecessary,        it speak
                                                                                               'Ihe
              rHEGREAT          PAr"rOllCWAR,r9414s                               for itsef.           Germans      reached   to vithin a kilomeseof theVolgaand
HallteniswherelheMuieunreallygetsintois sside.It needs              lo b€bome vicloryb€foreb€ingthrownback.
in nind ftat for theRussians     WorldWarTwodidnotbeginuntil22June CabiDets                        arcud th€sides       containweapons,      bolhRuslianandGerman,
1941ad the Germanledinvasionof Russiacode-naned                     "Opemtion     penonal      papers     ad    a  pan  of  clumsylooking      Geflnansnowoverbaotr
Babarosa".This,for theRussiais,          isTheGreatPatsiotic    War.A copyof      made    of straw.     A  photcrecord     of events  ke€p6   tlle narrative   0owing.
                                                                                                         prediliclion                 isslinmedupin theftontpageof
tlle plansfor "OperationBa6arossa"         is prominendy   displayed  neKto a        TheGerman                        for efficiency
M.1935,   37mmanti-tanlgun.                                                       aBelgian     ne$spaper,       Ir lzgi? (published     in Liegeon16S€pt€mber         1942).
   'Ite                                                                           This   copy   was     to announce     the  fal  of Slalingrad   - prematurely     - it s,as
        initialstages oftheAxisadvance      ar€glossed over:it wasaperiodof
chaosandmass-surrender         for the SovietArmy. However,two displa),s 'fte
standout. The 6rstdisplayhonoursthe defendenof Bre.t Fortressin                            tual €abinelslnwsFeld-Marschal              vonParussigning         theswender
Belorussia.   Theganison,of some7,m menof all ams, heldoutfor 29                  docume         in  FebrMry       1943  and  a  book   of suppon     from    the womenof
da]6against   muchsuperior    forces. A pieceofthefort'swaIinsdibedwith        a  Cov€ntry.
Russian   soldieislastwordsispositioned      belowasplendid     painting- norc       lte memorial         tothep€opleof Stalingndgraces           thecentreofthehall.
                                                                                     Thechange         in unilonnof theR€dArmyissho*nh Ha[ thin€en.Ne\r,
   'n'e
         s€cond  displayis a modelof the famous"Katyusha"           lorry-bome dress     regulations      re-introduced    someuaditional      as?eats  of Russian   miliary
surfar€-to'surfae   rocketlauncher.    Thestorygo€sftat dl€originalunitof         dess,   notably      the  pogoni.   A   complete   s€t  ofpo8ont    with   badges  of ran}
s€vensuchKaFshashadb€enin aclionconthualyfiom July1941and                         and   branch     of srNice    colou$   isshovn,    as ar€ it€ms  of  dress.
$,erEfimly comer€dat Smoleffkin November.fte vehiclerv/€reaI                          FollovingtheIossoi theGermanSixthAJmyat Strlingrad,fte Axis
destroyed   bytheircr€ri,s andonlyoft manlir€dto tellthetale.                     forc€s  re€sliablished       thefronl-lineandby theearlysumnerof 1943wer€
    "Encouraging'   poste$andRussian       u/eapons conpletethisexhibition.       re3dy   to  take    the  ofiensrve   andnipofr theKu$k sali€nt(or 'fuch' asthe
   The Gefinana&ace on, and tll€ Russians              su@essful   defenceof, Russians
                                                                                     'nle
                                                                                               describe    it).
Moscow    areporgay€d    in fte ten$ hall.                                                 RedAImyhads€enthemcomingandprepared                           it depth.Theepic
   Centmlyplacedis a displayof captuedGermanviclorymedalsand                      lanl   batdes     are  car€fuUy    napped,    and  beautiful   scale  nodels   oppos€   the
iNitationsto the viclory paradein Ren Squar€.Tlles€some$,hat                       main  weapons        of each   side: in particular  the  Panth€r,    the  Ferdinad    and
prEmature   itemsaresho\rnalong$,ithGennanrifles,LMGSandunifoms. theT.3,V85.                       Thislatter$,asnicknaned          byitscr€vs'thedevilb€lyiancei.
   A ompletes€tofsovietwintercamouflage           ht, including  show{ho€s,   js Delil becau!€of ils gun(85run),andbely{anc€rb€{aus€                             of ils light
of majorinter€st.Alongwith the rErnaiffof a GermaflDo.17bomber                     weight   (33  tons)    which   gave il a tendency   to bouce     vigorouslyl
rd.mned   b) aSovielpilolduringthebombing         oI lhecit).                         TheRedAir Forceishonouedtoo,ad thestoryistoldofapilot,V;taly
                                                                                   Popov.who,havingshotdo\rn42eremyplanes,                        washimsefshotdom.
    Thercis ahugephotograph       of fte morale-boo6ting   parade throughR€d Hebailedout,buthispanchutefailedandh€f€[ s€veral                               thousand  fert to
 Square,  in Nov€mber     1941,to celetratetheNovember         R€volutionr   the landin a lake.Happilyhesunivedthefall and30op.rationsandlivesin
 valianteffortsof the ordinaryMus.ovitein preparingtrench€sad retirement                          in Moscow      tothisday!
 tank-trap6  ar€alsodulyrecorded.                                                     HaI s€vente€n        cov€rslhelib€r"tionof th€Ukaineandthecrosingof
    Theailing ishutrgwithfte fagsof Sovietregiments         whichtookpanin 6e Dnieprtuverdudngtie autumnard wint€rof 1943-44-
 ms camPa8n,                                                                          The Red fumy wasshortof boatsandasfte Dni€pris up to two
    HaI eleveD   trac€sthecanpaigNin theGucasusa[d K rlia andthe hlometreswidein place.ferry prioritywasgivento gunsandodrcr
 sieges of lrningradandSebastopol.        Onceagaintheflagsof panicipating equipnent.Consequently                     the'poorbloodyinfanty' hadofrenasnot to
 swin.In recognition     oltheirb.av€rysome2,5m'HerooftheSovietUnion' beenrev€aled                     thattwomissiles   $€refircd,onedestrold Powen'Russim
 avards$,eremade.(Duing theBatdeof Mos.ovtherewereody l00l)                            'shadodplane,dl€s€{ondhisU.2l
                                                                                          'fte
    An enemporized      ferrymadeiom metalshe€ts          isdisplayed  witha57fin               co.kpitof a MiG 21i! on slrcwandmyreactionwas'Thisloots
 A.T. gllnascargo;botharepaintedRussian             khaki.                             uncomfortable!'   and'Crik€y!   rhelr€ lettingne lookinside!'
    AgaintheRedAir Forcefeatures,         butthistimeit isfte aviatdx.Wom€n Bythe195fttheSovietArmedForces                          hadb€€ndividedintofve major
 formedthrersquadrons,        bombenandfi8hte$.WithotEolete             aircmfttley brarch€s:      Thefumy, lheAiforce, theNavy,theAnti-aircraltdefences
 opentedoolyat night,€amhgfton the Germans                    rhenicknade'Night and the 'Rock€tForcesof SFat€gicMission'u/hichwas basicaly
 Witches'.  Theiraverage     agewas21.                                                responsible    for lhe ICBM utrits. nere are severaifine modelsand
    Theworkof lhePanisal)s,        theproletariat    andthem€dicalservi€es       are photognpl$of ICBMunitsin silo6andonthemove.
 honoured   in Hal fifteen.                                                               A ratherwell-made     mod€lof rheflst Sovi€tNuclearSubriarine         dos€s
    A larg€{calemapillustrat€s       thepositioisad op€rating          areasof the thisp€riod.
 hugepanisan     forc€sfightingin Axis-occrpi€d       Russia.   Ilany of thegrouF         'Itre
                                                                                                l97G and 8(b are co ainedin Halls 2l and22: the War in
 numb€red    several  thousand   andcoftoled larSeareis,          panicularly in the Alghadsran      features  herc.
 {oresrs ad maBhlands       of Byelorussia andtheUknine.                                  Ther€aref€wexhibils     ofnoteandstress    isplacd onthec/ithdra*"tand
    Of najor iDt€r€st     is a reconstruction    ba!€don a recendydircovercd fte actsof individuals.             However,   therearesom€iderestitrg       photographs
 partisan'home'. Thesewere g€nerallycircr ar h shapeand built andafft modelof theaircraftcarrierNovrraisirk.
 underground    tom timberandtud.Weapons            hanging    onthe$aI includea
 PPShSMGandMo6inM.1891              rifle.Thereis alxoa pr€ssusedto r€-shape
 GermanSAA to Russiancalibrc.A nunb€rof home-nade                          weapons                                     FOST-1985
 cannibalis€d  fromAxisandRussian        equipnentarealsoshovm.                       Otr7l,t y (Russian     V.E.Day)th€ArmedForces        oflheSovietUrioDw€re
    Prediclably,   theh€roicefrortsof the industrialworke$areshovnby reiamedtheArmed
                                                                                                                Forces of theRussian   Federation.    Hais 23and24
 statisticsandphotographs      of weapoDs  in Foduction.                              coverttr€se   forcesandfteir we3Dons.
    Thenedicalbrancbshov,s        artificiallimts,surgical     toolsandthecheery I partifllarlylikedthe
 facesof recov€dng     men.                                                                                        Frade drersof tbe Presidential        Guardwhiclr
                                                                                      harlsbackin mlour,sty|eanddetailto lhe dressof 1910coinpletepith
    A moremovings€tof scat'stics,         display€d    on a nap of Europ€a            kve. {shako)    andpogodthar$e Preobnj€Dski         vr'ould  recogris€.
 EuropeanRussia,showsfte Nmb€r of d€ad and the locationof
                                                                                          Amonglhemodemhardir'"reisakatyusha            descendant    withfortytub€s,
concensation     anddealhcatrlptr   €sr.ablished   bytheNazis.                        updatedKalashnikovs        and sa€ral  hand,held  milsile launclE   s.
    Someghasdy      instniments  oftorturcands€veral       hideous  photograpbs   of      Surprisingly therearealsoitensfiom thecur€Dta€lionin Chelh€niya
atrocitiesare    juxtapos€d    with a sampleof humanskinanda rcvolting includiq antique
            postcard                                                                                         fir$lms and banne$.This was unexpected               and
illustmted             nadeftomthesamematerial.                                       slrptomaticol thegowingpoliticalhoftstyin Russia            today.
    Themostrecentof6cialfigulesgiveth€totalloa!of Ru$ianpopulation 'fte final
                                                                                                     display,asHa[ 25is a*"idnganexhibition,depiclsth€rol€
dfing dteG.P.W.as25,m,m.                                                              playedh theformerYugo6lavia,        undertheauspices    ofthetlN, byRussiatr
    HaI sixteentakesthe visitoracross         the Russian    frontierandinto lhe
landslibemtedbyrheR€dAmy during194445.                    By theSummer      of 1944
tltewholeofRussia      hadb€enfteedardaGeinanbordermarkerliesonih
sideto showthis.Buigaria,Poland,Czelhoslovakia,                 Romania,   Hungary
andYugoslavia      a[ havetheirplacewithphotore.ordsad acampaign
                                                                                                                  AFTERHOUGTITS
                                                                               nap
                                                                                      Of al theexhibits    in thisv t cole.lionmypaniclarfavourir€s         haveto be
    Onecabiretsho\i,s     theW€stem     Alies andlheD-Daylandhgsin June asfo ows:
1      lrift sevemlpiecesof Alied, mainlyAnerican,uniformand                              On an emotionallevelfte shnpnel€ncosted            eanhdonatedby the
equipment.    Inde€d,moreemphasis        seems    io begivento th€R€dArinls citizens            of Stalingrad,  simplycas€ditr glrsswith t"o silftro6espla.edoD
liaisonteamin theWestthanto thefighting.                                              top.Sucbado\m-beat        yetsupremely   evocati€rnemorial     tothesacrificeof
   Therearealsointer€stirg       photogaphs     of thelers,than-ldurnphal    march thatconmuniryandis delendeB             wouldb€hardlo irnaghe.
of Geman PoWstbroughMos.owduringJuly 19,14-                         Most of tlrcs€ Surrounding          lhe caseis a plah o)ocreteftane supporting         a damaged
prisonel!*€rc takenasaresultof'OpentiotrBagration',                s,hich€fleclively tunetftoma TJ4'?6tan}. Ihe design          is suchtlBt theturrctandit! plinth
destroyed   lheGernanArmyGroupC€ntredurhg$e Sunmerof 1944. fom a
   The'VicloryRoom',asllall eighteen                                                           Fote€tiveembrace    aroundth€soil.
                                               isknolrll,isjustthat,it ir alxothe        Technicaly   atrda€stheticaly  the1:10scalemod€lof rhelya Mollrone$
largest.lt is impocsible    to ignorethecengalfeaturev,/hich         is a displayof bomberis sluming.Some72of thes€leviatharsof the ai (forgil€the
capturedNaziflagslaiddownastheywereduringthe \4c1oryparade W€IsiatrlaF€)wereproduced                                    in theyeirs191417.     It caniedup1osevetr
tmugh Mosdcow         in 19145. Oneof theeagles,      talonsclutching   a swastika, nachine-guns,      including  onein acageh theb€ly andonein thetail,anda
s,hichwasremoved       ftomBerlin.Iiesbrokenonth€floor.                              bombloadof up to 5m kibs.Thepilothadth€luxuryof a fuly-enclos€d
   Awards,bothRussian         andforeign,prelertedro MaBhals           Zhukovand cockpircabin         andit carrieia crewof seven.Finish€d       in bufr,it shoqrsthe
Roko6sovti     aloDgwith theirparadediessandotherr€galiaarenohble usualInperialroundels                          andtdangles   onvingsandfus€lage       repectively.
itens,veryr€miniscent       of th€irTsaristprede.erso6.                                  R€duc€d    asit is to 1.8min lengthand3.2mwingspan          it dominates the
   'ne
        fnal carDpaigD     agairstJapanin thesunner of 1945r€mhdsthe thndhal wonderlulys,e[.
visitorof thepartplayedby the RedNary dudngthe laslstages                    of the      I$dy I an a suckerfor paintings      in theheroicmam€randwithsucha
G.P.W.                                                                               wealtl to chooce     fromI washardF€ss€d.Theno6t attractive             hasto be
                                                                                     "Thedefendenof BreslFoftess'astheysally
                                                                                                                                          out fton thei shattered
                       THECOLDWAR,1945-1985                                          defeoces    intheirtattered  unifornstodobattlewiththeenemy.         l3dy Butler
                                                                                     andotherViclorianmilitaryartistswouldsuelyhav€approv€d,                butnotfor
HaI nineteen      dealsuriththe de-mobilisation       of the RedAmed Forces thesittingrcomof anEtrglish                semi!
(tley reverted    to b€ingdl€SovietfurnedForces          in 1946)ald thewarsin           It o0lyremaiNfor meto thankmo61          h€artilyall thestaffu/howereso
Kor€aandVi€tllan.Littlepropaganda             is madeof eitlFr of th€v,/ars     and helpfulandmademe verywelcome.My panio ar thad6 go to th€
moresfacelsglvenovettotheworkofweapons                 designen    Semercv  and,oI Mus€um's        dir€.lorColonel  A. NikomvandhisdeputyColonelhkin, but
cours€,  Kalashnikov,    lhereh€ingseveral      exarnples  of theirworkincluditrg my specialtlEnls go to AnnaatrdHel€nwho guidedrnd hteryret€d
anoriginalAK47.                                                                      thmryhoutmystay Spasibol
   Theremains      of CaryPor{elsU.2spyplaneplalaa grealpar ir HaJJ Althoughnotatnember                             oI staf buta fellowenthusiast    - MbhaBlinov,
wenty.Po$ea\rasshotdo$norer Rursrion I i"lay tctt0.tr irasreenrJy rhygratilude                       to youagain.
Above: EngtishCivil War atui ery on the narch, a old Hinch.ltffepieces
                                                                     pahted 4 Phit Robinsonof Hult. (Thesewon severatpainting
campetitnnsilentyyaago.)MarkAllemaaethestun rhebeautilutkhces           wetedoE h) alanMt scifi modeL ^'ru *no on ",ni""a ri
aI MidlandM itaip. oad who,enlnc c\.opp\ne Ba(LdrcpbJ Alanpery.
Below:ECWstti eryin situ.Puttinglow aflilleryon a.hitlg esthebauerycomnan!|etBoadvisionandmightincteaerange,butof cource     pt
doseta lesselfeclive.ptunsing
                          lbe, withthercundshot diggin|ino theealthinskadofpt;yins duck:anddt;kes'thrcushfi; etany iines.(ttiha
neo6.themenb'hohue todrcgke powdetandshotuprhe.h ||i benunenneutsesbu;$ it anot'fcetsjob tobepoputat,s;mewatsane:
Foundryfoot ofli.eB and an EsserMiniatwesmountedot'fcet hav joned theHinattffes. B;&drcp ty z,i"o emiron.
                                                                                                                                                          49
      ENGTISHCIVIT                                                       FrsTrcuFf's 97
      WARI'PDATE                                                          ( 1lth I.|')
                                                                              0llb.thdlt
                                                                                         - Preser&d 6y ihe Levell€F crEtgaoes Cftrb"
(Rnlesfor theadnaaced sseof Sim o!.!r lou tolf, &ya.nii|rc eZfo! I'lo d.t!, rl.5o 6t r &y
sqraf,atetroopJcompanlesfor                                          &h.{drh6d.Fadol!r!d4r(dr&-l6de.d
                                                                     lrt .l&tr,ir.Frq.ift'o        a|E (l6t&@ |r.e,.r|6.@E
                                                                                                                          i.|a,,r!it{i.tir,
                                                                                                                                            r.r[.d(C6!c
             PART1
                                                                  SFcir! Butesfor Ricoch€litrg  or "EounciDglRoud Shot:
                  by ThomosE. Sheperd                             Themostdangerous    us€of artillerywasto aimshortof thelarg€tandlet
                                                                  the shotricochetor "bounce"alongthe gound wiih obviousleihal
I{avingbeeDa*€rgamerfor someyearsnow,I've hadth€d€sieto us€ r€sultsto anytbingin ils path.Theheavierth€gun,thefanhertheshot
someoflhe foinationsandtactics,suchasanillerycoutrter'batt€ryfire wouldcontinueto go, eveDafter strikinga target!Only shotftom
or command€d   musketeers,thatmyresearch  of theEnglishCivil War MediunandHea\yCunsisgiv€nthecapabilityto bounce.RoundShot
hasdiscovered.  My desh€to play thesesituationsis basedon my froma MediumGunmayonly bounceonce;shotfton a H€alTGun
r€s€archof someof th€battlesaDdthefactthatmanyof theleadersof
bothsideshadexp€rienc€ in aheThirtyYearsWaror otherconiictson       If the r€sultfromrhedamagetableindicatesa "bou{ce"result,ioll
the contfuentin the yean prior to the !rar. Also, both sideshired 1D10.Theresultis th€numberof additionalinchesth€$tot continues
mercemri€s,€speciallyartilleristsand engineen,to help leadtheir alongits originallineof fire. A "0" indicates   lhe shotburiedits€lfand
forces.So,rhesetacticswouldhavebeenwellkno$nto bothsides.         didnotbounce.Any additionalunitswithinlhisdistanc!ar€slruckand
  Unfonunately,my favourite set of rules, 1644by Wrl€imes must ioll on the artillery danagetable for carualties.Ignore all
Fouodry,thoughan €xceletrtsetof rules,doesn'tprovidefor these additional"bounc€"resultsunlessshot was ftom a HeavyGun.
events.However,1644is a very flexibl€setof rules,andeith a little Enfiladefire will nor be awardedfor "bounc€"."Bounce"cannotbe
thooghtyoucandevelopappropriaterulesto covera widevarietyof usedfor counter-batt€ry          fire, nor do€sit haveany effect against
situations.Thistwo-pananiclecoversmyown"HouseRules"whichI artillerycre*s. Theyknowwhata "bouncing"roundshotcando and
hope\vill hetpmakeyourownECWgames       morelacticalycha €ngfug aresmanenoughto ducklCoverslopsall bounces;howev€r,a unit
andnore eniovable.                                                usingthatcoverv,/illstill haveto roll for damage with a - 1modifierto
                                                                  thedicercll resultIrom  the protection  offercdby thecover.
             ADVANCED
                    ARTILLERYRULES                                  CouDterhtteryFire
Thesegiveadditionalclassifications
                                for anil€ry, theAnillery Firelock   This is the practiceof using your own artillery to destroyyow
Guard,andenfiladefire to the game.They alsoaddthe optionto          opponent\adllery. It waswidelypracticedin lhe Thirty YearsWar;
executecounter-batteryfire againstyouropponenfsanillery.It also     €speciallyby lheSwedes. Sincebothsideshircdprofessioml  anillerists
               thegeaternumberof artillerypiecesavarlable
tak€sintoaccount                                           to the   fron thecontinentandhadseveralofficerswith €xp€rienc€   fromthat
Parliamentarians
               andtheimprovemenls    in Royalistanillerytacticsby   war I feel lhat the practic€wasmorewidespread    thatris currently
PrinceRuperl.                                                       lhought.Theserulesintroducecount€Fbattery  6re to 1644.
                                                     An €ryGunCl$sificalionsl
                                                                                                                  MoveorFire
TrpdPlsCosl                      Weightof Shot     C.seshotRadg€RoundShotRrnge Cns Sizr                           R.taofFir€
Ga oper                  20pt,    7ato 1.5lbs            g           12'         2                                Special
UltraLight               l5prs    3/ato2.'lbs            {           18"         2                                MoveandFire
UghtGun                  2lpts    3lbsto 6lbs            8"                      2                                MoveandFte
MediumGun                30pts   9lbsro 16lbs           10'          26'         3                                MoveorFire
HearyGun                 40pts   24lbsornore            14'          48'         4                                FireeveryotherTum
                                                                                                                  MoveorFire
Allcrevsare"Train€d" 5pointsto do*ngradeto "Ras,"/+spoitrtstoupgrade
                                                                   to "Elite"
Sp€cial
      Rul€sfor Galop€rGutrs:                                               l) Cou0ler-balleryfire must b€ declaredin the Intentiotrs
Gallopergunsarecapableof beingmovedby ho6e, u imbered,and                     pha$.
fuedonthesametum.Youmayalsofire agallopergun;thenlimberup
                                                                           2) Ro to hit on theCounteFbatteryto Hit Chart.
andmove.If this is the case,it mustbe declaredduringthe orders
phas€.Tle gallop€rwill fire duringthe movementphas€.Galloper               3) If the result is a "Hit", roll a D8 and consult the
gunsnayody b€usedin supportofHorseunils.Reflecting thefactthat                 Counter-Battery DamageTable.Anlthing r€sultingin the
iheywer€introducedby Princ€Rup€rt,onlyEa y andLateRoyalist                     gun"dismounting"  rendercth€gunuselessfor therestof the
andrheNewModelarmi€smayfieldgalloperguns.                                      gane.Surviving cre* modelscln beusedto crewotherguff,
                                                                               A resultof "explosion"permanently
                                                                                                               destro],sthegunfor the
         restof the gameor campaign! NOTE: Duringa campaign,
         "dismount€d"gunscanbe recoveredandrepaired.Roll a                                  WARRIOR MINIATI,JRES
         D6. 14: TbeGunis useless. 5-6iThegunis repaired(it may                      14Tiveton Avenue,GlasgowG329NryScodard
         befi€ldedin thercxt batde).                                                         New Calilogue g1$ phs a sEnPed ad.tred envelop€.
                                                                                 Pl€e si.|e intmb lor suplc 24ho6 aswdphdc 0l{1-23 3,116.we adepr vs,
      4) "Bounce"basnoeffeclfor Count€r-batterypurposes.                                                Makdwgeerc Mait od( oily,
                                                                                              - ONLYB.95 ptls A.50por, Oe* too Fdch or Binh Napolmniq
                                                                               lsdd AEMTES
      5) Cas€shothasno effectin count€r-battery
                                             fu€. However,il                   Rotlrm [C]r Royalielor Pdlimmtdia4 ACW Nodh:nd Soutl! 13ln clnhrt, Colonjal
                                                                               zds andBdlisL Fdray cmd or Evil6d skeletos, MhjnG oI lm pi{6 in.tuh arny
         cankil theguncrew.Treatthemasaninfantrytargetwith a
         -1to hit modifier.
                                                                               Am NTIOETJONIC     ,{ltflts . oN[Y 47.95 pt6 A,N post, t00 pi$, BdB\ Fnndl
                                                                               PrNiaa Rsia4 Astdar Spdnh.
Sp€cirlRd.s for f,nfl.de trir€                                                 25n't AR tiES - ONLI f2495r1asB,s0rorr, r00pt6   cR\ R@ P€Bia nr&idt
Enfiladefire isthesituationwher€cannonor nuskebfue intotheflank                Ltleddia    Noma4 Sanrai Moryols,rtrkmrhb, Mdieyars,ACw Nonn aid Soulh
of a unit. The ov€rall€ffectis absolutelydeva$atingascannonshot                ?5,,n DSr rRltls - rioMd280, oE 40 rod@* 6m
s.ythesdownentireraoksormassed    musk€tryisconcentrated
                                                       onavery                 ?sffi FICUI'S - IRoM Ep, 15m EROMI0p, All made6on Iop quality aloy. Alo
                                                                               20Dh Spdnh Civil Wa \4d@ ind Nlodm UsA Ertsive lsm Colonial nd
smallponionof theenemylin€; th€rebycausing   anincr€asednumber
of hirs.Eniladefire alsotak€splacewhencannons frredo$nlhelength
of auoitin acolurDn or intoatighdymass€d         body(suchasthe
                                         defensiv€
ECWequivalentto th€ Square).Enfrladefire doublesthetrumberof
casualties causedby atryanilleryroundshotor musket/carbfue
                                                         fte in                                SPECIALRTJLES
                                                                                                           FORTHE
the shootingphase,lt alsocauses  anautomaticconmandtestfor the                               ARTILLERYFIRELOCKGUARI)
targ€tunit.EnfJadefire occurss,hen:
                                                                      Bothsidesformedspecial,unitscomposed      entirelyof firelocksto guard
      a) Thelineof tu€ iswithin45"of theflankof theunit.              theirartill€rytrains.Firelock vereusedbecause      theyweresafeto use
      b) A unitis alsoconsid€red   to b€undertheeffectol€trfiladefire aiound  open    barrelsof gunpowd€r.   Both    ParliameniatrdRoyalist
         if the lin€of fire oossesthroughanypan of the uDitthatis     forcesmay   have  anindependent   anilery Firclock  Guard if theirarmy
         mass€d   4 or morefiguresdeep.                               containsoneor moreMediumor Hearf Guns.The FirelockGuard
                                                                      mustbe deployedand remainwithin 12"of aDyMediumor Heavy
DehmiDirgEnfil.de                                                     Guns.FirelockGuardshavea tue factor of 4 due to the sr€ater
  r) fronlhen.Ik                                                      r€liabilityof theweaponconparedto thenathclock.
   Detefinin€the cetrrerline  of the targ€!unit by situplyextendhga
   linehomlhebackof thefrontrank,parall€lto thedirectiontheuDit Milert FirdockGuard
   isfacing.Drawa straightlinefron thecenterofthefting unitto the Gl (if.rmy cont insMediunor H€rvJGuns)
   targetunit usingthe locationof the backof the FroolRaDkof the                                                                      Pt5per
  targetastheaimpoitrt.If lheLineof fire iswithin22.5"of eitherside Foot No.inunit Welpon CF IF AImo||I Slatis Model
  of thec€nterlfue,   theunitis enfiladed.                            Musket 612           Firelock 3        4 None Trained 5
   b) If theLineof fir€ crosses   tbroughanypan of a unit tharis4 or + I pt permodelto upgrade     to Elitestatus.
   morefiguresdeep,lhatunitisconsidered     lo beenfrladed.If aunitis
   inlineofbatde,enfiladewillonlybeawardedtoani        ery.If aunitis
  in columtror h a defensive    body(egSquare)theneniladec/il be
   a*ardedfor bothanilleryandmusketrydu€to th€ tightlypacked                             NEWARTILLERYTA3LES
  naturcof lhetarg€t.                                                 MoveRites
                                                                      G||nType            MaDhendl€d Ho$e lheFn                OrDnwD
ErrnDl.s                                                              Galoper                   4'               t2'               NA
                                                                      UltraLight                4'               10'               NA
                                                                      LightGun                  {                 8'               NA
                     -.--                                             MediumGun                 3'                I'                 6'
                                                                      Heaif Gun                 2'                6'                {
                       -?                                                     HorseTean6add5 pointsto thecostof a Mediumor HeavyGun,*
                                                   1 LiEor6r.p(srhmushraaor
                                                    L boc&Edepilinndfilad.d
   u*otfft i! vihii {5'ofm. i!'loIln. uft; ui!i3                              An eryDrmrgeTable
   ..fl iddby dinaymudshdand hlsrnry.
                                                                              the/D6lo[                      |       2       3       4   5
                                                                              Galloper                       I       I        I       t  2 RC
                                                                              tltra Light                    1       1        1       t  2 RC
                                                                              Lightcun                       1       1        1      2   2 RC
                                                                              Mediumcun                      1       1        1      2 3 8 RCB
                                                                              HeavyGun                       I       2       2       3 4 8 RCB
                                                                              CASESHOT                      2C      2C       3C      3C 4C 5C
                                                                              \umber:ThequaDriryofcasualtiescaused
                                                                                                                 bythehit.
                                                                              R: Rerol. A !€condR resultcauses
                                                                                                             5 casualties
                                                                                                                        to thetarget.Ignore
              ffi                                                                 thesecondCodmandTestresult.
              ffi                                                             C: TargetmustTestlor Comnand.
                                                                              B: Shot"Bounces"
              ffi                                                                Damage   Modifiers:
                                                                                 -1 if artilleryclev
                                                                                 2x DamageResultif EnfiladeFire
                                                                                                                                                                      5l
         GAMES
GLADIAilOR                                                                                                     t xIw     * MDaTECS    / Z^POTECS
                                                                                                               rno.hd ha.oricrr€ndy ior ourAztesod
                                                                                                               Tldell6    ro do batle witL
                                                                                                               ,{226 Mii€.conmmd               ......................11).95
                                                                                                               ):227 ZAporecC.'mDd ............      .............
                                                                                                                                                                50 95
                                                                                                               lz2a    Min€crza9orc {djo6 si'll
                                                                                                                                                          ......51 70
                                                                                                                       ad ad,,.......................................
                                                                                                               AZ29 Mirr..rzrpoEc wro6 wirh
                                                                                                                                         . . ..........................
                                                                                                                       opp€r de ..........                      ,1.70
                                                                                                               rz10 P@. sling€B..............                   l,t 70
                                                                                                                                                   ...............
                                                                                                                           I POSTAI       RATFS {
                                                                                                               o. ov.l56 ord6 e alqys d&g€ d. *.t
                                                                                                               posi4 -d pacldg d Gi ov.rP4moc
                                                                                                               .€6nded rii! cEdit not6 .arht tuturc ordc6. To
                                                                                                               gv. .vd b.tct lzlu€ .b. pcr2$ Fctdras.
                                                          RESINSCENICS
                                                   URETHANE                                                    RESI oF worlD:.lr      1096 stac.      2r% (6h   5r)
              BZIF    l5mpdisdestion......... 16.95        COASTIINE PACK                                             cATAIoGtiE :ll or 4 rRcs
   ,4                 Tm piad of edthb.ol toPp.d           DBM,TDBRhlv€ gvd             plrf€6 the optio. of
                                                                                                                 **     vrs   MTSIIIRCII|D ACCTPID lit
                      by vdrden $k6.
   ..:i;      Bz2F    t 5nn polisade a4€@y... ,3.95
                      snrd. paliede s tr d Deul
                                                           Bdd€zmc c@stlin pa& $t[ hide dE ioin
                                                           bcMd    bluc md 9re6 clorlE wirb mnui-
   fii iii                                     ... 42.95
                                                           2@8d€nr     pics conEininS dif6,
                                                           dun6, beach6, n&sh6 dd 1 com€c.or
                                                                                                                      GLADIATORGAMES,
              BZIF    l'tln.omerwrioro.
              BZ.'F   15m.om€rb6riotu..........tt.95                                                                     11 DEiISENT AVENUE,
                      Squrc cm.r b6tioB .o pl.ce           Lrg. riv6,       islmds {d    @d6.                         BTGGLESWADE,DEDS SGTA ATY.
    t:E*      BZSF
                      dilery, d.., (so/p.ct).
                      15'm sdighr b6iiod........ 55.9t
                                                           Bzl's   Cmtlinepact.................516.50
                                                                   1a picc6 7,,1ftd lppmx.
                                                                                                                          (PGid addlg  @ty)
                                                                                                                       TET"TAX(01761 314881
    '',r.'            Squft b6rion fo. sd4ht rus of        azl9s   Blu€rclt(6fr x 2it)......... . 49.95
                      p.lied. (rw!r'p.ck)
                                                                                                                      '/,/z
                                                                                                 \\t,'
5.2 MoraleTable
                                             OUI OF
 ScordRe{ult ROUT         WITHDR,{WINCONTROL                             NAFOLEONIC ARMY & IJNIFORM GUIDES
                                           CONTROL
                                          2,3,4,5
     -2        1       2                  1,4,5
     -3                3                  4.5
               1.2     3,4                5,6
     -5                4.5                6
     -6        1.2.3.4 5,6
                                                                                                              (4,          r'O   PNST^CF& PACKING
A s.or€ of 7 = Automaticrout from field or sunend€rif en€my              iat          r   ; s; ii;i   i,    L,*;    iiij , t;    u@m . .opF' re.
within4'
5,3 MoraleXe.ults
                                                                       routnumb€rtheacdonis indecnive.IJ eithersideiswithin20%of the
               IoCtrtg€Tal                                             otherit isanarginalvictory.Greaterthan20%differem€isdeemed to
                                                                       beadecisive viclor.
 ROI,"I        All unitsanebptingio charg€ Withdrawtobas€lin€  wirh
                                           backto emny atchargerare;
                                           fiiendlyuits wiihh 8'nulr
                                                                                                      6.0 GENERALS
                                                                       GeDerals play animportanlpart in the rules.Theyhavea command
 WITIIDRAW Unirreluctdrlynoves     FaUbet facingthe€oenya!                                    ratingwhichcanbeusedto "Inspire"trooF
                                                                       radiusandanelfectiveness
           forwardal aomalmoven€nl                                     withinlhatcommand  radius.
           rate,I{rheyoaraclthe    Shr!€L
           en€nytheydorot Eceive                                        Grade                              Conm{ddRadius              trtrectiv€ftss
           atrybonusforcharying.                                        Inferior                                    3'                    -l
 INCOmROL UDitcharges asmmal.      Unitcanfightandnovea5                ComDetent                      6'                 +l
                                                                        InsDirational                 t2'
 OUIOF         ChrgeUdomedbvards                                       Cetrerahattachedto unitsin meleeor undereffectivefire (6r€ that
CONTROL                                    toward!nearcsteremyunit     causes
                                                                            10%+ casualties). rolllD 10.arol-lofoindicates
                                                                                                                        theGenenlhas
               uil\ frontalarc.lithey rcut in lheuniashontsle. The
                                                                       beenkilled: a scoreof 1.2indicatesthe Generalhasbeenwounded.
               charge
                    nlov€Dent
                            agaii!                                     WoundedGen€mlsarereducedonegradein status.TwicewouDded
               Er nearesr
                        €nedyur D                                      seneralsar€kiled.
                                                                                                                               59.95
                       BBING & BUY STAND                                         Reverge! Medierralrules (alsocover sieges&
                                                                                 navdlaclions)by Todd Fisher.                 tr2.95
           PARNCIPANOiI
                     ANDDEI'ONSTRAIIONGAiIES
                                                                                 16,14.
                                                                                      ECWrulesftomWargames     Poundry,
                   OwnWalgames
       TheNodheast's         Conventlon                                          A4colourcover.Includescamlraigm  lules& rnap
                                                                                 + armylists
               Adulbtl.5OO.A.P9ll.0o Chlldr.n50p
                                                     Mirdbshrd' r.r(01qa &55s1
                                                                                 P&P:Wi l0% (tnax.t3) Euope: 20%(max.fS)
                                              stdl
                                                                                 Sb.tage|n,18l,ovetBLa!e, Ne$att, Noitr NGA lEZ.
                 WMMMS
                         WEST MIDLAND MILITARY MODELLING SHOW
                          THE MIDLANDS PREMIER ONE DAY SHOW
                                       SUNDAY 9th MARCH T997
                                   ALIJMWELL CEN'I-RE
                                                    .PRIMLEYAVE\IJE,WALSALt
                                         2 MINUTES FROM JUNCTION I |, M6.
                                       OURREGULARTTUDERSINCLUDE}
              AWESOME ENITRPRISES.'N CORPS.ANDY DUMELOW.AVID RE^DER.B & M MODELS.B & B MIN.
              B B. BG(GB). BICORNE,BOOKSTOP BOO(SHOP.BRITANNIA.CHARIOT,DREWS MILITIA.ELLDRBURN
              ARMIES,F & F. F A A.FALCON FIGURES.FIRE FORCE-FIREBASEGAMESFRONTRANK.CALLIA,FTONTLINE
              GLADIATOR CAMIS. IRRECULAR. I K M. LANCNSHIRE GAMES.M M S, MACNETIC DISPLAYS.MAINLY
              MILITARY.PEfER PICKEEP WATGAMING.OLD CLORY.P O P,POLLY OLIVER.Q R F.REDOUBT, SC0TIA.
              SECOAD CHANCE, SHO. SKYTRIX LTD.SNATDRAGON.SOUTHSEA.STRATACEM,TABLETOP G^MES.
              TINSOLDIELTTNF^I,GAR MODELS,fWO DRACONSTYSON BOOKS.,VILLAGE CREEN.HETS^NTS.
              WARCAMES SOUIH. W I A, WARCAMES FOUNDRY.WESTERN MINATURES. PEI\'DRAKEN,..-ETC,
ENQUIRIES:DAVEJARMAN01902847900 GRXGLAWRENCE01922401395
      FTASCOI&2 1997
           Visit oneshowseea secondat half price!!
     Getdiscountson enty to theRoyal ArmouriesMuseum
       throughoutNovember,with a FIASCO programme!
News: Followingoneof the"oneofthe bestonedayshowsin the country',,   FIASCO 1996at the Royal
Armouries Museum, there havebeenbookingdiffculties at this venuefor 1997 The Le€dsWargames
club hasdecidedto run FIAsco at the previousvenue,until we canbe guaranteeda regularJunefi*n'e
at the Armouries.we alsowantedto maiataina presenceat the museurqasthe last showwas so good, so
we will be runninga FIASCO tr at the RoyalArmourieson the lir|t Surday in Novemberin 1997,
1998& 1999.
FIASCO                                                                                   FIASCO II
Saturday2lst June1997                                                       Sunday2nd November1997
Armley sportscentre                                                                 RoyalArmouries
Carr Crofts                                                                         Armouries Drive
Armley, Leeds12                                                                     LeedsCity centre
Doorsoper 10.00for both events.!2 wrgedLl utrwaged.Visit both showsand pay half pricefor the
secotrd.Witb nASCO U programmeyou can get discountedeDtry, to the Royal Armouries
Museum,on and oneday from FL{SCOtr to the endofNovember.
l l\\ . !.\n,,tr,lL,..lrN,l.ltrrLUlirr)j, I
                      s€nbG*r5an3x       rcb''
            D4r',$c|!|dbd's|'e.NahlDbtrc1,{P
                   6r:ic*6lr)6tr"dEEo63s1@
          rr.r&r u( &.rc +rG, d 5.r &@ B.n q.|dr +bt d tar
                                                                                        lmln A liod.lBulldL'F
                                                                    x&Mrej HM'r 16rnl; v,inlv Milir,ryrBint: H!dce' DBionld.dtj D'4ar
                                                                                 Modsls(l5mmNaNrFnic4rdburrdi^q3t
                                                                  shoDoBnTuGsatl10.00rn4.00Dml
                                                                                     1A OONFIDIiATION TUROPEEI\INE
     PETERPIG FIGT]RES+OINK                                                              DEJf,UX O'lflSTOrnE
 ESSEX
     MINIATU
           R ES                                                                                                           EsTABLTsHED
                                                                                                                                  1e7e
                                                          l5mm MACEDO IAII& PI,NICWARS
'P^jcdmiFdtl!..dd'i|4cc*d                                                                          {P r11 hd(nidtHridnrpffi
      rr|6d'gdr,'!'c
'Ppcdmd'.dc{...ddi4cc*q                                    €t'Id..''''...''''....'''''.''''''e5                                      {EPeEr'MlfusDei4d*
                                                                                                                                          'did|lrhffi    .............
                                                                                                                                                                  eE
                                                        ir)d6d4|dsfu''',,%                                                           rPE  Ebbdrddd6.rd.3h
dPl9     Prbfristerlhbrd                          Ee*oh'rddd|fu:*t's
                                                  lrEPe E€drddtulhah                         fre
rP t     J.{tn.(sdpd...)                                                                           xPAre soedbd c|rful'lrtm
                                                                                                                                     rPs     bdi'.ll,ftn    t3F r.dl
                                                           .!furtuidiM.              ........e.6
rr.e{r(Gidoi]]frN                                                                                  sPe     hrydrlbdqd)
                                                           i'i436&rFtu'                    ..es
                                                                                                                                     ds s-riEP en(tu8.rtuddr
{P re rdsdokidim
                                                                                                   (reFrh^furdiF)                    {P '00 ryr,Ittrrruorjd
HP^l'cr)llllJlmeqdry                                                                                                                 xP trr rldits1fr.i     dd$.
IP^P(,fu!6*car!6fudlad
                                                                                                   w^/bctlmbhdlsldad'nY
                                                                                                         ld4IsfuGd'aefu'             xP^'6(,fuF&nfug''nr&.Y
                                                  MPk      G.€lrdtuntuhrdr
                                                                                                   w 2     dh4d.|,eddd               w 16 s4ala.!d$.
                                                  {P r     PtudHbxc      td6                       aP -    cd@bd.€rFv..i.
                                                  uPe      PtudkbRc.ituiho,
                                                                                                                                     uP^r6 ^l&dH.Cb@eM
                                                  xEPmF6hsotrd.@fr                                                                   UP^P ^llfuH.dEPOTI#
uPs      8Jfuds.ldblshrEv         l*.ed           lrcEtu^tfuhh6.u{Prr)
              ESSEXMINIATURES
                            AREMAJOBSTOCKISTS
                                            OFTHEFOLLOWING
                                                         ITEMS:
                    SHOPOPENINGTIMES:
                                  MON-FRt
                                        8.30-5.00,
                                                SAT9.00-1.00                                                                          TELEPHONEOFDEBS
Pclag. dd Packing6cs lor UK& AFPO                                                                                                         01268682309
MinimumPosiago& Peking - 41.5o                                                                                                      FAXOBDEBS   01268510151
OdoEvalue el0-e25:!3.0O                                                                                                                 CrcdnCardOdo's
            !25-e5O:e4.5o
            l5O+:FREEPOST                                                                                                         ACCESS                  VISA
                                                                                                                                     Desparch€d
                                                                                                                                              within2,1houls
          Unitl, ShannonSquare,ThamesEstuaryEstate,Canveylsland,EssexSS8oPE
                                         IT FIGURES!
                                                             P R E S E N T S
                                                                                                  ffioro*onn*
 EUROPE-ADD T5% MIN. i1.OO                          II)WESTOFT, SI'FT,OLK
 RESI OF WORJD- ADD 20%_
 MIN.4r.50                                           NR32 4EN, ENGLAND.
                                                      PHONE: (01502)51834)
                                                                                                 oft JohnsonEood)
                                                                                                 BOX27&ROIITEIOEAST
                                                                                                 TBLADELPnA"WV26050-0278
sEl{D a5 ltNc. P & p u.K, & EUBOPEIFOn OUn Futty ILLUSIFAIED CAiAIOGUE !
15MM. MARLBUFIAN,
               GT.NOFTHERN
                         WAR& INOIANMUTINY
S c e u s a t :
 PLAY FOSTALDIPIOMACY atrd orher boardgames.               Joir ou_r "Dt'xford'97Military& ModelShow".Ther€wil bevariousmodeling
 inexpensive   ad ftiendlyanateurhobby.Cotrtacr    Srephen Agar.?9 d€momtrations     andq,argames   on borhrheSatuidayaDdthe Sunday,
 FloreoceRoad,BrightonBNl 6DL for details.                           with themodelcompetitioN(bothMAFVA andOpenclasss!)otrthe
                                                                     Sunday.   Vehicleswill b€runningbothda's,with ddesavailabl€to the
                        CLIES & SOCIETIES                            public. The Saturdaywill be an ideal time to g€t rhe d€taiisftom
 Gf,IMSBY WARGIMES SOCIETYhas electeda new secr€tary rcstored v€hiclesatte ing the Raly, with more tine for the
 folo\r/itrJitsAG-l!{in January.Forfijnher inlormationpreaseconEcr phologaphicopportunities.     OntheSundayaltemoonwill b€thearem
TimWalker,69TivertonStreel,Cleethorpes.       NorthEastLincolnshire eventsculminating   withthe'Cavalcad€'. ForfurtheriDjornatiotrseoda
 DNJs7PP.Tel:(014?4348S5t.       Theclubisenrering  ils26rhyearand largestampedetrvelopeto PaulMiddteton,39 The Leas,Baldock,
ha| itsow-trpremiseswirhfivetargegamin8rabtesandasnackiar. We Herrs.SG?6HZ.
payany rcrn or ngrregames.boardgames        andcardSames otherrlan SUNDAY6TH AI'ruL T997- MODEXMODBLLINGAND WA.R.
FRP\ andarealwaysotrrhetookourfor ne* btood:W€canbetoud ar GAMf,SDay will be heldat theTo*n Hall, W€lls,Somers€t.                 Trad€
lhe rearof Lad'smithRoad,crinsby, in Si\hiltsStreer.Weareopen stands,demofftrationand panicipationganes. Major modelling
everyMondayandThundayftom7.00D.n.                                    exhibition,gamesq,orlchopdemonstsation.    Fu(her detailsavailable
SOUTIIf,ASTESSEX         MILnARY SOCIETY(S.E.E.M.S)hasmoved ftom Paul Hambleton,60 Ash Lane. Wells. Somers€tBA5 2tS.
ftomtheRochevay      Cenfieaft€r2?years.Ourn€wvenueij,,TheSitver TeWa* 0174916,$42.
JubileeCetrtre",fuk Lane,Srroudcr€en, RocMord,Ess€x.wherew€                                 WARGAME
DeereveryWednesday
                                                                                                         RTJLES
                          ev€njng,ftom 7pmonwards.We alsohave
all.dayandlreekeMgameselery twoor threemon$s.Wecirer for            Nf,W   Wll   WAIIGAME      RIILES: S.ale  6mmbase/lsnm,20mn or
moslp€riodsandscalesandarealwayseagerro rry n€wonesandnew           25mn    figure = 1 idiantry s€ction.Full organisatiomldetailsfor all
Dethocls.Anyoneinrere$edsborddcotrta( Laurie Brvsonat Nine arniesincluded.Usesplastictemplates(included)for both artiltery
Oaks,Soutb     HanningfieldWay.Runwe[,WickJord,                     AND smallarns ftel Fastpaced(andoftenbloodyl)ganesr€sult-
                                                   EssrrS|l 7DT. gr€at
Tel:Dr2tfims58.                                                           tun! Nicetul colourcovertoo! ODly15.50includingU.K. p&p
                                                                    ftom: AgemaPublicatioDs,     3 WorksopRoad,Streiston,Nottingham
                                                                    NC32BA.
                     FORTIICOMING
                                EVENTS
MAFVA NAnON LS 'yt T\e t9y7 Natioml Modet Show &                            50,000+ SECONDHANDWARGAMFI;FIGIIRES
Competitionsof theMiniatureAfV Association                                   Alwaysin stock.All scales.Mostmanufacrues.
                                             will beheldoverthe
weekendof August9th/10that TheImp€rialWar Museun,Dut'ord                             SAEstatinginterestsfor liststo:
Airfield.Cambridged re. England.A\ h previous  years,it will bein
                                                                                            AJ. Dumelow,
conjunclionwirhrheMililary VehicleRally.bul thjsyearwil beover                       53Stat on Road,Stapenhil,
t[e whol€weekend, andrherewillalsobea large-$a]e                                   Burton ou-Tftnt, Strfrs DEIS 9Rp
                                                   rnod€laircrafl                     Tel€phon€:(01283)530556
eveDthappening. Fortbisreasonrle $holeeventwillb€kno$f|asthe
                   When replying to adverts please mention ltrargames lllusbated.
FIRE& FURY. EASTERilSCETARIOBOOK!
                                                          fhe companionto the Great luestem
                                                          BattlesScenarloRook no^vollers
                                                          sevenadditionalAmerican    CivilWar
                                                          battlesto usewith your Frreand
                                                          Fu,y miniaflneswatgamerules.A
                                                          selectionof eastemtheatrebattles
                                                          foughtfrom186l to l862are
                                                          presented,eachcompletewith one
                                                          or morehistoricaland  what-if
                                                          scenarios. specialrulet ordersof
                                                          batde.a detailedbaftlefieldterain
                                                          map,a timerecordchan,and
                                                          historicalbackground.Twelve
                                                          scenarios in allhavebeenplaytested
                                                          to accommodate               games
                                                                            multi-player
                                                          andoffera wide rangeof gaming
                                                          experiences. Thisbook provides
                                                          scenario
                                                                 infomationonly